F309811

General Info

Members Datasets Scaffolds Average Seq Length
202 159 404 144

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_11014261|Ga0105237_110142612
Length 165
Sequence MDSRFRGNDGALNDAICEEPMAIERMDNIGIVVDDLDAAIDFFRTLGLDLEGKATIEDEWAGRVTGLRGQRVEIAMMRTPDGHGRLELSRFLAPPVVADHRNAPVNALGYLRVMFAVDDLDDTLAKLARHGVQVVDEIVRYEDVYRLCYIRGPGGLLIGLAEELG

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
27 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
28 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
46 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
47 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
48 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
51 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
52 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
54 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
56 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
73 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
79 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
82 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
83 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
84 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
85 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
86 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
89 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
90 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
103 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
104 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
105 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
109 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
110 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
111 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
112 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
113 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
114 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
119 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
122 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
129 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
130 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
134 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
135 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
136 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
137 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
139 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
142 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
143 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
144 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
145 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
146 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
147 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
148 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
149 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
150 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
152 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
153 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
154 2643221573 Lysobacter sp. Root604 Isolate Unclassified
155 2643221720 Lysobacter sp. Root916 Isolate Unclassified
156 2643221728 Lysobacter sp. Root983 Isolate Unclassified
157 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
158 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
159 2932401849 Devosia sp. 2618 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.54
