F310261

General Info

Members Datasets Scaffolds Average Seq Length
202 116 190 406

Family's Representative Sequence

Representative Sequence 3300046453|Ga0495627_007138|Ga0495627_007138_2877_4181
Length 434
Sequence MIFHEDSASLHRFFEILILFITNSGYSKMAVGDVTMPQMHVVKGVKIGSAEAYVRYPNRRDLVIFEFAEDSNVAGVFTQNAFCAAPVHVSKAHLAQGNPRYLVINTGNANAGTGPTGLKNAQDTCAKLAKIAGVNSSEILPFSTGVIGEQLPMERLLAGLRPALNTLQDAAWYDAASGIMTTDTVPKGASEQFELDGITYTMTGISKGAGMIRPNMATMLSFVATDAPISRDLVQSLLKTTVEHSFNRITIDGDTSTNDSCIFVATGQAGGAEITSINDARYAQVLEVLARVMNRLAQLIVRDGEGATKFITVAVEGGGNTQECCDIAYSIAHSPLVKTALFASDPNWGRILAAIGYAGVKDLDVSKIQVWLDDVQICKDGGAAEDYTEEAGARVMAQTEITIRVDLGRGQAKDTVYTCDLSYDYVKINADYRS

Samples

Sample ID Description Type Environment
1 2551306352 Acinetobacter sp. GG2 Isolate Rhizosphere
2 2643221665 Acinetobacter sp. Root1280 Isolate Unclassified
3 2675903507 Acinetobacter calcoaceticus GK2 Isolate Unclassified
4 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
5 2744054655 Acinetobacter sp. BMW17 Isolate Unclassified
6 2773857761 Acinetobacter sp. 3664 Isolate Unclassified
7 2773857770 Acinetobacter sp. 3636 Isolate Unclassified
8 2916699645 Acinetobacter ursingii M3 Isolate Unclassified
9 2919182534 Acinetobacter calcoaceticus 2589 Isolate Rhizosphere
10 2928515477 Acinetobacter bereziniae 1375 Isolate Rhizosphere
11 2984568884 Acinetobacter baylyi SORGH_AS893 Isolate Aerial Root
12 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
13 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
22 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
23 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
29 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
30 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
41 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
42 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
43 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
44 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
45 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
46 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
47 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
48 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
49 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
50 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
51 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
52 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
53 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
55 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
56 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
57 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
58 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
59 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
60 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
61 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
62 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
63 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
64 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
65 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
66 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
67 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
68 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
69 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
70 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
71 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
72 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
73 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
74 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
75 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
78 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
79 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
80 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
81 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
82 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
83 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
84 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
85 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
86 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
89 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
93 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
94 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
96 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
97 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
98 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
99 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
100 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
101 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
102 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
106 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
111 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
112 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
113 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
114 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
115 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
116 8033232454 Acinetobacter radioresistens SA188 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.61
Metatranscriptomes 5.45
Isolates 5.94

