F310140

General Info

Members Datasets Scaffolds Average Seq Length
202 86 404 310

Family's Representative Sequence

Representative Sequence 3300039093|Ga0400489_07028|Ga0400489_07028_354_1367
Length 337
Sequence MGFALILASISFVLAVVWGPFLIRILRYYGIGKRIRIDGPRSHMTKQGTPTMGGLMIVVPVMLITLSLNVYNLLGQTWIGRSILVPLGVMVVYALIGALDDIAGVRGMRRGEGYSARQKTVWELLFSLVVAGTMLLMKIQFAGQVGVPGVRRAVDLGWIWLPIAALVIYFSANAVNFTDGLDGLAGIIVASAFVAYGIVALLQGQVYLVHFCFTMVGACFAFLWYNAYPAQLFMGDVGSLALGATLGVVALMTGQWLLLPVIALVPVAEAVSVVLQVAYFKYTKRKYGQGRRIFKMSPLHCHFELLGWSETQVVQRFWLVGLLAAMAGVALALWGSG

Samples

Sample ID Description Type Environment
1 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
32 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
33 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
40 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
41 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
42 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
43 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
44 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
45 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
46 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
47 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
48 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
49 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
50 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
51 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
52 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
53 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
54 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
55 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
56 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
57 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
58 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
59 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
60 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
61 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
62 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
63 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
64 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
65 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
66 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
67 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
68 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
69 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
70 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
71 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
72 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
73 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
74 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
75 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
76 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
77 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
78 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
79 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
80 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
81 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
82 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
83 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
84 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
85 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
86 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 98.51
Stem 0
Stem Tuber 0
Unclassified 16.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0400489_07028 3300039093 Bacteria 1603