Metatranscriptomes 0.5
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.37
Nodule 0.99
Rhizoplane 2.48
Rhizosphere 60.4
Stem 0
Stem Tuber 0
Unclassified 0.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_11014261 3300009545 Bacteria 837
2 JGI25152J39213_1006818 3300002773 Bacteria 3034
3 JGI25150J39212_1000129 3300002774 Bacteria 42648
4 JGI25151J46595_10001041 3300003187 Bacteria 20704
5 JGI25153J46596_10013889 3300003215 Bacteria 3380
6 rootH1_10103409 3300003323 Bacteria 5599
7 JGI25407J50210_10052577 3300003373 Bacteria 1031
8 Ga0055525_1000054 3300003759 Bacteria 216523
9 Ga0055527_1008228 3300003760 Bacteria 1250
10 Ga0055524_1023327 3300003775 Bacteria 1995
11 Ga0070670_100350429 3300005331 Bacteria 1297
12 Ga0070714_100514295 3300005435 Bacteria 1143
13 Ga0070710_10061497 3300005437 Bacteria 2139
14 Ga0070705_100078601 3300005440 Bacteria 2018
15 Ga0070681_10037040 3300005458 Bacteria 4896
16 Ga0070706_100237396 3300005467 Bacteria 1702
17 Ga0070707_100503121 3300005468 Bacteria 1173
18 Ga0070697_100042088 3300005536 Bacteria 3697
19 Ga0068853_100015213 3300005539 Bacteria 6324
20 Ga0068855_100284339 3300005563 Bacteria 1835
21 Ga0068863_100551650 3300005841 Bacteria 1138
22 Ga0068860_100010053 3300005843 Bacteria 9375
23 Ga0068860_100018393 3300005843 Bacteria 6798
24 Ga0081538_10014740 3300005981 Bacteria 6099
25 Ga0081538_10070322 3300005981 Bacteria 1933
26 Ga0081540_1012264 3300005983 Bacteria 5662
27 Ga0081539_10317827 3300005985 Bacteria 663
28 Ga0075365_10021767 3300006038 Bacteria 4005
29 Ga0070712_100375140 3300006175 Bacteria 1170
30 Ga0075428_100461195 3300006844 Bacteria 1361
31 Ga0075431_100091211 3300006847 Bacteria 3145
32 Ga0075433_10093106 3300006852 Bacteria 2666
33 Ga0075434_100136955 3300006871 Bacteria 2468
34 Ga0075436_100003726 3300006914 Bacteria 10452
35 Ga0075436_100195598 3300006914 Bacteria 1431
36 Ga0075435_100072572 3300007076 Bacteria 2812
37 Ga0111539_10300032 3300009094 Bacteria 1870
38 Ga0114129_11241234 3300009147 Bacteria 926
39 Ga0105241_10645403 3300009174 Bacteria 961
40 Ga0105248_10008215 3300009177 Bacteria 11466
41 Ga0105249_12967053 3300009553 Bacteria 545
42 Ga0105239_10770349 3300010375 Unclassified 1102
43 Ga0105239_11549496 3300010375 Bacteria 766
44 Ga0157327_1063474 3300012512 Bacteria 557
45 Ga0157370_10653434 3300013104 Bacteria 961
46 Ga0163163_11489432 3300014325 Bacteria 738
47 Ga0182008_10181413 3300014497 Bacteria 1065
48 Ga0157379_10072244 3300014968 Bacteria 3086
49 Ga0163161_10033486 3300017792 Bacteria 3672
50 Ga0213876_10529323 3300021384 Bacteria 627
51 Ga0213875_10001506 3300021388 Bacteria 14992
52 Ga0209672_101125 3300025228 Bacteria 11157
53 Ga0209563_100075 3300025230 Bacteria 216575
54 Ga0207425_1000070 3300025245 Bacteria 116438
55 Ga0209129_1000172 3300025258 Bacteria 95144
56 Ga0209129_1029169 3300025258 Bacteria 932
57 Ga0209673_1012882 3300025273 Bacteria 3337
58 Ga0209673_1026791 3300025273 Bacteria 1886
59 Ga0209025_1000083 3300025294 Bacteria 265556
60 Ga0209564_1019770 3300025295 Bacteria 2501
61 Ga0209758_1000090 3300025297 Bacteria 246564
62 Ga0209256_1014535 3300025299 Bacteria 2824
63 Ga0207426_1008606 3300025302 Bacteria 4099
64 Ga0209051_1039615 3300025303 Bacteria 1699
65 Ga0207692_10048760 3300025898 Bacteria 2134
66 Ga0207707_10833888 3300025912 Bacteria 766
67 Ga0207671_10536089 3300025914 Bacteria 933
68 Ga0207660_10921337 3300025917 Bacteria 713
69 Ga0207646_10036876 3300025922 Bacteria 4411
70 Ga0207650_10293127 3300025925 Bacteria 1327