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 0.99
Nodule 0
Rhizoplane 0
Rhizosphere 88.12
Stem 0
Stem Tuber 0
Unclassified 10.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058692_1000027 3300003856 Bacteria 198745
2 Ga0065703_1000515 3300005272 Bacteria 19094
3 Ga0070669_100025784 3300005353 Bacteria 4224
4 Ga0070697_100000561 3300005536 Bacteria 27986
5 Ga0068853_100152445 3300005539 Bacteria 2081
6 Ga0070665_100023838 3300005548 Bacteria 6166
7 Ga0068855_100072384 3300005563 Bacteria 4006
8 Ga0068863_100017075 3300005841 Bacteria 6960
9 Ga0068862_100130092 3300005844 Bacteria 2226
10 Ga0070716_100077884 3300006173 Bacteria 1969
11 Ga0099794_10093559 3300007265 Bacteria 1494
12 Ga0105244_10013831 3300009036 Bacteria 4695
13 Ga0105240_10092681 3300009093 Bacteria 3688
14 Ga0105243_10000343 3300009148 Bacteria 50175
15 Ga0105249_10003729 3300009553 Bacteria 13145
16 Ga0105249_10007463 3300009553 Bacteria 9540
17 Ga0105249_10018658 3300009553 Bacteria 6178
18 Ga0157371_10006144 3300013102 Bacteria 9973
19 Ga0157370_10019334 3300013104 Bacteria 6836
20 Ga0183365_10001 3300015684 Bacteria 2090444
21 Ga0207696_1003228 3300025711 Bacteria 7522
22 Ga0207655_1001604 3300025728 Bacteria 20191
23 Ga0207655_1005360 3300025728 Bacteria 8748
24 Ga0207655_1018010 3300025728 Bacteria 3776
25 Ga0207713_1002759 3300025735 Bacteria 12446
26 Ga0207713_1002761 3300025735 Bacteria 12439
27 Ga0207710_10000057 3300025900 Bacteria 177544
28 Ga0207681_10000821 3300025923 Bacteria 20470
29 Ga0207709_10000057 3300025935 Bacteria 216617
30 Ga0207665_10105227 3300025939 Bacteria 1976
31 Ga0207712_10006748 3300025961 Bacteria 7241
32 Ga0207712_10123480 3300025961 Bacteria 1963
33 Ga0209371_1000074 3300027312 Bacteria 198823
34 Ga0268266_10052606 3300028379 Bacteria 3497
35 Ga0265324_10000012 3300029957 Bacteria 212868
36 Ga0268256_1000067 3300030500 Bacteria 198823
37 Ga0316575_10004620 3300031665 Bacteria 4853
38 Ga0316575_10012346 3300031665 Bacteria 3176
39 Ga0316575_10017144 3300031665 Bacteria 2748
40 Ga0316575_10035163 3300031665 Bacteria 1969
41 Ga0316579_10001998 3300031691 Bacteria 7628
42 Ga0316579_10002763 3300031691 Bacteria 6706
43 Ga0316579_10002965 3300031691 Bacteria 6522
44 Ga0316579_10005572 3300031691 Bacteria 5092
45 Ga0316579_10010760 3300031691 Bacteria 3874
46 Ga0265314_10026920 3300031711 Bacteria 4314
47 Ga0316578_10011162 3300031728 Bacteria 4687
48 Ga0316578_10039475 3300031728 Bacteria 2727
49 Ga0316578_10146687 3300031728 Bacteria 1421
50 Ga0316577_10004221 3300031733 Bacteria 7387
51 Ga0316577_10004390 3300031733 Bacteria 7272
52 Ga0316577_10006628 3300031733 Bacteria 6131
53 Ga0316577_10011321 3300031733 Bacteria 4830
54 Ga0316577_10022966 3300031733 Bacteria 3463
55 Ga0316577_10068937 3300031733 Bacteria 1975
56 Ga0316583_10000653 3300032133 Bacteria 10633
57 Ga0316583_10001379 3300032133 Bacteria 8060
58 Ga0316583_10014205 3300032133 Bacteria 2872
59 Ga0316583_10017546 3300032133 Bacteria 2575
60 Ga0316585_10000082 3300032137 Bacteria 16341