2 SwRhRL2b_contig_1013028 2162886007 Bacteria 4094
3 JGI25406J46586_10014021 3300003203 Bacteria 3418
4 Ga0065704_10070789 3300005289 Bacteria 16089
5 Ga0065707_10000467 3300005295 Bacteria 75943
6 Ga0065707_10083010 3300005295 Bacteria 10885
7 Ga0070689_100027080 3300005340 Bacteria 4320
8 Ga0070703_10019072 3300005406 Bacteria 1987
9 Ga0070701_10042608 3300005438 Bacteria 2318
10 Ga0070705_100025451 3300005440 Unclassified 3209
11 Ga0070700_100021211 3300005441 Bacteria 3774
12 Ga0070706_100026100 3300005467 Bacteria 5375
13 Ga0070706_100246021 3300005467 Bacteria 1670
14 Ga0070707_100119366 3300005468 Unclassified 2560
15 Ga0070698_100014539 3300005471 Bacteria 8309
16 Ga0070698_100016452 3300005471 Bacteria 7804
17 Ga0070698_100104715 3300005471 Unclassified 2799
18 Ga0070698_100134930 3300005471 Bacteria 2422
19 Ga0070698_100162818 3300005471 Unclassified 2174
20 Ga0070699_100004954 3300005518 Bacteria 11745
21 Ga0070699_100008330 3300005518 Bacteria 8986
22 Ga0070699_100017792 3300005518 Bacteria 6103
23 Ga0070699_100027706 3300005518 Bacteria 4885
24 Ga0068853_100282882 3300005539 Bacteria 1529
25 Ga0070704_100038730 3300005549 Unclassified 3268
26 Ga0070704_100170605 3300005549 Unclassified 1730
27 Ga0068857_100222577 3300005577 Bacteria 1724
28 Ga0068857_100447526 3300005577 Unclassified 1207
29 Ga0068859_100041776 3300005617 Bacteria 4605
30 Ga0068859_100061931 3300005617 Unclassified 3770
31 Ga0068864_100039597 3300005618 Unclassified 4028
32 Ga0068862_100074201 3300005844 Unclassified 2940
33 Ga0081539_10000908 3300005985 Bacteria 56079
34 Ga0081539_10019175 3300005985 Bacteria 4694
35 Ga0081539_10034770 3300005985 Bacteria 3040
36 Ga0075428_100065084 3300006844 Bacteria 3992
37 Ga0075428_100193044 3300006844 Unclassified 2202
38 Ga0075430_100129820 3300006846 Bacteria 2100
39 Ga0075431_100008134 3300006847 Bacteria 10477
40 Ga0075431_100085256 3300006847 Bacteria 3261
41 Ga0075431_100195397 3300006847 Bacteria 2071
42 Ga0075434_100133137 3300006871 Unclassified 2505
43 Ga0075429_100020264 3300006880 Bacteria 5767
44 Ga0075429_100047003 3300006880 Bacteria 3755
45 Ga0075429_100083919 3300006880 Unclassified 2777
46 Ga0075429_100095014 3300006880 Bacteria 2599
47 Ga0097620_100041777 3300006931 Bacteria 4605
48 Ga0097620_100061930 3300006931 Unclassified 3770
49 Ga0111539_10042855 3300009094 Bacteria 5430
50 Ga0114129_10027224 3300009147 Bacteria 8094
51 Ga0114129_10076586 3300009147 Bacteria 4657
52 Ga0105243_10003565 3300009148 Bacteria 12564
53 Ga0105243_10059050 3300009148 Unclassified 3059
54 Ga0105249_10013543 3300009553 Bacteria 7204
55 Ga0105249_10083005 3300009553 Unclassified 2982
56 Ga0105249_10676926 3300009553 Bacteria 1091
57 Ga0105246_10030725 3300011119 Bacteria 3550
58 Ga0105246_10049356 3300011119 Bacteria 2882
59 Ga0207660_10018235 3300025917 Unclassified 4676
60 Ga0207709_10027197 3300025935 Unclassified 3292
61 Ga0207712_10293848 3300025961 Unclassified 1331
62 Ga0207708_10009881 3300026075 Bacteria 7085
63 Ga0207674_10135851 3300026116 Bacteria 2421
64 Ga0207674_10289004 3300026116 Unclassified 1588
65 Ga0268265_10064132 3300028380 Unclassified 2829
66 Ga0265334_10022510 3300028573 Bacteria 2567
67 Ga0265318_10007644 3300028577 Unclassified 4868
68 Ga0265322_10045134 3300028654 Bacteria 1254
69 Ga0265338_10037644 3300028800 Unclassified 4599
70 Ga0265320_10003505 3300031240 Bacteria 10519
71 Ga0265340_10010767 3300031247 Bacteria 4886
72 Ga0265316_10089974 3300031344 Unclassified 2342
73 Ga0316575_10026427 3300031665 Bacteria 2256
74 Ga0316579_10001467 3300031691 Bacteria 8564
75 Ga0316579_10018731 3300031691 Bacteria 3050