71 Ga0207664_10483492 3300025929 Bacteria 1108
72 Ga0207665_10072047 3300025939 Bacteria 2359
73 Ga0207711_10037254 3300025941 Bacteria 4130
74 Ga0207639_10011474 3300026041 Bacteria 6156
75 Ga0207702_10593493 3300026078 Bacteria 1086
76 Ga0207641_11998974 3300026088 Bacteria 581
77 Ga0207674_10057629 3300026116 Bacteria 3938
78 Ga0207428_10053371 3300027907 Bacteria 3224
79 Ga0207428_10361861 3300027907 Bacteria 1066
80 Ga0268266_10664022 3300028379 Bacteria 1004
81 Ga0268264_10006429 3300028381 Bacteria 9895
82 Ga0268264_10109893 3300028381 Bacteria 2413
83 Ga0307509_10082803 3300031507 Bacteria 3309
84 Ga0307408_100016971 3300031548 Bacteria 4868
85 Ga0307408_100560577 3300031548 Bacteria 1009
86 Ga0307508_10009820 3300031616 Bacteria 8769
87 Ga0307405_10107880 3300031731 Bacteria 1880
88 Ga0307413_10051987 3300031824 Bacteria 2472
89 Ga0307413_10108126 3300031824 Bacteria 1855
90 Ga0307410_10134707 3300031852 Bacteria 1819
91 Ga0307410_10183828 3300031852 Bacteria 1584
92 Ga0307406_10038449 3300031901 Bacteria 2962
93 Ga0307406_10161412 3300031901 Bacteria 1611
94 Ga0307407_10034984 3300031903 Bacteria 2755
95 Ga0307412_10018978 3300031911 Bacteria 4152
96 Ga0307412_10074539 3300031911 Bacteria 2325
97 Ga0307409_100049516 3300031995 Bacteria 3204
98 Ga0307409_100055381 3300031995 Bacteria 3061
99 Ga0307416_100216780 3300032002 Bacteria 1831
100 Ga0307416_100243845 3300032002 Bacteria 1743
101 Ga0307416_103728038 3300032002 Bacteria 510
102 Ga0307414_10469640 3300032004 Bacteria 1107
103 Ga0307415_100260560 3300032126 Bacteria 1414
104 Ga0307507_10220940 3300033179 Bacteria 1274
105 Ga0307510_10139919 3300033180 Bacteria 2066
106 Ga0373942_0194569 3300035207 Bacteria 670
107 Ga0373937_1596860 3300036401 Bacteria 599
108 Ga0395899_0090600 3300037312 Bacteria 2217
109 Ga0395900_0063149 3300037418 Bacteria 3807
110 Ga0395898_0265748 3300037466 Bacteria 1636
111 Ga0395898_1793482 3300037466 Bacteria 535
112 Ga0436364_1027303 3300037853 Bacteria 1102
113 Ga0436364_1375186 3300037853 Bacteria 86866
114 Ga0395901_0167892 3300038443 Bacteria 2303
115 Ga0395901_1336013 3300038443 Bacteria 677
116 Ga0436365_0257901 3300039437 Bacteria 4028
117 Ga0436360_0070994 3300039438 Bacteria 561
118 Ga0436361_0739381 3300039447 Bacteria 617
119 Ga0436362_0267129 3300039453 Bacteria 728
120 Ga0451800_1154535 3300041459 Bacteria 711
121 Ga0451855_1643097 3300041511 Bacteria 568
122 Ga0439450_044482 3300042008 Bacteria 1040
123 Ga0466971_0350923 3300044719 Bacteria 714
124 Ga0466968_0058684 3300044735 Bacteria 1656
125 Ga0466959_0710760 3300045049 Bacteria 673
126 Ga0451576_1264561 3300045051 Bacteria 770
127 Ga0495592_0010622 3300046454 Bacteria 6943
128 Ga0495585_0521766 3300046492 Bacteria 563
129 Ga0495606_0000260 3300046507 Bacteria 93381
130 Ga0495620_0393017 3300046515 Bacteria 525
131 Ga0495628_1120924 3300046516 Bacteria 537
132 Ga0495645_0000375 3300046543 Bacteria 31078
133 Ga0495625_0181800 3300046660 Bacteria 1398
134 Ga0495646_0057354 3300046680 Bacteria 2331
135 Ga0495600_0560691 3300046809 Bacteria 697
136 Ga0495675_0186612 3300047444 Bacteria 1267
137 Ga0495673_0158859 3300047469 Bacteria 869
138 Ga0495684_0139437 3300047471 Bacteria 1818
139 Ga0495686_0126583 3300047472 Bacteria 1518
140 Ga0495602_0330404 3300048088 Bacteria 1106
141 Ga0495626_0283999 3300048091 Bacteria 657
142 Ga0496101_0303830 3300048904 Bacteria 1250
143 Ga0496104_0046586 3300048907 Bacteria 4083
144 Ga0496108_0686373 3300048911 Bacteria 889
145 Ga0496114_0271516 3300048917 Bacteria 1494