61 Ga0316585_10028103 3300032137 Bacteria 1758
62 Ga0316580_10002222 3300032139 Bacteria 5299
63 Ga0316580_10015811 3300032139 Bacteria 2311
64 Ga0316593_10001411 3300032168 Bacteria 5278
65 Ga0316593_10001710 3300032168 Bacteria 4958
66 Ga0316593_10006908 3300032168 Bacteria 3090
67 Ga0316593_10010649 3300032168 Bacteria 2645
68 Ga0316593_10052608 3300032168 Bacteria 1379
69 Ga0316592_1000442 3300033524 Bacteria 5660
70 Ga0316592_1000625 3300033524 Bacteria 5136
71 Ga0316588_1000514 3300033528 Bacteria 5328
72 Ga0316588_1000880 3300033528 Bacteria 4578
73 Ga0316596_1000319 3300033541 Bacteria 7766
74 Ga0316596_1004959 3300033541 Bacteria 3015
75 Ga0316574_0002494 3300035398 Bacteria 9249
76 Ga0316574_0004318 3300035398 Bacteria 7424
77 Ga0316574_0004386 3300035398 Bacteria 7383
78 Ga0316574_0008088 3300035398 Bacteria 5819
79 Ga0316574_0010187 3300035398 Bacteria 5298
80 Ga0316574_0022578 3300035398 Bacteria 3748
81 Ga0316574_0046708 3300035398 Bacteria 2686
82 Ga0316574_0050418 3300035398 Bacteria 2591
83 Ga0316574_0091027 3300035398 Bacteria 1944
84 Ga0316574_0105620 3300035398 Bacteria 1804
85 Ga0316574_0271234 3300035398 Bacteria 1082
86 Ga0316582_0000389 3300036647 Bacteria 15938
87 Ga0316582_0002415 3300036647 Bacteria 8766
88 Ga0316582_0018376 3300036647 Bacteria 4068
89 Ga0316582_0036845 3300036647 Bacteria 3029
90 Ga0316582_0091225 3300036647 Bacteria 2006
91 Ga0316582_0096835 3300036647 Bacteria 1949
92 Ga0316582_0114361 3300036647 Bacteria 1800
93 Ga0316584_0002754 3300036712 Bacteria 11245
94 Ga0316584_0008182 3300036712 Bacteria 7191
95 Ga0316584_0016463 3300036712 Bacteria 5301
96 Ga0316584_0042260 3300036712 Bacteria 3399
97 Ga0316584_0071156 3300036712 Bacteria 2606
98 Ga0316584_0081087 3300036712 Bacteria 2430
99 Ga0316584_0125087 3300036712 Bacteria 1920
100 Ga0316584_0238500 3300036712 Bacteria 1331
101 Ga0395905_0000022 3300037471 Bacteria 321527
102 Ga0400484_08857 3300038725 Bacteria 2819
103 Ga0400490_15415 3300038726 Bacteria 9869
104 Ga0400490_17228 3300038726 Bacteria 8173
105 Ga0400490_46944 3300038726 Bacteria 4843
106 Ga0400488_03691 3300038741 Bacteria 4542
107 Ga0400488_48428 3300038741 Bacteria 26259
108 Ga0400483_158634 3300039062 Bacteria 2776
109 Ga0400483_182919 3300039062 Bacteria 3177
110 Ga0400483_196187 3300039062 Bacteria 25625
111 Ga0400483_217209 3300039062 Bacteria 3697
112 Ga0400483_235836 3300039062 Bacteria 3249
113 Ga0400487_51369 3300039110 Bacteria 98129
114 Ga0439466_0022392 3300041411 Bacteria 2230
115 Ga0451577_0107344 3300042876 Bacteria 2495
116 Ga0466969_0002300 3300044656 Bacteria 10198
117 Ga0466966_0000560 3300044684 Bacteria 23677
118 Ga0466961_0006158 3300044693 Bacteria 7615
119 Ga0466961_0184846 3300044693 Bacteria 1293
120 Ga0466963_0180293 3300044694 Bacteria 1474
121 Ga0453684_0002379 3300044712 Bacteria 45928
122 Ga0453684_0004281 3300044712 Bacteria 30458
123 Ga0453684_0121325 3300044712 Bacteria 3155
124 Ga0466971_0008012 3300044719 Bacteria 4605
125 Ga0466957_0030533 3300044842 Bacteria 3218
126 Ga0466959_0000040 3300045049 Bacteria 101109