76 Ga0316576_10093002 3300031727 Bacteria 2247
77 Ga0316576_10132696 3300031727 Bacteria 1874
78 Ga0316576_10280130 3300031727 Bacteria 1249
79 Ga0316576_10325128 3300031727 Bacteria 1147
80 Ga0316578_10008309 3300031728 Bacteria 5276
81 Ga0316578_10045151 3300031728 Unclassified 2564
82 Ga0316578_10051918 3300031728 Bacteria 2401
83 Ga0316578_10100508 3300031728 Bacteria 1734
84 Ga0307405_10196027 3300031731 Bacteria 1463
85 Ga0316577_10000647 3300031733 Bacteria 14530
86 Ga0316577_10103076 3300031733 Bacteria 1600
87 Ga0307413_10059829 3300031824 Bacteria 2342
88 Ga0307410_10059449 3300031852 Bacteria 2609
89 Ga0307407_10008905 3300031903 Bacteria 4639
90 Ga0307414_10411877 3300032004 Bacteria 1177
91 Ga0307415_100079738 3300032126 Bacteria 2333
92 Ga0316574_0071458 3300035398 Bacteria 2192
93 Ga0316582_0000076 3300036647 Bacteria 25350
94 Ga0316582_0002805 3300036647 Bacteria 8314
95 Ga0316582_0007285 3300036647 Bacteria 5883
96 Ga0316582_0037882 3300036647 Bacteria 2993
97 Ga0316582_0038783 3300036647 Bacteria 2963
98 Ga0316582_0086369 3300036647 Bacteria 2057
99 Ga0316584_0040227 3300036712 Bacteria 3483
100 Ga0316584_0059373 3300036712 Bacteria 2864
101 Ga0316584_0067276 3300036712 Bacteria 2685
102 Ga0316584_0070958 3300036712 Bacteria 2610
103 Ga0316584_0152258 3300036712 Bacteria 1721
104 Ga0316584_0185200 3300036712 Bacteria 1540
105 Ga0316581_0014397 3300037588 Bacteria 2252
106 Ga0316581_0036737 3300037588 Bacteria 1487
107 Ga0400488_43423 3300038741 Bacteria 3203
108 Ga0400489_73801 3300039093 Bacteria 106363
109 Ga0451577_0002318 3300042876 Bacteria 23000
110 Ga0451577_0003097 3300042876 Bacteria 18765
111 Ga0451577_0031721 3300042876 Bacteria 4767
112 Ga0451577_0039307 3300042876 Bacteria 4252
113 Ga0451577_0051234 3300042876 Unclassified 3685
114 Ga0451577_0087091 3300042876 Bacteria 2787
115 Ga0451577_0102160 3300042876 Unclassified 2562
116 Ga0451577_0102198 3300042876 Bacteria 2561
117 Ga0451577_0180821 3300042876 Bacteria 1901
118 Ga0451577_0398361 3300042876 Bacteria 1249
119 Ga0451577_0407844 3300042876 Bacteria 1234
120 Ga0453683_0000294 3300044673 Bacteria 63845
121 Ga0453683_0010024 3300044673 Bacteria 6301
122 Ga0453683_0022887 3300044673 Unclassified 3983
123 Ga0453683_0025858 3300044673 Bacteria 3727
124 Ga0453683_0028334 3300044673 Bacteria 3547
125 Ga0453683_0077740 3300044673 Bacteria 2078
126 Ga0453683_0219088 3300044673 Bacteria 1210
127 Ga0453684_0000023 3300044712 Bacteria 857153
128 Ga0453684_0000128 3300044712 Bacteria 335864
129 Ga0453684_0000541 3300044712 Bacteria 143452
130 Ga0453684_0000670 3300044712 Bacteria 122645
131 Ga0453684_0001401 3300044712 Bacteria 69706
132 Ga0453684_0001415 3300044712 Bacteria 69097
133 Ga0453684_0004730 3300044712 Bacteria 28120
134 Ga0453684_0007259 3300044712 Bacteria 20517
135 Ga0453684_0010151 3300044712 Bacteria 16165
136 Ga0453684_0010926 3300044712 Bacteria 15361
137 Ga0453684_0012220 3300044712 Bacteria 14224
138 Ga0453684_0014133 3300044712 Bacteria 12832
139 Ga0453684_0035062 3300044712 Bacteria 6946
140 Ga0453684_0048299 3300044712 Bacteria 5631
141 Ga0453684_0056114 3300044712 Bacteria 5113
142 Ga0453684_0059827 3300044712 Bacteria 4907
143 Ga0453684_0063046 3300044712 Bacteria 4744
144 Ga0453684_0073723 3300044712 Unclassified 4302
145 Ga0453684_0093989 3300044712 Bacteria 3691
146 Ga0453684_0117535 3300044712 Bacteria 3218
147 Ga0453684_0127510 3300044712 Bacteria 3060
148 Ga0453684_0135515 3300044712 Bacteria 2949
149 Ga0453684_0144408 3300044712 Bacteria 2837
150 Ga0453684_0154274 3300044712 Bacteria 2725
151 Ga0453684_0341446 3300044712 Bacteria 1691
