F311163

General Info

Members Datasets Scaffolds Average Seq Length
203 160 406 157

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10081173|Ga0105245_100811732
Length 178
Sequence MIAKLLMLDKPHRVGDTGGMHHYTAQITWQRGSQDFLGNRYSRRHLIRFDGGAEMPGSSSPHVVPVPLSDPSAVDPEETFVASLSSCHMLWFLSLAAKAGFCVDSYADQAEGVMARNAAGKMAMTVVTLRPRVVFSGDKRPTSEQLHELHHRAHEECFIANSVTTDVRCEPVESPEAA

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
57 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
58 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
61 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
62 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
63 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
107 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
108 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
109 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
110 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
111 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
112 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
113 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
118 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
119 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
120 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
121 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
122 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
123 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
130 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
134 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
135 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
136 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
137 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
140 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
141 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
146 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
147 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
148 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
149 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
152 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
153 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
156 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
160 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.9
Nodule 0
Rhizoplane 0
Rhizosphere 89.66
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10081173 3300009098 Bacteria 2964
2 Ga0070670_100898829 3300005331 Bacteria 803
3 Ga0068869_100078007 3300005334 Bacteria 2466
4 Ga0070666_10018422 3300005335 Bacteria 4489
5 Ga0070666_10391418 3300005335 Bacteria 998
6 Ga0070660_100384328 3300005339 Unclassified 1159
7 Ga0070689_100057414 3300005340 Bacteria 3021
8 Ga0070661_100020969 3300005344 Bacteria 4665
9 Ga0070661_100532161 3300005344 Bacteria 944
10 Ga0070675_100007765 3300005354 Bacteria 8305
11 Ga0070671_100681161 3300005355 Unclassified 891
12 Ga0070674_100261348 3300005356 Bacteria 1364
13 Ga0070674_100979498 3300005356 Bacteria 741
14 Ga0070673_100015902 3300005364 Bacteria 5301
15 Ga0070673_100638240 3300005364 Bacteria 974
16 Ga0070667_100356599 3300005367 Bacteria 1325
17 Ga0070714_101059837 3300005435 Bacteria 790
18 Ga0070714_101201334 3300005435 Bacteria 740
19 Ga0070713_100151492 3300005436 Bacteria 2063
20 Ga0070711_100024058 3300005439 Bacteria 3969
21 Ga0070700_100832660 3300005441 Bacteria 746
22 Ga0070708_100013066 3300005445 Bacteria 6789
23 Ga0070678_100110942 3300005456 Bacteria 2146
24 Ga0070678_101583969 3300005456 Bacteria 615
25 Ga0068867_100223407 3300005459 Bacteria 1519