146 Ga0496116_0025112 3300048919 Bacteria 4388
147 Ga0496116_0034398 3300048919 Bacteria 3576
148 Ga0496116_0068791 3300048919 Bacteria 2254
149 Ga0496117_0023394 3300048920 Bacteria 4926
150 Ga0496117_0036549 3300048920 Bacteria 3673
151 Ga0496117_0147557 3300048920 Bacteria 1397
152 Ga0496118_0024248 3300048921 Bacteria 5244
153 Ga0496118_0032894 3300048921 Bacteria 4263
154 Ga0496119_0017745 3300048922 Bacteria 5336
155 Ga0496119_0145401 3300048922 Bacteria 1276
156 Ga0496121_0022771 3300048924 Bacteria 6060
157 Ga0496121_0025002 3300048924 Bacteria 5687
158 Ga0496121_0029981 3300048924 Bacteria 5008
159 Ga0496121_0116254 3300048924 Bacteria 2029
160 Ga0496121_0462234 3300048924 Bacteria 815
161 Ga0496122_0018513 3300048925 Bacteria 6428
162 Ga0496122_0042768 3300048925 Bacteria 3559
163 Ga0496122_0045840 3300048925 Bacteria 3392
164 Ga0496122_0047096 3300048925 Bacteria 3331
165 Ga0496122_0090601 3300048925 Bacteria 2086
166 Ga0496123_0021986 3300048926 Bacteria 4933
167 Ga0496123_0025030 3300048926 Bacteria 4513
168 Ga0496123_0035992 3300048926 Bacteria 3518
169 Ga0496124_0006996 3300048927 Bacteria 12093
170 Ga0496124_0026462 3300048927 Bacteria 5229
171 Ga0496124_0053021 3300048927 Bacteria 3441
172 Ga0496124_0180241 3300048927 Bacteria 1626
173 Ga0496124_0215156 3300048927 Bacteria 1450
174 Ga0496125_0007130 3300048928 Bacteria 11927
175 Ga0496125_0236832 3300048928 Bacteria 1162
176 Ga0496126_0035762 3300048929 Bacteria 4650
177 Ga0496126_0237675 3300048929 Bacteria 1524
178 Ga0501034_0360189 3300049571 Bacteria 1382
179 Ga0501206_098385 3300049653 Bacteria 528
180 nmdc:mga0yw44_15585_c1 3300050492 Bacteria 1275
181 nmdc:mga0yw44_890999_c1 3300050492 Bacteria 603
182 nmdc:mga06z11_827798_c1 3300050494 Bacteria 564
183 nmdc:mga05p37_1276538_c1 3300050507 Bacteria 751
184 nmdc:mga08y16_114785_c1 3300050511 Bacteria 2804
185 nmdc:mga08y16_13120_c1 3300050511 Bacteria 8717
186 nmdc:mga0rr50_251219_c1 3300050513 Bacteria 1469
187 nmdc:mga08x19_67452_c1 3300050514 Bacteria 2327
188 nmdc:mga0a205_50618_c1 3300050515 Bacteria 4011
189 Ga0500594_0017723 3300053118 Bacteria 1746
190 Ga0500573_0283986 3300053140 Bacteria 836
191 Ga0500625_051333 3300053729 Bacteria 1903
192 Ga0590071_026198 3300059421 Bacteria 1383
193 Ga0590074_064021 3300059423 Bacteria 687
194 Ga0587079_029355 3300059647 Bacteria 1047
195 2515851843 2515154155 Bacteria 7985436
196 2585257844 2582581304 Bacteria 5831370
197 2643879471 2643221573 Bacteria 4784121
198 2644662918 2643221720 Bacteria 4694283
199 2644698128 2643221728 Bacteria 4797149
200 2856314237 2856314179 Bacteria 6477897
201 2906414659 2906414383 Bacteria 6580790
202 2932402224 2932401849 Bacteria 4262978
203 Ga0105237_11014261
204 JGI25152J39213_1006818
205 JGI25150J39212_1000129
206 JGI25151J46595_10001041
207 JGI25153J46596_10013889
208 rootH1_10103409
209 JGI25407J50210_10052577
210 Ga0055525_1000054
211 Ga0055527_1008228
212 Ga0055524_1023327
213 Ga0070670_100350429
214 Ga0070714_100514295
215 Ga0070710_10061497
216 Ga0070705_100078601
217 Ga0070681_10037040
218 Ga0070706_100237396
219 Ga0070707_100503121
220 Ga0070697_100042088
221 Ga0068853_100015213
222 Ga0068855_100284339
223 Ga0068863_100551650
224 Ga0068860_100010053
225 Ga0068860_100018393
226 Ga0081538_10014740
227 Ga0081538_10070322
228 Ga0081540_1012264
229 Ga0081539_10317827
230 Ga0075365_10021767
231 Ga0070712_100375140
232 Ga0075428_100461195
233 Ga0075431_100091211
234 Ga0075433_10093106
235 Ga0075434_100136955
236 Ga0075436_100003726
237 Ga0075436_100195598
