F311494

General Info

Members Datasets Scaffolds Average Seq Length
203 127 406 271

Family's Representative Sequence

Representative Sequence 3300039437|Ga0436365_1371573|Ga0436365_1371573_14608_15495
Length 295
Sequence MGSGTAVEWLAPSSLEEALALRASRGADTTVVAGGSFLAILMNQGFVQPTSLLSLGGVGELRGIAVVDGELRLGAMVRHRDVERDPVIRRDWPVLSLGFGLVASPRVRNQATVGGVLADADYASDPPAVLCAVGARAVLRSPRGERQVPIDELILGFYETCIAEDELLTEVRVPAVLGPAVYRKFRSRSSEDRPCVAVAAARSADRLRVVVGACADVPQHYPDVCAKGSEGPIDAAVAREIGSAYAQRMAPLSDSRGSAEYRRRVVAVEVRRAVEMLGSDSVGNGGGRRGAGANR

Samples

Sample ID Description Type Environment
1 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
32 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
35 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
67 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
69 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
82 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
83 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
84 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
92 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
93 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
101 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
106 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
107 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
108 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
109 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
110 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
111 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
112 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
113 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
114 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
115 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
116 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
117 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
118 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
119 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
120 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
121 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
124 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
125 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
126 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
127 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.4
Rhizosphere 87.68
Stem 0
Stem Tuber 0
Unclassified 3.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436365_1371573 3300039437 Bacteria 21290
2 Ga0070690_100210398 3300005330 Bacteria 1357
3 Ga0068869_100304138 3300005334 Bacteria 1288
4 Ga0070682_100131125 3300005337 Bacteria 1697
5 Ga0068868_100020195 3300005338 Bacteria 5001
6 Ga0070660_100129427 3300005339 Bacteria 2019
7 Ga0070689_100111693 3300005340 Bacteria 2174
8 Ga0070691_10052438 3300005341 Bacteria 1950
9 Ga0070687_100019251 3300005343 Bacteria 3172
10 Ga0070668_100212457 3300005347 Bacteria 1592
11 Ga0070688_100071543 3300005365 Bacteria 2221
12 Ga0070667_100381272 3300005367 Bacteria 1281
13 Ga0070711_100048967 3300005439 Bacteria 2893
14 Ga0070708_100081145 3300005445 Bacteria 2936
15 Ga0070708_100187565 3300005445 Unclassified 1934
16 Ga0070663_100123772 3300005455 Bacteria 1956
17 Ga0068867_100233971 3300005459 Bacteria 1486
18 Ga0070679_100192835 3300005530 Bacteria 2006
19 Ga0070684_100434264 3300005535 Bacteria 1213
20 Ga0070686_100067115 3300005544 Bacteria 2336
21 Ga0070664_100256487 3300005564 Bacteria 1573
22 Ga0068857_100456572 3300005577 Bacteria 1195
23 Ga0068854_100098030 3300005578 Bacteria 2192
24 Ga0068854_100484426 3300005578 Bacteria 1039
25 Ga0068852_100112069 3300005616 Bacteria 2482