26 Ga0068867_100734352 3300005459 Bacteria 874
27 Ga0070685_10032483 3300005466 Bacteria 2923
28 Ga0070706_100965726 3300005467 Bacteria 786
29 Ga0070699_100003826 3300005518 Bacteria 13298
30 Ga0070679_100120680 3300005530 Bacteria 2607
31 Ga0070679_100504512 3300005530 Bacteria 1154
32 Ga0070684_101548514 3300005535 Unclassified 625
33 Ga0070697_100169723 3300005536 Bacteria 1846
34 Ga0070672_100002860 3300005543 Bacteria 11083
35 Ga0070672_100216972 3300005543 Bacteria 1604
36 Ga0070672_100470241 3300005543 Bacteria 1085
37 Ga0070665_100218461 3300005548 Bacteria 1906
38 Ga0070704_100167310 3300005549 Bacteria 1745
39 Ga0068855_100339744 3300005563 Unclassified 1656
40 Ga0070664_100299967 3300005564 Bacteria 1452
41 Ga0070702_100541346 3300005615 Bacteria 862
42 Ga0070702_100712369 3300005615 Bacteria 766
43 Ga0068859_100134341 3300005617 Bacteria 2546
44 Ga0068859_100376044 3300005617 Bacteria 1516
45 Ga0068864_101545747 3300005618 Bacteria 667
46 Ga0068864_101574559 3300005618 Bacteria 661
47 Ga0068863_100184857 3300005841 Bacteria 2001
48 Ga0068863_100298406 3300005841 Bacteria 1563
49 Ga0068862_100180658 3300005844 Bacteria 1893
50 Ga0075432_10012767 3300006058 Bacteria 2853
51 Ga0070716_100705480 3300006173 Unclassified 771
52 Ga0075366_10216924 3300006195 Bacteria 1165
53 Ga0097621_101857392 3300006237 Bacteria 575
54 Ga0075430_100119245 3300006846 Unclassified 2199
55 Ga0075431_100451213 3300006847 Bacteria 1282
56 Ga0097620_100134333 3300006931 Bacteria 2546
57 Ga0097620_100376026 3300006931 Bacteria 1516
58 Ga0075435_100119133 3300007076 Unclassified 2201
59 Ga0111539_11875330 3300009094 Bacteria 695
60 Ga0114129_10674883 3300009147 Bacteria 1331
61 Ga0105241_10123172 3300009174 Bacteria 2091
62 Ga0105241_11178611 3300009174 Bacteria 725
63 Ga0105242_10007864 3300009176 Bacteria 8206
64 Ga0105248_10087044 3300009177 Bacteria 3515
65 Ga0105248_10999567 3300009177 Bacteria 945
66 Ga0105249_10056235 3300009553 Bacteria 3602
67 Ga0157371_10373054 3300013102 Bacteria 1041
68 Ga0157374_10021321 3300013296 Bacteria 5764
69 Ga0157374_10082616 3300013296 Bacteria 3051
70 Ga0157374_10318081 3300013296 Unclassified 1542
71 Ga0157374_11004981 3300013296 Bacteria 853
72 Ga0157378_10005188 3300013297 Bacteria 11436
73 Ga0157378_10323275 3300013297 Bacteria 1499
74 Ga0163162_10041825 3300013306 Bacteria 4585
75 Ga0163162_10855889 3300013306 Bacteria 1024
76 Ga0157375_10009162 3300013308 Bacteria 8675
77 Ga0157375_10136135 3300013308 Bacteria 2580
78 Ga0157375_10285969 3300013308 Bacteria 1812
79 Ga0157375_10907831 3300013308 Unclassified 1024
80 Ga0157375_11646004 3300013308 Bacteria 759
81 Ga0163163_10027652 3300014325 Bacteria 5436
82 Ga0157380_11397954 3300014326 Bacteria 750
83 Ga0157380_11833202 3300014326 Bacteria 666
84 Ga0157377_10855924 3300014745 Bacteria 675
85 Ga0157379_10850334 3300014968 Bacteria 863
86 Ga0157376_10011541 3300014969 Bacteria 6518
87 Ga0157376_10691175 3300014969 Bacteria 1024
88 Ga0182007_10118756 3300015262 Bacteria 884
89 Ga0183362_10001 3300015683 Bacteria 2046624
90 Ga0213872_10005176 3300021361 Bacteria 6749
91 Ga0207680_10128180 3300025903 Bacteria 1669
92 Ga0207680_10618156 3300025903 Bacteria 775
93 Ga0207645_10472605 3300025907 Bacteria 847
94 Ga0207649_10000405 3300025920 Bacteria 32001
95 Ga0207652_10609682 3300025921 Bacteria 978
96 Ga0207681_10310873 3300025923 Bacteria 1250
97 Ga0207694_10779367 3300025924 Bacteria 807
98 Ga0207650_10175696 3300025925 Bacteria 1704
99 Ga0207659_10006320 3300025926 Bacteria 7250
100 Ga0207700_10223571 3300025928 Bacteria 1597