127 Ga0451576_0177561 3300045051 Bacteria 2224
128 Ga0466958_0000417 3300045836 Bacteria 17527
129 Ga0495627_007138 3300046453 Bacteria 4316
130 Ga0495638_0086042 3300046460 Bacteria 1900
131 Ga0495641_0035893 3300046461 Bacteria 2333
132 Ga0495580_0027984 3300046472 Bacteria 4100
133 Ga0495632_0031891 3300046519 Bacteria 2719
134 Ga0495643_0045726 3300046522 Bacteria 2376
135 Ga0495663_0001945 3300046525 Bacteria 6362
136 Ga0495680_0044457 3300047322 Bacteria 3512
137 Ga0501031_0041788 3300049568 Bacteria 2993
138 Ga0501033_0001878 3300049570 Bacteria 18274
139 Ga0501033_0062882 3300049570 Bacteria 2733
140 Ga0501034_0018593 3300049571 Bacteria 7124
141 Ga0501034_0026916 3300049571 Bacteria 5850
142 Ga0501034_0046508 3300049571 Bacteria 4384
143 Ga0501034_0127541 3300049571 Bacteria 2529
144 Ga0501036_0078440 3300049572 Bacteria 2793
145 Ga0501037_0001398 3300049573 Bacteria 17718
146 Ga0501037_0015483 3300049573 Bacteria 5612
147 Ga0501037_0053707 3300049573 Bacteria 2947
148 Ga0501038_0000505 3300049574 Bacteria 34234
149 Ga0501038_0011001 3300049574 Bacteria 8262
150 Ga0501039_0002690 3300049575 Bacteria 13263
151 Ga0501040_0000085 3300049576 Bacteria 46155
152 Ga0501040_0033226 3300049576 Bacteria 3493
153 Ga0501040_0054183 3300049576 Bacteria 2749
154 Ga0501041_0000236 3300049577 Bacteria 25702
155 Ga0501042_0000107 3300049578 Bacteria 34352
156 Ga0501042_0002604 3300049578 Bacteria 11092
157 Ga0501042_0024700 3300049578 Bacteria 4216
158 Ga0501043_0012436 3300049579 Bacteria 6657
159 Ga0501046_0000005 3300049580 Bacteria 394121
160 Ga0501046_0000548 3300049580 Bacteria 37400
161 Ga0501046_0014061 3300049580 Bacteria 6758
162 Ga0501046_0035964 3300049580 Bacteria 3988
163 Ga0501048_0000076 3300049582 Bacteria 51144
164 Ga0501068_0052432 3300049584 Bacteria 2468
165 Ga0501069_0055342 3300049585 Bacteria 2210
166 Ga0501070_0010173 3300049586 Bacteria 7964
167 Ga0501070_0025230 3300049586 Bacteria 4984
168 Ga0501070_0032628 3300049586 Bacteria 4358
169 Ga0501071_0000836 3300049587 Bacteria 16486
170 Ga0501072_0000201 3300049588 Bacteria 43540
171 Ga0501073_0058005 3300049589 Bacteria 2707
172 Ga0501073_0157092 3300049589 Bacteria 1576
173 Ga0501074_0002010 3300049590 Bacteria 14017
174 Ga0501074_0060570 3300049590 Bacteria 2727
175 Ga0501075_0000544 3300049591 Bacteria 22874
176 Ga0501076_0000771 3300049592 Bacteria 20696
177 Ga0501077_0025685 3300049593 Bacteria 3738
178 Ga0501079_0000441 3300049741 Bacteria 26973
179 Ga0501080_0017995 3300049742 Bacteria 6542
180 Ga0501080_0124904 3300049742 Bacteria 2383
181 Ga0501081_0001178 3300049743 Bacteria 15807
182 Ga0501035_0043097 3300049822 Bacteria 4068
183 Ga0501035_0044479 3300049822 Bacteria 3998
184 Ga0501045_0000911 3300049824 Bacteria 19278
185 Ga0500635_0000524 3300053080 Bacteria 10483
186 Ga0500608_000373 3300053122 Bacteria 17412
187 Ga0501082_0006025 3300060353 Bacteria 10515
188 Ga0501082_0073887 3300060353 Bacteria 2936
189 Ga0466962_0001991 3300061719 Bacteria 9650
190 Ga0530510_0000543 3300061734 Bacteria 24227