26 Ga0068859_100142708 3300005617 Bacteria 2469
27 Ga0068861_100197105 3300005719 Bacteria 1688
28 Ga0068870_10282015 3300005840 Unclassified 1042
29 Ga0068863_100489981 3300005841 Bacteria 1210
30 Ga0068858_100259210 3300005842 Bacteria 1652
31 Ga0068860_100022712 3300005843 Bacteria 6065
32 Ga0081455_10023580 3300005937 Bacteria 5724
33 Ga0081538_10001285 3300005981 Bacteria 26085
34 Ga0081538_10009202 3300005981 Bacteria 8277
35 Ga0081538_10030863 3300005981 Bacteria 3628
36 Ga0081538_10043795 3300005981 Bacteria 2803
37 Ga0081538_10071587 3300005981 Bacteria 1906
38 Ga0081538_10119646 3300005981 Unclassified 1269
39 Ga0070712_100128462 3300006175 Bacteria 1918
40 Ga0070712_100131813 3300006175 Bacteria 1895
41 Ga0075428_100076634 3300006844 Bacteria 3650
42 Ga0075428_100083278 3300006844 Bacteria 3490
43 Ga0075434_100151542 3300006871 Bacteria 2339
44 Ga0075434_100382632 3300006871 Bacteria 1428
45 Ga0068865_100194750 3300006881 Bacteria 1570
46 Ga0097620_100142707 3300006931 Bacteria 2469
47 Ga0111539_10272989 3300009094 Bacteria 1968
48 Ga0111539_10352911 3300009094 Unclassified 1712
49 Ga0105245_10014540 3300009098 Bacteria 6853
50 Ga0105247_10155963 3300009101 Bacteria 1508
51 Ga0114129_10459748 3300009147 Bacteria 1668
52 Ga0105243_10139907 3300009148 Bacteria 2064
53 Ga0105243_10331963 3300009148 Bacteria 1389
54 Ga0105249_10025462 3300009553 Bacteria 5327
55 Ga0105249_10310055 3300009553 Bacteria 1586
56 Ga0157372_10802692 3300013307 Bacteria 1093
57 Ga0157375_10105950 3300013308 Bacteria 2903
58 Ga0157375_10682477 3300013308 Bacteria 1182
59 Ga0157379_10078033 3300014968 Bacteria 2966
60 Ga0213876_10072318 3300021384 Bacteria 1821
61 Ga0213875_10000268 3300021388 Bacteria 51367
62 Ga0213875_10015284 3300021388 Bacteria 3735
63 Ga0213875_10054118 3300021388 Bacteria 1880
64 Ga0207693_10046757 3300025915 Bacteria 3400
65 Ga0207662_10017488 3300025918 Bacteria 4057
66 Ga0207687_10005997 3300025927 Bacteria 8041
67 Ga0207687_10054895 3300025927 Bacteria 2789
68 Ga0207706_10122246 3300025933 Bacteria 2289
69 Ga0207709_10222884 3300025935 Bacteria 1361
70 Ga0207670_10062749 3300025936 Bacteria 2540
71 Ga0207661_10350516 3300025944 Bacteria 1332
72 Ga0207712_10045676 3300025961 Bacteria 3034
73 Ga0207668_10035287 3300025972 Bacteria 3328
74 Ga0207640_10164106 3300025981 Bacteria 1647
75 Ga0207677_10099195 3300026023 Bacteria 2138
76 Ga0207703_10380705 3300026035 Bacteria 1305
77 Ga0207678_10241311 3300026067 Bacteria 1547
78 Ga0207708_10065053 3300026075 Bacteria 2787
79 Ga0207708_10366536 3300026075 Bacteria 1185
80 Ga0207648_10152910 3300026089 Bacteria 2036
81 Ga0207676_10071589 3300026095 Bacteria 2784
82 Ga0207675_100019598 3300026118 Bacteria 6314
83 Ga0207675_100112327 3300026118 Bacteria 2571
84 Ga0207698_10051634 3300026142 Bacteria 3145
85 Ga0207428_10173232 3300027907 Bacteria 1633
86 Ga0268264_10015399 3300028381 Bacteria 6270
87 Ga0268264_10453540 3300028381 Bacteria 1243
88 Ga0307405_10556983 3300031731 Bacteria 929
89 Ga0307410_10166624 3300031852 Unclassified 1656
90 Ga0307410_10302295 3300031852 Bacteria 1263
91 Ga0307406_10152210 3300031901 Bacteria 1652
92 Ga0307407_10077417 3300031903 Bacteria 2000
93 Ga0307409_100120048 3300031995 Bacteria 2224
94 Ga0307409_100131818 3300031995 Bacteria 2137
95 Ga0307409_100391155 3300031995 Bacteria 1325
96 Ga0307416_100066175 3300032002 Bacteria 2974
97 Ga0307416_100121785 3300032002 Bacteria 2327
98 Ga0307416_100375146 3300032002 Bacteria 1450
99 Ga0307411_10163633 3300032005 Bacteria 1670
100 Ga0307411_10246686 3300032005 Bacteria 1402
101 Ga0307415_100149698 3300032126 Bacteria 1795