101 Ga0207686_10121652 3300025934 Bacteria 1778
102 Ga0207670_10047666 3300025936 Bacteria 2856
103 Ga0207670_10166033 3300025936 Bacteria 1652
104 Ga0207669_10369662 3300025937 Bacteria 1114
105 Ga0207704_10047080 3300025938 Bacteria 2575
106 Ga0207691_10174133 3300025940 Bacteria 1883
107 Ga0207691_10363270 3300025940 Bacteria 1237
108 Ga0207689_10097424 3300025942 Bacteria 2416
109 Ga0207661_11302779 3300025944 Bacteria 668
110 Ga0207667_10319777 3300025949 Bacteria 1585
111 Ga0207651_10215568 3300025960 Bacteria 1548
112 Ga0207712_10791922 3300025961 Bacteria 833
113 Ga0207668_11319537 3300025972 Bacteria 650
114 Ga0207658_10547488 3300025986 Bacteria 1035
115 Ga0207658_10704361 3300025986 Bacteria 913
116 Ga0207677_10011868 3300026023 Bacteria 4986
117 Ga0207703_10314997 3300026035 Bacteria 1431
118 Ga0207708_10663685 3300026075 Bacteria 889
119 Ga0207641_10061993 3300026088 Bacteria 3190
120 Ga0207648_10070825 3300026089 Bacteria 3039
121 Ga0207648_10240078 3300026089 Bacteria 1613
122 Ga0207676_10779515 3300026095 Unclassified 931
123 Ga0207683_10007155 3300026121 Bacteria 9568
124 Ga0207683_10128467 3300026121 Bacteria 2279
125 Ga0207428_10217916 3300027907 Bacteria 1432
126 Ga0268266_10315137 3300028379 Bacteria 1462
127 Ga0268266_11188904 3300028379 Bacteria 737
128 Ga0268265_10769372 3300028380 Bacteria 936
129 Ga0265334_10049347 3300028573 Bacteria 1619
130 Ga0265324_10023122 3300029957 Bacteria 2217
131 Ga0265331_10020768 3300031250 Bacteria 3366
132 Ga0307509_10000978 3300031507 Bacteria 48968
133 Ga0307509_10281072 3300031507 Bacteria 1425
134 Ga0307408_101060990 3300031548 Bacteria 750
135 Ga0307508_10127941 3300031616 Bacteria 2143
136 Ga0316575_10007517 3300031665 Bacteria 3947
137 Ga0265314_10024787 3300031711 Bacteria 4540
138 Ga0307507_10098121 3300033179 Bacteria 2468
139 Ga0307510_10001484 3300033180 Bacteria 25882
140 Ga0373937_0551511 3300036401 Bacteria 1095
141 Ga0395901_0086932 3300038443 Bacteria 3269
142 Ga0395901_1256159 3300038443 Unclassified 704
143 Ga0436365_1460051 3300039437 Bacteria 1747
144 Ga0436361_0124622 3300039447 Bacteria 10744
145 Ga0436361_1187360 3300039447 Unclassified 1172
146 Ga0436363_1538480 3300039450 Bacteria 797
147 Ga0439441_010495 3300042001 Bacteria 1554
148 Ga0439445_0003038 3300042004 Bacteria 3756
149 Ga0451577_1110914 3300042876 Bacteria 707
150 Ga0466972_0000084 3300044658 Bacteria 86336
151 Ga0453683_0335430 3300044673 Bacteria 970
152 Ga0453684_0025498 3300044712 Bacteria 8580
153 Ga0451576_0498422 3300045051 Bacteria 1279
154 Ga0495629_0337746 3300046459 Bacteria 1029
155 Ga0495638_0182537 3300046460 Bacteria 1196
156 Ga0495662_0048961 3300046476 Bacteria 2040
157 Ga0495664_0049945 3300046477 Bacteria 2483
158 Ga0495618_0007012 3300046514 Bacteria 6828
159 Ga0495628_0031970 3300046516 Bacteria 4252
160 Ga0495630_0011505 3300046517 Bacteria 6408
161 Ga0495666_0203617 3300046526 Unclassified 909
162 Ga0495640_0022267 3300046533 Bacteria 4635
163 Ga0495586_0008168 3300046535 Bacteria 5577
164 Ga0495586_0144060 3300046535 Unclassified 1338
165 Ga0495586_0560479 3300046535 Unclassified 660
166 Ga0495645_0052987 3300046543 Unclassified 2950
167 Ga0495622_0122490 3300046557 Bacteria 1187
168 Ga0495635_0545709 3300046663 Bacteria 760
169 Ga0495599_0079363 3300046678 Bacteria 2049
170 Ga0495658_0074329 3300046683 Bacteria 1980
171 Ga0495624_0029769 3300046690 Unclassified 3561
172 Ga0495624_0522540 3300046690 Unclassified 709
173 Ga0495600_0290712 3300046809 Bacteria 1033
174 Ga0495604_0148531 3300047317 Unclassified 1668
175 Ga0495674_0770029 3300047319 Bacteria 751