152 Ga0453684_0348141 3300044712 Bacteria 1671
153 Ga0453684_0352989 3300044712 Bacteria 1658
154 Ga0453684_0361599 3300044712 Bacteria 1634
155 Ga0453684_0527815 3300044712 Bacteria 1303
156 Ga0453684_0589257 3300044712 Bacteria 1220
157 Ga0453684_0645291 3300044712 Bacteria 1156
158 Ga0453684_0707425 3300044712 Unclassified 1094
159 Ga0451576_0000307 3300045051 Bacteria 118840
160 Ga0451576_0008135 3300045051 Bacteria 12353
161 Ga0451576_0009380 3300045051 Bacteria 11350
162 Ga0451576_0044639 3300045051 Bacteria 4671
163 Ga0451576_0068054 3300045051 Bacteria 3706
164 Ga0451576_0205038 3300045051 Bacteria 2059
165 Ga0451576_0453109 3300045051 Bacteria 1347
166 Ga0451576_0453681 3300045051 Bacteria 1346
167 Ga0451576_0712380 3300045051 Bacteria 1054
168 Ga0501298_011183 3300049521 Bacteria 1555
169 Ga0501037_0059696 3300049573 Bacteria 2782
170 Ga0501038_0329502 3300049574 Bacteria 1193
171 Ga0501039_0179992 3300049575 Bacteria 1663
172 Ga0501071_0060861 3300049587 Bacteria 2734
173 Ga0501073_0018004 3300049589 Bacteria 5108
174 Ga0501074_0071247 3300049590 Bacteria 2499
175 Ga0501074_0165318 3300049590 Bacteria 1580
176 Ga0501075_0009575 3300049591 Bacteria 6783
177 Ga0501075_0128883 3300049591 Bacteria 1927
178 Ga0501075_0183371 3300049591 Unclassified 1597
179 Ga0501076_0492977 3300049592 Bacteria 1010
180 Ga0501079_0025303 3300049741 Bacteria 4553
181 Ga0501080_0065786 3300049742 Bacteria 3372
182 Ga0501080_0080421 3300049742 Bacteria 3029
183 Ga0501081_0007659 3300049743 Bacteria 7006
184 Ga0501081_0121922 3300049743 Bacteria 1858
185 nmdc:mga05p37_16556_c1 3300050507 Bacteria 8881
186 nmdc:mga05p37_29631_c1 3300050507 Bacteria 6678
187 nmdc:mga05p37_5443_c1 3300050507 Bacteria 14953
188 nmdc:mga05p37_77524_c1 3300050507 Bacteria 4092
189 nmdc:mga09592_112877_c1 3300050508 Bacteria 2332
190 nmdc:mga09592_16072_c1 3300050508 Bacteria 6117
191 nmdc:mga09592_30269_c1 3300050508 Bacteria 4504
192 nmdc:mga09592_77467_c1 3300050508 Bacteria 2828
193 nmdc:mga0qj67_16214_c1 3300050509 Bacteria 5646
194 nmdc:mga06r32_168670_c1 3300050510 Bacteria 2172
195 nmdc:mga06r32_40783_c2 3300050510 Bacteria 4042
196 nmdc:mga06r32_50168_c1 3300050510 Bacteria 3992
197 nmdc:mga08y16_174721_c1 3300050511 Bacteria 2230
198 nmdc:mga0n895_158562_c1 3300050512 Unclassified 2294
199 nmdc:mga0a205_85405_c1 3300050515 Unclassified 3048
200 Ga0501084_0005656 3300054114 Bacteria 10263
201 Ga0501082_0038739 3300060353 Bacteria 4111
202 Ga0501082_0056452 3300060353 Bacteria 3383
203 Ga0400489_07028
204 SwRhRL2b_contig_1013028
205 JGI25406J46586_10014021
206 Ga0065704_10070789
207 Ga0065707_10000467
208 Ga0065707_10083010
209 Ga0070689_100027080
210 Ga0070703_10019072
211 Ga0070701_10042608
212 Ga0070705_100025451
213 Ga0070700_100021211
214 Ga0070706_100026100
215 Ga0070706_100246021
216 Ga0070707_100119366
217 Ga0070698_100014539
218 Ga0070698_100016452
219 Ga0070698_100104715
220 Ga0070698_100134930
221 Ga0070698_100162818
222 Ga0070699_100004954
223 Ga0070699_100008330
224 Ga0070699_100017792
225 Ga0070699_100027706
226 Ga0068853_100282882
227 Ga0070704_100038730
228 Ga0070704_100170605
229 Ga0068857_100222577
230 Ga0068857_100447526
231 Ga0068859_100041776
232 Ga0068859_100061931
233 Ga0068864_100039597
234 Ga0068862_100074201
235 Ga0081539_10000908
236 Ga0081539_10019175
237 Ga0081539_10034770
238 Ga0075428_100065084
239 Ga0075428_100193044
240 Ga0075430_100129820
241 Ga0075431_100008134
242 Ga0075431_100085256
243 Ga0075431_100195397
244 Ga0075434_100133137
245 Ga0075429_100020264
246 Ga0075429_100047003
247 Ga0075429_100083919
248 Ga0075429_100095014