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035398 Ga0316574_0271234 Ga0316574_0271234_11_1024 333
2 3300036647 Ga0316582_0114361 Ga0316582_0114361_681_1787 356
3 3300039062 Ga0400483_235836 Ga0400483_235836_389_1624 375
4 3300038741 Ga0400488_03691 Ga0400488_03691_3052_4254 378
5 3300031691 Ga0316579_10002763 Ga0316579_100027632 379
6 3300031733 Ga0316577_10068937 Ga0316577_100689371 379
7 3300032133 Ga0316583_10014205 Ga0316583_100142052 379
8 3300032168 Ga0316593_10006908 Ga0316593_100069083 379
9 3300033528 Ga0316588_1000880 Ga0316588_10008802 379
10 3300033541 Ga0316596_1004959 Ga0316596_10049592 379
11 3300035398 Ga0316574_0002494 Ga0316574_0002494_412_1605 379
12 3300036712 Ga0316584_0071156 Ga0316584_0071156_597_1790 379
13 3300038725 Ga0400484_08857 Ga0400484_08857_36_1178 379
14 3300035398 Ga0316574_0046708 Ga0316574_0046708_294_1511 382
15 3300036712 Ga0316584_0002754 Ga0316584_0002754_9924_11126 382
16 3300031665 Ga0316575_10012346 Ga0316575_100123463 385
17 3300031733 Ga0316577_10006628 Ga0316577_100066283 385
18 3300032137 Ga0316585_10000082 Ga0316585_100000822 385
19 3300035398 Ga0316574_0022578 Ga0316574_0022578_476_1678 385
20 3300032168 Ga0316593_10001411 Ga0316593_100014114 387
21 3300031733 Ga0316577_10022966 Ga0316577_100229662 389
22 3300035398 Ga0316574_0010187 Ga0316574_0010187_2414_3583 389
23 3300036647 Ga0316582_0096835 Ga0316582_0096835_60_1229 389
24 3300044712 Ga0453684_0121325 Ga0453684_0121325_934_2157 389
25 3300035398 Ga0316574_0091027 Ga0316574_0091027_472_1644 390
26 3300036712 Ga0316584_0042260 Ga0316584_0042260_858_2078 391
27 3300053080 Ga0500635_0000524 Ga0500635_0000524_5067_6491 391
28 3300042876 Ga0451577_0107344 Ga0451577_0107344_1044_2222 392
29 3300046472 Ga0495580_0027984 Ga0495580_0027984_2632_3822 392
30 3300049580 Ga0501046_0000005 Ga0501046_0000005_352231_353412 392
31 3300060353 Ga0501082_0073887 Ga0501082_0073887_575_1756 392
32 3300038726 Ga0400490_46944 Ga0400490_46944_1302_2486 393
33 3300038741 Ga0400488_48428 Ga0400488_48428_3428_4612 393
34 3300045051 Ga0451576_0177561 Ga0451576_0177561_978_2207 393
35 3300005539 Ga0068853_100152445 Ga0068853_1001524453 394
36 3300029957 Ga0265324_10000012 Ga0265324_10000012157 394
37 3300031711 Ga0265314_10026920 Ga0265314_100269201 394
38 3300049570 Ga0501033_0062882 Ga0501033_0062882_104_1519 394
39 3300035398 Ga0316574_0004386 Ga0316574_0004386_6162_7349 395
40 3300044693 Ga0466961_0184846 Ga0466961_0184846_20_1216 395
41 3300049571 Ga0501034_0026916 Ga0501034_0026916_264_1454 395
42 iso_pu_bacteria 2916699645 2916701252 395
43 3300035398 Ga0316574_0105620 Ga0316574_0105620_38_1228 396
44 3300049568 Ga0501031_0041788 Ga0501031_0041788_470_1666 396
45 3300049570 Ga0501033_0001878 Ga0501033_0001878_16925_18121 396
46 3300049572 Ga0501036_0078440 Ga0501036_0078440_366_1562 396
47 3300049573 Ga0501037_0053707 Ga0501037_0053707_957_2153 396
48 3300049574 Ga0501038_0000505 Ga0501038_0000505_2432_3628 396
49 3300049575 Ga0501039_0002690 Ga0501039_0002690_7068_8264 396
50 3300049576 Ga0501040_0033226 Ga0501040_0033226_1137_2333 396
51 3300049577 Ga0501041_0000236 Ga0501041_0000236_2635_3831 396
52 3300049578 Ga0501042_0000107 Ga0501042_0000107_30470_31666 396
53 3300049579 Ga0501043_0012436 Ga0501043_0012436_4528_5724 396
54 3300049580 Ga0501046_0000548 Ga0501046_0000548_28521_29717 396
55 3300049582 Ga0501048_0000076 Ga0501048_0000076_15574_16770 396
56 3300049584 Ga0501068_0052432 Ga0501068_0052432_148_1344 396
57 3300049587 Ga0501071_0000836 Ga0501071_0000836_13949_15145 396
58 3300049588 Ga0501072_0000201 Ga0501072_0000201_13581_14777 396
59 3300049590 Ga0501074_0060570 Ga0501074_0060570_921_2117 396
60 3300049591 Ga0501075_0000544 Ga0501075_0000544_17802_18998 396
61 3300049592 Ga0501076_0000771 Ga0501076_0000771_15636_16832 396
62 3300049593 Ga0501077_0025685 Ga0501077_0025685_1311_2507 396
63 3300049741 Ga0501079_0000441 Ga0501079_0000441_2242_3438 396
64 3300049743 Ga0501081_0001178 Ga0501081_0001178_1105_2301 396
65 3300049822 Ga0501035_0044479 Ga0501035_0044479_2271_3467 396
66 3300049824 Ga0501045_0000911 Ga0501045_0000911_3654_4850 396