176 Ga0495686_0276073 3300047472 Bacteria 935
177 Ga0501036_0408933 3300049572 Bacteria 1132
178 Ga0501040_1002164 3300049576 Bacteria 606
179 Ga0501047_0281479 3300049581 Bacteria 1508
180 Ga0501047_0625961 3300049581 Bacteria 897
181 Ga0501070_0890088 3300049586 Bacteria 695
182 Ga0501076_0153171 3300049592 Bacteria 1876
183 nmdc:mga06z11_479852_c1 3300050494 Bacteria 752
184 nmdc:mga09592_848749_c1 3300050508 Unclassified 770
185 nmdc:mga0qj67_306861_c1 3300050509 Bacteria 1286
186 nmdc:mga06r32_452244_c1 3300050510 Bacteria 1264
187 nmdc:mga08y16_1297659_c1 3300050511 Bacteria 695
188 nmdc:mga0n895_383273_c1 3300050512 Bacteria 1422
189 nmdc:mga0rr50_207467_c1 3300050513 Unclassified 1613
190 Ga0495601_0359441 3300053077 Bacteria 946
191 Ga0500610_0307127 3300053079 Unclassified 696
192 Ga0500646_0279006 3300053090 Bacteria 595
193 Ga0500583_0256879 3300053092 Bacteria 862
194 Ga0500650_0000153 3300053098 Bacteria 18041
195 Ga0500607_073433 3300053121 Bacteria 1761
196 Ga0500652_033237 3300053131 Bacteria 2037
197 Ga0500652_041972 3300053131 Bacteria 1844
198 Ga0500658_0004331 3300053134 Bacteria 5320
199 Ga0500577_0115041 3300053142 Bacteria 1114
200 Ga0500604_0027539 3300053151 Bacteria 1645
201 Ga0500616_0000388 3300053153 Bacteria 61251
202 Ga0500637_0075981 3300053178 Bacteria 1937
203 Ga0501082_1654767 3300060353 Bacteria 559
204 Ga0105245_10081173
205 Ga0070670_100898829
206 Ga0068869_100078007
207 Ga0070666_10018422
208 Ga0070666_10391418
209 Ga0070660_100384328
210 Ga0070689_100057414
211 Ga0070661_100020969
212 Ga0070661_100532161
213 Ga0070675_100007765
214 Ga0070671_100681161
215 Ga0070674_100261348
216 Ga0070674_100979498
217 Ga0070673_100015902
218 Ga0070673_100638240
219 Ga0070667_100356599
220 Ga0070714_101059837
221 Ga0070714_101201334
222 Ga0070713_100151492
223 Ga0070711_100024058
224 Ga0070700_100832660
225 Ga0070708_100013066
226 Ga0070678_100110942
227 Ga0070678_101583969
228 Ga0068867_100223407
229 Ga0068867_100734352
230 Ga0070685_10032483
231 Ga0070706_100965726
232 Ga0070699_100003826
233 Ga0070679_100120680
234 Ga0070679_100504512
235 Ga0070684_101548514
236 Ga0070697_100169723
237 Ga0070672_100002860
238 Ga0070672_100216972
239 Ga0070672_100470241
240 Ga0070665_100218461
241 Ga0070704_100167310
242 Ga0068855_100339744
243 Ga0070664_100299967
244 Ga0070702_100541346
245 Ga0070702_100712369
246 Ga0068859_100134341
247 Ga0068859_100376044
248 Ga0068864_101545747
249 Ga0068864_101574559
250 Ga0068863_100184857
251 Ga0068863_100298406
252 Ga0068862_100180658
253 Ga0075432_10012767
254 Ga0070716_100705480
255 Ga0075366_10216924
256 Ga0097621_101857392
257 Ga0075430_100119245
258 Ga0075431_100451213
259 Ga0097620_100134333
260 Ga0097620_100376026
261 Ga0075435_100119133
262 Ga0111539_11875330
263 Ga0114129_10674883
264 Ga0105241_10123172
265 Ga0105241_11178611
266 Ga0105242_10007864
267 Ga0105248_10087044
268 Ga0105248_10999567
269 Ga0105249_10056235
270 Ga0157371_10373054
271 Ga0157374_10021321
272 Ga0157374_10082616
273 Ga0157374_10318081
274 Ga0157374_11004981
275 Ga0157378_10005188
276 Ga0157378_10323275
277 Ga0163162_10041825
278 Ga0163162_10855889
279 Ga0157375_10009162
280 Ga0157375_10136135
281 Ga0157375_10285969
282 Ga0157375_10907831
283 Ga0157375_11646004
284 Ga0163163_10027652
285 Ga0157380_11397954
286 Ga0157380_11833202
287 Ga0157377_10855924
288 Ga0157379_10850334
289 Ga0157376_10011541
290 Ga0157376_10691175
291 Ga0182007_10118756
292 Ga0183362_10001
293 Ga0213872_10005176
294 Ga0207680_10128180
295 Ga0207680_10618156
296 Ga0207645_10472605
297 Ga0207649_10000405