102 Ga0307415_100209715 3300032126 Bacteria 1553
103 Ga0395899_0321607 3300037312 Bacteria 1042
104 Ga0395900_0392366 3300037418 Bacteria 1354
105 Ga0395898_0078247 3300037466 Bacteria 3191
106 Ga0395905_0084296 3300037471 Bacteria 2977
107 Ga0395905_0167195 3300037471 Bacteria 2067
108 Ga0395905_0266413 3300037471 Bacteria 1599
109 Ga0436364_0798736 3300037853 Bacteria 130922
110 Ga0436364_0835680 3300037853 Bacteria 25994
111 Ga0436364_0954524 3300037853 Bacteria 5153
112 Ga0395901_0072641 3300038443 Bacteria 3587
113 Ga0395901_0194187 3300038443 Bacteria 2129
114 Ga0395901_0225903 3300038443 Bacteria 1956
115 Ga0395901_0803885 3300038443 Unclassified 929
116 Ga0436365_0336833 3300039437 Bacteria 21259
117 Ga0436365_0722043 3300039437 Bacteria 13262
118 Ga0436363_0959379 3300039450 Bacteria 5869
119 Ga0436363_1613959 3300039450 Bacteria 8982
120 Ga0466963_0007792 3300044694 Bacteria 6403
121 Ga0466963_0054441 3300044694 Bacteria 2659
122 Ga0466968_0152217 3300044735 Bacteria 1064
123 Ga0466970_0143306 3300044765 Bacteria 1317
124 Ga0466959_0164946 3300045049 Bacteria 1556
125 Ga0466958_0050988 3300045836 Bacteria 2505
126 Ga0466958_0061569 3300045836 Bacteria 2287
127 Ga0466967_0000383 3300045976 Bacteria 20618
128 Ga0466967_0005043 3300045976 Bacteria 9052
129 Ga0466967_0097829 3300045976 Bacteria 2679
130 Ga0466967_0337228 3300045976 Bacteria 1457
131 Ga0466967_0373340 3300045976 Bacteria 1384
132 Ga0466967_0454128 3300045976 Bacteria 1253
133 Ga0496102_0512702 3300048905 Bacteria 1122
134 Ga0496105_0031418 3300048908 Bacteria 4353
135 Ga0496106_0056244 3300048909 Bacteria 2974
136 Ga0496108_0001307 3300048911 Bacteria 19598
137 Ga0496109_0168254 3300048912 Bacteria 2056
138 Ga0496109_0533725 3300048912 Bacteria 1107
139 Ga0496110_0037045 3300048913 Bacteria 4238
140 Ga0496110_0063640 3300048913 Bacteria 3259
141 Ga0496110_0506664 3300048913 Bacteria 1099
142 Ga0496111_0000537 3300048914 Bacteria 19640
143 Ga0496111_0040461 3300048914 Bacteria 3343
144 Ga0496113_0123835 3300048916 Bacteria 2024
145 Ga0496114_0143500 3300048917 Bacteria 2069
146 Ga0501031_0244339 3300049568 Bacteria 1167
147 Ga0501033_0623865 3300049570 Bacteria 738
148 Ga0501039_0032065 3300049575 Bacteria 4050
149 Ga0501039_0087769 3300049575 Bacteria 2423
150 Ga0501040_0039767 3300049576 Bacteria 3199
151 Ga0501040_0311933 3300049576 Bacteria 1125
152 Ga0501042_0072943 3300049578 Bacteria 2456
153 Ga0501043_0160844 3300049579 Bacteria 1754
154 Ga0501046_0029608 3300049580 Bacteria 4450
155 Ga0501046_0270152 3300049580 Bacteria 1247
156 Ga0501048_0114047 3300049582 Bacteria 1909
157 Ga0501048_0489800 3300049582 Bacteria 881
158 Ga0501067_0003975 3300049583 Bacteria 8160
159 Ga0501068_0042901 3300049584 Bacteria 2720
160 Ga0501069_0006480 3300049585 Bacteria 6120
161 Ga0501071_0097195 3300049587 Bacteria 2168
162 Ga0501071_0099540 3300049587 Bacteria 2142
163 Ga0501071_0223685 3300049587 Bacteria 1417
164 Ga0501071_0291689 3300049587 Bacteria 1235
165 Ga0501072_0057089 3300049588 Bacteria 3076
166 Ga0501072_0322825 3300049588 Bacteria 1227
167 Ga0501072_0329856 3300049588 Bacteria 1212
168 Ga0501072_0398067 3300049588 Bacteria 1092
169 Ga0501074_0119453 3300049590 Bacteria 1885
170 Ga0501075_0020922 3300049591 Bacteria 4766
171 Ga0501075_0064484 3300049591 Bacteria 2763
172 Ga0501075_0125522 3300049591 Bacteria 1954
173 Ga0501075_0544178 3300049591 Bacteria 886
174 Ga0501076_0031063 3300049592 Bacteria 4163
175 Ga0501076_0093155 3300049592 Bacteria 2424
176 Ga0501076_0148127 3300049592 Bacteria 1909
177 Ga0501077_0012509 3300049593 Bacteria 5313
178 Ga0501077_0017030 3300049593 Bacteria 4583