67 3300060353 Ga0501082_0006025 Ga0501082_0006025_778_1974 396
68 3300061734 Ga0530510_0000543 Ga0530510_0000543_18782_19978 396
69 3300044712 Ga0453684_0004281 Ga0453684_0004281_23956_25149 397
70 3300049571 Ga0501034_0018593 Ga0501034_0018593_3857_5053 397
71 3300005536 Ga0070697_100000561 Ga0070697_1000005618 398
72 3300007265 Ga0099794_10093559 Ga0099794_100935592 398
73 3300032168 Ga0316593_10001710 Ga0316593_100017102 399
74 3300036647 Ga0316582_0002415 Ga0316582_0002415_4894_6093 399
75 3300031665 Ga0316575_10017144 Ga0316575_100171442 400
76 3300031665 Ga0316575_10035163 Ga0316575_100351632 400
77 3300031691 Ga0316579_10001998 Ga0316579_100019986 400
78 3300031733 Ga0316577_10004221 Ga0316577_100042215 400
79 3300032133 Ga0316583_10000653 Ga0316583_100006533 400
80 3300032139 Ga0316580_10002222 Ga0316580_100022222 400
81 3300033524 Ga0316592_1000442 Ga0316592_10004424 400
82 3300033524 Ga0316592_1000625 Ga0316592_10006252 400
83 3300033528 Ga0316588_1000514 Ga0316588_10005142 400
84 3300036712 Ga0316584_0238500 Ga0316584_0238500_37_1254 400
85 3300039062 Ga0400483_182919 Ga0400483_182919_736_1938 400
86 3300039062 Ga0400483_217209 Ga0400483_217209_1619_2821 400
87 3300039110 Ga0400487_51369 Ga0400487_51369_15341_16543 400
88 3300049576 Ga0501040_0000085 Ga0501040_0000085_22462_23682 400
89 3300049578 Ga0501042_0002604 Ga0501042_0002604_5084_6304 400
90 3300038726 Ga0400490_17228 Ga0400490_17228_4752_5957 401
91 3300031733 Ga0316577_10004390 Ga0316577_100043905 402
92 3300032168 Ga0316593_10010649 Ga0316593_100106492 402
93 iso_pu_bacteria 2551306352 2552746044 402
94 iso_pu_bacteria 2643221665 2644362923 402
95 iso_pu_bacteria 2675903507 2678229780 402
96 iso_pu_bacteria 2744054655 2745159308 402
97 iso_pu_bacteria 2773857761 2774391483 402
98 iso_pu_bacteria 2773857770 2774439551 402
99 iso_pu_bacteria 2919182534 2919186174 402
100 iso_pu_bacteria 2928515477 2928518993 402
101 iso_pu_bacteria 2984568884 2984570770 402
102 iso_pu_bacteria 8033232454 8033233537 402
103 3300038726 Ga0400490_15415 Ga0400490_15415_8302_9513 403
104 3300039062 Ga0400483_158634 Ga0400483_158634_610_1821 403
105 3300039062 Ga0400483_196187 Ga0400483_196187_17476_18687 403
106 3300044712 Ga0453684_0002379 Ga0453684_0002379_34042_35253 403
107 3300049742 Ga0501080_0124904 Ga0501080_0124904_862_2073 403
108 3300032168 Ga0316593_10052608 Ga0316593_100526081 404
109 3300033541 Ga0316596_1000319 Ga0316596_10003196 404
110 3300049580 Ga0501046_0035964 Ga0501046_0035964_673_2103 404
111 3300049822 Ga0501035_0043097 Ga0501035_0043097_1961_3391 404
112 3300005841 Ga0068863_100017075 Ga0068863_1000170756 405
113 3300005844 Ga0068862_100130092 Ga0068862_1001300923 405
114 3300009553 Ga0105249_10007463 Ga0105249_100074637 405
115 3300009553 Ga0105249_10018658 Ga0105249_100186582 405
116 3300013104 Ga0157370_10019334 Ga0157370_100193344 405
117 3300015684 Ga0183365_10001 Ga0183365_10001809 405
118 3300025961 Ga0207712_10123480 Ga0207712_101234802 405
119 3300031691 Ga0316579_10005572 Ga0316579_100055722 405
120 3300031728 Ga0316578_10011162 Ga0316578_100111624 405
121 3300031728 Ga0316578_10039475 Ga0316578_100394752 405
122 3300031733 Ga0316577_10011321 Ga0316577_100113213 405
123 3300032133 Ga0316583_10017546 Ga0316583_100175462 405
124 3300032137 Ga0316585_10028103 Ga0316585_100281031 405
125 3300032139 Ga0316580_10015811 Ga0316580_100158113 405
126 3300035398 Ga0316574_0004318 Ga0316574_0004318_2183_3400 405
127 3300035398 Ga0316574_0008088 Ga0316574_0008088_1482_2699 405
128 3300035398 Ga0316574_0050418 Ga0316574_0050418_1237_2454 405
129 3300036647 Ga0316582_0000389 Ga0316582_0000389_4360_5577 405
130 3300036647 Ga0316582_0018376 Ga0316582_0018376_2598_3815 405
131 3300036712 Ga0316584_0008182 Ga0316584_0008182_841_2058 405
132 3300036712 Ga0316584_0016463 Ga0316584_0016463_2969_4186 405
133 3300036712 Ga0316584_0081087 Ga0316584_0081087_325_1542 405
134 3300036712 Ga0316584_0125087 Ga0316584_0125087_397_1614 405
135 3300037471 Ga0395905_0000022 Ga0395905_0000022_267409_268824 405
136 3300044656 Ga0466969_0002300 Ga0466969_0002300_2035_3450 405