249 Ga0097620_100041777
250 Ga0097620_100061930
251 Ga0111539_10042855
252 Ga0114129_10027224
253 Ga0114129_10076586
254 Ga0105243_10003565
255 Ga0105243_10059050
256 Ga0105249_10013543
257 Ga0105249_10083005
258 Ga0105249_10676926
259 Ga0105246_10030725
260 Ga0105246_10049356
261 Ga0207660_10018235
262 Ga0207709_10027197
263 Ga0207712_10293848
264 Ga0207708_10009881
265 Ga0207674_10135851
266 Ga0207674_10289004
267 Ga0268265_10064132
268 Ga0265334_10022510
269 Ga0265318_10007644
270 Ga0265322_10045134
271 Ga0265338_10037644
272 Ga0265320_10003505
273 Ga0265340_10010767
274 Ga0265316_10089974
275 Ga0316575_10026427
276 Ga0316579_10001467
277 Ga0316579_10018731
278 Ga0316576_10093002
279 Ga0316576_10132696
280 Ga0316576_10280130
281 Ga0316576_10325128
282 Ga0316578_10008309
283 Ga0316578_10045151
284 Ga0316578_10051918
285 Ga0316578_10100508
286 Ga0307405_10196027
287 Ga0316577_10000647
288 Ga0316577_10103076
289 Ga0307413_10059829
290 Ga0307410_10059449
291 Ga0307407_10008905
292 Ga0307414_10411877
293 Ga0307415_100079738
294 Ga0316574_0071458
295 Ga0316582_0000076
296 Ga0316582_0002805
297 Ga0316582_0007285
298 Ga0316582_0037882
299 Ga0316582_0038783
300 Ga0316582_0086369
301 Ga0316584_0040227
302 Ga0316584_0059373
303 Ga0316584_0067276
304 Ga0316584_0070958
305 Ga0316584_0152258
306 Ga0316584_0185200
307 Ga0316581_0014397
308 Ga0316581_0036737
309 Ga0400488_43423
310 Ga0400489_73801
311 Ga0451577_0002318
312 Ga0451577_0003097
313 Ga0451577_0031721
314 Ga0451577_0039307
315 Ga0451577_0051234
316 Ga0451577_0087091
317 Ga0451577_0102160
318 Ga0451577_0102198
319 Ga0451577_0180821
320 Ga0451577_0398361
321 Ga0451577_0407844
322 Ga0453683_0000294
323 Ga0453683_0010024
324 Ga0453683_0022887
325 Ga0453683_0025858
326 Ga0453683_0028334
327 Ga0453683_0077740
328 Ga0453683_0219088
329 Ga0453684_0000023
330 Ga0453684_0000128
331 Ga0453684_0000541
332 Ga0453684_0000670
333 Ga0453684_0001401
334 Ga0453684_0001415
335 Ga0453684_0004730
336 Ga0453684_0007259
337 Ga0453684_0010151
338 Ga0453684_0010926
339 Ga0453684_0012220
340 Ga0453684_0014133
341 Ga0453684_0035062
342 Ga0453684_0048299
343 Ga0453684_0056114
344 Ga0453684_0059827
345 Ga0453684_0063046
346 Ga0453684_0073723
347 Ga0453684_0093989
348 Ga0453684_0117535
349 Ga0453684_0127510
350 Ga0453684_0135515
351 Ga0453684_0144408
352 Ga0453684_0154274
353 Ga0453684_0341446
354 Ga0453684_0348141
355 Ga0453684_0352989
356 Ga0453684_0361599
357 Ga0453684_0527815
358 Ga0453684_0589257
359 Ga0453684_0645291
360 Ga0453684_0707425
361 Ga0451576_0000307
362 Ga0451576_0008135
363 Ga0451576_0009380
364 Ga0451576_0044639
365 Ga0451576_0068054
366 Ga0451576_0205038
367 Ga0451576_0453109
368 Ga0451576_0453681
369 Ga0451576_0712380
370 Ga0501298_011183
371 Ga0501037_0059696
372 Ga0501038_0329502
373 Ga0501039_0179992
374 Ga0501071_0060861
375 Ga0501073_0018004
376 Ga0501074_0071247
377 Ga0501074_0165318
378 Ga0501075_0009575
379 Ga0501075_0128883
380 Ga0501075_0183371
381 Ga0501076_0492977
382 Ga0501079_0025303
383 Ga0501080_0065786
384 Ga0501080_0080421
385 Ga0501081_0007659
386 Ga0501081_0121922
387 nmdc:mga05p37_16556_c1
388 nmdc:mga05p37_29631_c1
389 nmdc:mga05p37_5443_c1
390 nmdc:mga05p37_77524_c1
391 nmdc:mga09592_112877_c1
392 nmdc:mga09592_16072_c1
393 nmdc:mga09592_30269_c1
394 nmdc:mga09592_77467_c1
395 nmdc:mga0qj67_16214_c1
396 nmdc:mga06r32_168670_c1
397 nmdc:mga06r32_40783_c2
398 nmdc:mga06r32_50168_c1
399 nmdc:mga08y16_174721_c1
400 nmdc:mga0n895_158562_c1
401 nmdc:mga0a205_85405_c1
402 Ga0501084_0005656
403 Ga0501082_0038739
404 Ga0501082_0056452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10555