179 Ga0501077_0039574 3300049593 Bacteria 3004
180 Ga0501079_0044565 3300049741 Bacteria 3423
181 Ga0501079_0070312 3300049741 Bacteria 2703
182 Ga0501079_0218035 3300049741 Bacteria 1490
183 Ga0501079_0357569 3300049741 Bacteria 1144
184 Ga0501080_0255487 3300049742 Bacteria 1597
185 Ga0501035_0455756 3300049822 Bacteria 1057
186 nmdc:mga05p37_19787_c1 3300050507 Bacteria 8143
187 nmdc:mga09592_95335_c1 3300050508 Bacteria 2545
188 nmdc:mga08y16_824525_c1 3300050511 Bacteria 919
189 nmdc:mga0n895_109859_c1 3300050512 Bacteria 2772
190 nmdc:mga0n895_57528_c1 3300050512 Bacteria 3832
191 Ga0501084_0059804 3300054114 Bacteria 3190
192 Ga0501084_0066791 3300054114 Bacteria 3009
193 Ga0501084_0151204 3300054114 Bacteria 1957
194 Ga0590071_007042 3300059421 Bacteria 2662
195 Ga0590074_008316 3300059423 Bacteria 1728
196 Ga0501082_0094580 3300060353 Bacteria 2582
197 Ga0501082_0131003 3300060353 Bacteria 2176
198 Ga0466962_0017383 3300061719 Bacteria 3463
199 Ga0530510_0051112 3300061734 Bacteria 2986
200 Ga0530510_0091954 3300061734 Bacteria 2214
201 Ga0530510_0118201 3300061734 Bacteria 1945
202 Ga0530510_0126547 3300061734 Bacteria 1878
203 Ga0530510_0352052 3300061734 Unclassified 1106
204 Ga0436365_1371573
205 Ga0070690_100210398
206 Ga0068869_100304138
207 Ga0070682_100131125
208 Ga0068868_100020195
209 Ga0070660_100129427
210 Ga0070689_100111693
211 Ga0070691_10052438
212 Ga0070687_100019251
213 Ga0070668_100212457
214 Ga0070688_100071543
215 Ga0070667_100381272
216 Ga0070711_100048967
217 Ga0070708_100081145
218 Ga0070708_100187565
219 Ga0070663_100123772
220 Ga0068867_100233971
221 Ga0070679_100192835
222 Ga0070684_100434264
223 Ga0070686_100067115
224 Ga0070664_100256487
225 Ga0068857_100456572
226 Ga0068854_100098030
227 Ga0068854_100484426
228 Ga0068852_100112069
229 Ga0068859_100142708
230 Ga0068861_100197105
231 Ga0068870_10282015
232 Ga0068863_100489981
233 Ga0068858_100259210
234 Ga0068860_100022712
235 Ga0081455_10023580
236 Ga0081538_10001285
237 Ga0081538_10009202
238 Ga0081538_10030863
239 Ga0081538_10043795
240 Ga0081538_10071587
241 Ga0081538_10119646
242 Ga0070712_100128462
243 Ga0070712_100131813
244 Ga0075428_100076634
245 Ga0075428_100083278
246 Ga0075434_100151542
247 Ga0075434_100382632
248 Ga0068865_100194750
249 Ga0097620_100142707
250 Ga0111539_10272989
251 Ga0111539_10352911
252 Ga0105245_10014540
253 Ga0105247_10155963
254 Ga0114129_10459748
255 Ga0105243_10139907
256 Ga0105243_10331963
257 Ga0105249_10025462
258 Ga0105249_10310055
259 Ga0157372_10802692
260 Ga0157375_10105950
261 Ga0157375_10682477
262 Ga0157379_10078033
263 Ga0213876_10072318
264 Ga0213875_10000268
265 Ga0213875_10015284
266 Ga0213875_10054118
267 Ga0207693_10046757
268 Ga0207662_10017488
269 Ga0207687_10005997
270 Ga0207687_10054895
271 Ga0207706_10122246
272 Ga0207709_10222884
273 Ga0207670_10062749
274 Ga0207661_10350516
275 Ga0207712_10045676
276 Ga0207668_10035287
277 Ga0207640_10164106
278 Ga0207677_10099195
279 Ga0207703_10380705
280 Ga0207678_10241311
281 Ga0207708_10065053
282 Ga0207708_10366536
283 Ga0207648_10152910
284 Ga0207676_10071589
285 Ga0207675_100019598
286 Ga0207675_100112327
287 Ga0207698_10051634
288 Ga0207428_10173232
289 Ga0268264_10015399
290 Ga0268264_10453540
291 Ga0307405_10556983
292 Ga0307410_10166624
293 Ga0307410_10302295
294 Ga0307406_10152210
295 Ga0307407_10077417
296 Ga0307409_100120048
297 Ga0307409_100131818
298 Ga0307409_100391155
299 Ga0307416_100066175
300 Ga0307416_100121785
301 Ga0307416_100375146
302 Ga0307411_10163633
303 Ga0307411_10246686
304 Ga0307415_100149698
305 Ga0307415_100209715
306 Ga0395899_0321607
307 Ga0395900_0392366