137 3300044684 Ga0466966_0000560 Ga0466966_0000560_7679_9094 405
138 3300044693 Ga0466961_0006158 Ga0466961_0006158_5966_7381 405
139 3300044694 Ga0466963_0180293 Ga0466963_0180293_45_1460 405
140 3300044719 Ga0466971_0008012 Ga0466971_0008012_379_1794 405
141 3300044842 Ga0466957_0030533 Ga0466957_0030533_335_1750 405
142 3300045049 Ga0466959_0000040 Ga0466959_0000040_96212_97627 405
143 3300045836 Ga0466958_0000417 Ga0466958_0000417_15894_17309 405
144 3300046461 Ga0495641_0035893 Ga0495641_0035893_800_2065 405
145 3300047322 Ga0495680_0044457 Ga0495680_0044457_1147_2364 405
146 3300049571 Ga0501034_0046508 Ga0501034_0046508_2921_4342 405
147 3300049571 Ga0501034_0127541 Ga0501034_0127541_109_1521 405
148 3300049573 Ga0501037_0001398 Ga0501037_0001398_2927_4144 405
149 3300049573 Ga0501037_0015483 Ga0501037_0015483_1557_2774 405
150 3300049574 Ga0501038_0011001 Ga0501038_0011001_3248_4465 405
151 3300049576 Ga0501040_0054183 Ga0501040_0054183_747_1967 405
152 3300049578 Ga0501042_0024700 Ga0501042_0024700_355_1575 405
153 3300049580 Ga0501046_0014061 Ga0501046_0014061_2202_3419 405
154 3300049585 Ga0501069_0055342 Ga0501069_0055342_422_1639 405
155 3300049586 Ga0501070_0010173 Ga0501070_0010173_1045_2283 405
156 3300049586 Ga0501070_0025230 Ga0501070_0025230_2981_4198 405
157 3300049586 Ga0501070_0032628 Ga0501070_0032628_1227_2444 405
158 3300049589 Ga0501073_0058005 Ga0501073_0058005_642_1859 405
159 3300049589 Ga0501073_0157092 Ga0501073_0157092_314_1531 405
160 3300049590 Ga0501074_0002010 Ga0501074_0002010_9679_10896 405
161 3300049742 Ga0501080_0017995 Ga0501080_0017995_92_1309 405
162 3300053122 Ga0500608_000373 Ga0500608_000373_9285_10706 405
163 3300061719 Ga0466962_0001991 Ga0466962_0001991_1587_3002 405
164 iso_pu_bacteria 2739367756 2739793550 405
165 3300003856 Ga0058692_1000027 Ga0058692_100002732 406
166 3300005272 Ga0065703_1000515 Ga0065703_10005153 406
167 3300005353 Ga0070669_100025784 Ga0070669_1000257846 406
168 3300005548 Ga0070665_100023838 Ga0070665_1000238387 406
169 3300005563 Ga0068855_100072384 Ga0068855_1000723841 406
170 3300006173 Ga0070716_100077884 Ga0070716_1000778842 406
171 3300009036 Ga0105244_10013831 Ga0105244_100138316 406
172 3300009093 Ga0105240_10092681 Ga0105240_100926817 406
173 3300009148 Ga0105243_10000343 Ga0105243_1000034339 406
174 3300009553 Ga0105249_10003729 Ga0105249_100037299 406
175 3300013102 Ga0157371_10006144 Ga0157371_100061442 406
176 3300025711 Ga0207696_1003228 Ga0207696_10032288 406
177 3300025728 Ga0207655_1001604 Ga0207655_10016042 406
178 3300025728 Ga0207655_1005360 Ga0207655_10053602 406
179 3300025728 Ga0207655_1018010 Ga0207655_10180101 406
180 3300025735 Ga0207713_1002759 Ga0207713_10027598 406
181 3300025735 Ga0207713_1002761 Ga0207713_10027618 406
182 3300025900 Ga0207710_10000057 Ga0207710_1000005732 406
183 3300025923 Ga0207681_10000821 Ga0207681_1000082121 406
184 3300025935 Ga0207709_10000057 Ga0207709_10000057175 406
185 3300025939 Ga0207665_10105227 Ga0207665_101052272 406
186 3300025961 Ga0207712_10006748 Ga0207712_100067488 406
187 3300027312 Ga0209371_1000074 Ga0209371_100007432 406
188 3300028379 Ga0268266_10052606 Ga0268266_100526062 406
189 3300030500 Ga0268256_1000067 Ga0268256_100006732 406
190 3300031665 Ga0316575_10004620 Ga0316575_100046203 406
191 3300031691 Ga0316579_10002965 Ga0316579_100029653 406
192 3300031691 Ga0316579_10010760 Ga0316579_100107602 406
193 3300031728 Ga0316578_10146687 Ga0316578_101466871 406
194 3300032133 Ga0316583_10001379 Ga0316583_100013796 406
195 3300036647 Ga0316582_0036845 Ga0316582_0036845_692_1912 406
196 3300036647 Ga0316582_0091225 Ga0316582_0091225_470_1690 406
197 3300041411 Ga0439466_0022392 Ga0439466_0022392_130_1350 406
198 3300046453 Ga0495627_007138 Ga0495627_007138_2877_4181 406
199 3300046460 Ga0495638_0086042 Ga0495638_0086042_104_1324 406
200 3300046519 Ga0495632_0031891 Ga0495632_0031891_810_2030 406
201 3300046522 Ga0495643_0045726 Ga0495643_0045726_885_2105 406
202 3300046525 Ga0495663_0001945 Ga0495663_0001945_1131_2351 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01960