MraY_sig1

Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1

46

58

0.96

PF00953

Glycos_transf_4

Glycosyl transferase family 4

83

254

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6oyh-assembly4.cif.gz_D crystal structure of mray bound to carbacaprazamycin 0.7702 8 309
6oz6-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7674 7 309
6oyh-assembly1.cif.gz_A crystal structure of mray bound to carbacaprazamycin 0.7621 7 309
6oz6-assembly4.cif.gz_D error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.7569 7 309
6oyh-assembly3.cif.gz_B crystal structure of mray bound to carbacaprazamycin 0.7548 1 309
ID Description Score Start End Superfamily
af_K7LBJ4_160_324_1.50.40.10 Mainly Alpha;Alpha/alpha barrel;Mitochondrial carrier fold;Mitochondrial carrier domain 0.3606 2 142 1.50.40.10
af_Q9VPV3_546_694_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.3547 117 215 1.10.287.70
af_Q6Z3I6_46_239_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.3413 88 231 1.20.1270.60
af_P40482_636_753_1.20.120.730 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Sec23/Sec24 helical domain 0.3307 88 216 1.20.120.730
af_Q5N7N1_268_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3132 14 234 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A645F8Y5-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9258 217 311 GO:0005886
GO:0008963
GO:0044038
GO:0051992
GO:0071555
AF-A0A661WDH8-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9101 83 312 GO:0005886
GO:0008963
GO:0009252
GO:0046872
GO:0051992
GO:0071555
AF-A0A2H0LI85-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) 0.9061 217 308 GO:0005886
GO:0008963
GO:0044038
GO:0046872
GO:0051992
GO:0071555
AF-A0A7V8VXK7-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase 0.8983 229 312 GO:0005886
GO:0016780
GO:0044038
GO:0071555
AF-A0A7V6IU11-F1-model_v4 Phospho-N-acetylmuramoyl-pentapeptide-transferase 0.8855 228 310 GO:0005886
GO:0016780
GO:0044038
GO:0071555

Map