298 Ga0207652_10609682
299 Ga0207681_10310873
300 Ga0207694_10779367
301 Ga0207650_10175696
302 Ga0207659_10006320
303 Ga0207700_10223571
304 Ga0207686_10121652
305 Ga0207670_10047666
306 Ga0207670_10166033
307 Ga0207669_10369662
308 Ga0207704_10047080
309 Ga0207691_10174133
310 Ga0207691_10363270
311 Ga0207689_10097424
312 Ga0207661_11302779
313 Ga0207667_10319777
314 Ga0207651_10215568
315 Ga0207712_10791922
316 Ga0207668_11319537
317 Ga0207658_10547488
318 Ga0207658_10704361
319 Ga0207677_10011868
320 Ga0207703_10314997
321 Ga0207708_10663685
322 Ga0207641_10061993
323 Ga0207648_10070825
324 Ga0207648_10240078
325 Ga0207676_10779515
326 Ga0207683_10007155
327 Ga0207683_10128467
328 Ga0207428_10217916
329 Ga0268266_10315137
330 Ga0268266_11188904
331 Ga0268265_10769372
332 Ga0265334_10049347
333 Ga0265324_10023122
334 Ga0265331_10020768
335 Ga0307509_10000978
336 Ga0307509_10281072
337 Ga0307408_101060990
338 Ga0307508_10127941
339 Ga0316575_10007517
340 Ga0265314_10024787
341 Ga0307507_10098121
342 Ga0307510_10001484
343 Ga0373937_0551511
344 Ga0395901_0086932
345 Ga0395901_1256159
346 Ga0436365_1460051
347 Ga0436361_0124622
348 Ga0436361_1187360
349 Ga0436363_1538480
350 Ga0439441_010495
351 Ga0439445_0003038
352 Ga0451577_1110914
353 Ga0466972_0000084
354 Ga0453683_0335430
355 Ga0453684_0025498
356 Ga0451576_0498422
357 Ga0495629_0337746
358 Ga0495638_0182537
359 Ga0495662_0048961
360 Ga0495664_0049945
361 Ga0495618_0007012
362 Ga0495628_0031970
363 Ga0495630_0011505
364 Ga0495666_0203617
365 Ga0495640_0022267
366 Ga0495586_0008168
367 Ga0495586_0144060
368 Ga0495586_0560479
369 Ga0495645_0052987
370 Ga0495622_0122490
371 Ga0495635_0545709
372 Ga0495599_0079363
373 Ga0495658_0074329
374 Ga0495624_0029769
375 Ga0495624_0522540
376 Ga0495600_0290712
377 Ga0495604_0148531
378 Ga0495674_0770029
379 Ga0495686_0276073
380 Ga0501036_0408933
381 Ga0501040_1002164
382 Ga0501047_0281479
383 Ga0501047_0625961
384 Ga0501070_0890088
385 Ga0501076_0153171
386 nmdc:mga06z11_479852_c1
387 nmdc:mga09592_848749_c1
388 nmdc:mga0qj67_306861_c1
389 nmdc:mga06r32_452244_c1
390 nmdc:mga08y16_1297659_c1
391 nmdc:mga0n895_383273_c1
392 nmdc:mga0rr50_207467_c1
393 Ga0495601_0359441
394 Ga0500610_0307127
395 Ga0500646_0279006
396 Ga0500583_0256879
397 Ga0500650_0000153
398 Ga0500607_073433
399 Ga0500652_033237
400 Ga0500652_041972
401 Ga0500658_0004331
402 Ga0500577_0115041
403 Ga0500604_0027539
404 Ga0500616_0000388
405 Ga0500637_0075981
406 Ga0501082_1654767

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

69

171

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9827 1 151
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9701 1 151
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8508 1 150
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8417 1 151
1lql-assembly4.cif.gz_G crystal structure of osmc like protein from mycoplasma pneumoniae 0.8265 2 151
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9609 2 151 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9425 2 151 3.30.300.20
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8526 58 151 3.30.300.20
1lqlE02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8524 58 151 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8314 7 151 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A023BVL4-F1-model_v4 Peroxiredoxin 0.9903 9 151
AF-A0A2N7SF35-F1-model_v4 deleted 0.9872 39 152
AF-W7Q118-F1-model_v4 OsmC family protein 0.9857 62 152
AF-A0A853WSU6-F1-model_v4 deleted 0.985 1 150
AF-A0A534FSH6-F1-model_v4 OsmC family peroxiredoxin 0.9846 39 150

Map