ArgJ

ArgJ family

46

434

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vra-assembly1.cif.gz_B crystal structure of arginine biosynthesis bifunctional protein argj (10175521) from bacillus halodurans at 2.00 a resolution 0.9509 194 404
2yep-assembly4.cif.gz_H structure of an n-terminal nucleophile (ntn) hydrolase, oat2, in complex with glutamate 0.9428 194 402
1vz8-assembly2.cif.gz_C ornithine acetyltransferase (orf6 gene product - clavulanic acid biosynthesis) from streptomyces clavuligerus (semet structure) 0.9378 14 406
1vz8-assembly2.cif.gz_C ornithine acetyltransferase (orf6 gene product - clavulanic acid biosynthesis) from streptomyces clavuligerus (semet structure) 0.9329 14 406
1vz7-assembly2.cif.gz_D ornithine acetyltransferase (orf6 gene product - clavulanic acid biosynthesis) from streptomyces clavuligerus 0.9312 14 402
ID Description Score Start End Superfamily
af_Q2G1H5_285_413_3.10.20.340 Alpha Beta;Roll;Ubiquitin-like (UB roll);ArgJ beta chain, C-terminal domain 0.9717 276 406 3.10.20.340
af_Q04728_215_299_3.30.2330.10 Alpha Beta;2-Layer Sandwich;arginine biosynthesis bifunctional protein fold;arginine biosynthesis bifunctional protein suprefamily 0.967 194 275 3.30.2330.10
3it4D02 Alpha Beta;Roll;Ubiquitin-like (UB roll);ArgJ beta chain, C-terminal domain 0.9652 277 402 3.10.20.340
af_Q2G1H5_285_413_3.10.20.340 Alpha Beta;Roll;Ubiquitin-like (UB roll);ArgJ beta chain, C-terminal domain 0.9644 276 406 3.10.20.340
af_Q54DY1_210_295_3.30.2330.10 Alpha Beta;2-Layer Sandwich;arginine biosynthesis bifunctional protein fold;arginine biosynthesis bifunctional protein suprefamily 0.9579 196 275 3.30.2330.10
ID Description Score Start End GO Terms
AF-A0A7C7W1T2-F1-model_v4 glutamate N-acetyltransferase (EC 2.3.1.35) 0.9952 288 406 GO:0004042
GO:0004358
GO:0005737
GO:0006526
GO:0006592
AF-A0A7V2UKH5-F1-model_v4 glutamate N-acetyltransferase (EC 2.3.1.35) 0.9945 287 406 GO:0004042
GO:0004358
GO:0005737
GO:0006526
GO:0006592
AF-A0A1Q3N6I3-F1-model_v4 glutamate N-acetyltransferase (EC 2.3.1.35) 0.9936 1 312 GO:0004042
GO:0004358
GO:0006526
GO:0006592
AF-A0A832E101-F1-model_v4 glutamate N-acetyltransferase (EC 2.3.1.35) 0.9933 281 406 GO:0004042
GO:0004358
GO:0005737
GO:0006526
GO:0006592
AF-A0A3B8Z2B5-F1-model_v4 glutamate N-acetyltransferase (EC 2.3.1.35) 0.9932 284 406 GO:0004042
GO:0004358
GO:0006526
GO:0006592

Feature Viewer

pLDDT pTM Quality
93.62 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map