308 Ga0395898_0078247
309 Ga0395905_0084296
310 Ga0395905_0167195
311 Ga0395905_0266413
312 Ga0436364_0798736
313 Ga0436364_0835680
314 Ga0436364_0954524
315 Ga0395901_0072641
316 Ga0395901_0194187
317 Ga0395901_0225903
318 Ga0395901_0803885
319 Ga0436365_0336833
320 Ga0436365_0722043
321 Ga0436363_0959379
322 Ga0436363_1613959
323 Ga0466963_0007792
324 Ga0466963_0054441
325 Ga0466968_0152217
326 Ga0466970_0143306
327 Ga0466959_0164946
328 Ga0466958_0050988
329 Ga0466958_0061569
330 Ga0466967_0000383
331 Ga0466967_0005043
332 Ga0466967_0097829
333 Ga0466967_0337228
334 Ga0466967_0373340
335 Ga0466967_0454128
336 Ga0496102_0512702
337 Ga0496105_0031418
338 Ga0496106_0056244
339 Ga0496108_0001307
340 Ga0496109_0168254
341 Ga0496109_0533725
342 Ga0496110_0037045
343 Ga0496110_0063640
344 Ga0496110_0506664
345 Ga0496111_0000537
346 Ga0496111_0040461
347 Ga0496113_0123835
348 Ga0496114_0143500
349 Ga0501031_0244339
350 Ga0501033_0623865
351 Ga0501039_0032065
352 Ga0501039_0087769
353 Ga0501040_0039767
354 Ga0501040_0311933
355 Ga0501042_0072943
356 Ga0501043_0160844
357 Ga0501046_0029608
358 Ga0501046_0270152
359 Ga0501048_0114047
360 Ga0501048_0489800
361 Ga0501067_0003975
362 Ga0501068_0042901
363 Ga0501069_0006480
364 Ga0501071_0097195
365 Ga0501071_0099540
366 Ga0501071_0223685
367 Ga0501071_0291689
368 Ga0501072_0057089
369 Ga0501072_0322825
370 Ga0501072_0329856
371 Ga0501072_0398067
372 Ga0501074_0119453
373 Ga0501075_0020922
374 Ga0501075_0064484
375 Ga0501075_0125522
376 Ga0501075_0544178
377 Ga0501076_0031063
378 Ga0501076_0093155
379 Ga0501076_0148127
380 Ga0501077_0012509
381 Ga0501077_0017030
382 Ga0501077_0039574
383 Ga0501079_0044565
384 Ga0501079_0070312
385 Ga0501079_0218035
386 Ga0501079_0357569
387 Ga0501080_0255487
388 Ga0501035_0455756
389 nmdc:mga05p37_19787_c1
390 nmdc:mga09592_95335_c1
391 nmdc:mga08y16_824525_c1
392 nmdc:mga0n895_109859_c1
393 nmdc:mga0n895_57528_c1
394 Ga0501084_0059804
395 Ga0501084_0066791
396 Ga0501084_0151204
397 Ga0590071_007042
398 Ga0590074_008316
399 Ga0501082_0094580
400 Ga0501082_0131003
401 Ga0466962_0017383
402 Ga0530510_0051112
403 Ga0530510_0091954
404 Ga0530510_0118201
405 Ga0530510_0126547
406 Ga0530510_0352052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

5

176

0.99

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

180

277

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9213 4 276
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9203 6 276
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9182 6 276
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.918 6 276
7dqx-assembly1.cif.gz_E crystal structure of xanthine dehydrogenase family protein 0.915 5 276
ID Description Score Start End Superfamily
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9636 60 173 3.30.465.10
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9594 58 174 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9563 60 173 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9555 60 173 3.30.465.10
4zohB02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9479 60 173 3.30.465.10
ID Description Score Start End GO Terms
AF-X1R0Y1-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9691 6 175 GO:0016491
GO:0071949
AF-A0A535K826-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9634 3 145 GO:0016491
GO:0071949
AF-A0A838HGK8-F1-model_v4 FAD binding domain-containing protein 0.9588 4 177 GO:0016491
GO:0071949
AF-A0A535BI47-F1-model_v4 FAD-binding PCMH-type domain-containing protein 0.9558 6 175 GO:0016491
GO:0071949
AF-A0A132NJK2-F1-model_v4 Molybdopterin dehydrogenase 0.9553 6 170 GO:0016491
GO:0071949

Map