238 Ga0075435_100072572
239 Ga0111539_10300032
240 Ga0114129_11241234
241 Ga0105241_10645403
242 Ga0105248_10008215
243 Ga0105249_12967053
244 Ga0105239_10770349
245 Ga0105239_11549496
246 Ga0157327_1063474
247 Ga0157370_10653434
248 Ga0163163_11489432
249 Ga0182008_10181413
250 Ga0157379_10072244
251 Ga0163161_10033486
252 Ga0213876_10529323
253 Ga0213875_10001506
254 Ga0209672_101125
255 Ga0209563_100075
256 Ga0207425_1000070
257 Ga0209129_1000172
258 Ga0209129_1029169
259 Ga0209673_1012882
260 Ga0209673_1026791
261 Ga0209025_1000083
262 Ga0209564_1019770
263 Ga0209758_1000090
264 Ga0209256_1014535
265 Ga0207426_1008606
266 Ga0209051_1039615
267 Ga0207692_10048760
268 Ga0207707_10833888
269 Ga0207671_10536089
270 Ga0207660_10921337
271 Ga0207646_10036876
272 Ga0207650_10293127
273 Ga0207664_10483492
274 Ga0207665_10072047
275 Ga0207711_10037254
276 Ga0207639_10011474
277 Ga0207702_10593493
278 Ga0207641_11998974
279 Ga0207674_10057629
280 Ga0207428_10053371
281 Ga0207428_10361861
282 Ga0268266_10664022
283 Ga0268264_10006429
284 Ga0268264_10109893
285 Ga0307509_10082803
286 Ga0307408_100016971
287 Ga0307408_100560577
288 Ga0307508_10009820
289 Ga0307405_10107880
290 Ga0307413_10051987
291 Ga0307413_10108126
292 Ga0307410_10134707
293 Ga0307410_10183828
294 Ga0307406_10038449
295 Ga0307406_10161412
296 Ga0307407_10034984
297 Ga0307412_10018978
298 Ga0307412_10074539
299 Ga0307409_100049516
300 Ga0307409_100055381
301 Ga0307416_100216780
302 Ga0307416_100243845
303 Ga0307416_103728038
304 Ga0307414_10469640
305 Ga0307415_100260560
306 Ga0307507_10220940
307 Ga0307510_10139919
308 Ga0373942_0194569
309 Ga0373937_1596860
310 Ga0395899_0090600
311 Ga0395900_0063149
312 Ga0395898_0265748
313 Ga0395898_1793482
314 Ga0436364_1027303
315 Ga0436364_1375186
316 Ga0395901_0167892
317 Ga0395901_1336013
318 Ga0436365_0257901
319 Ga0436360_0070994
320 Ga0436361_0739381
321 Ga0436362_0267129
322 Ga0451800_1154535
323 Ga0451855_1643097
324 Ga0439450_044482
325 Ga0466971_0350923
326 Ga0466968_0058684
327 Ga0466959_0710760
328 Ga0451576_1264561
329 Ga0495592_0010622
330 Ga0495585_0521766
331 Ga0495606_0000260
332 Ga0495620_0393017
333 Ga0495628_1120924
334 Ga0495645_0000375
335 Ga0495625_0181800
336 Ga0495646_0057354
337 Ga0495600_0560691
338 Ga0495675_0186612
339 Ga0495673_0158859
340 Ga0495684_0139437
341 Ga0495686_0126583
342 Ga0495602_0330404
343 Ga0495626_0283999
344 Ga0496101_0303830
345 Ga0496104_0046586
346 Ga0496108_0686373
347 Ga0496114_0271516
348 Ga0496116_0025112
349 Ga0496116_0034398
350 Ga0496116_0068791
351 Ga0496117_0023394
352 Ga0496117_0036549
353 Ga0496117_0147557
354 Ga0496118_0024248
355 Ga0496118_0032894
356 Ga0496119_0017745
357 Ga0496119_0145401
358 Ga0496121_0022771
359 Ga0496121_0025002
360 Ga0496121_0029981
361 Ga0496121_0116254
362 Ga0496121_0462234
363 Ga0496122_0018513
364 Ga0496122_0042768
365 Ga0496122_0045840
366 Ga0496122_0047096
367 Ga0496122_0090601
368 Ga0496123_0021986
369 Ga0496123_0025030
370 Ga0496123_0035992
371 Ga0496124_0006996
372 Ga0496124_0026462
373 Ga0496124_0053021
374 Ga0496124_0180241
375 Ga0496124_0215156
376 Ga0496125_0007130
377 Ga0496125_0236832
378 Ga0496126_0035762
379 Ga0496126_0237675
380 Ga0501034_0360189
381 Ga0501206_098385
382 nmdc:mga0yw44_15585_c1
383 nmdc:mga0yw44_890999_c1
384 nmdc:mga06z11_827798_c1
385 nmdc:mga05p37_1276538_c1
386 nmdc:mga08y16_114785_c1
387 nmdc:mga08y16_13120_c1
388 nmdc:mga0rr50_251219_c1
389 nmdc:mga08x19_67452_c1
390 nmdc:mga0a205_50618_c1
391 Ga0500594_0017723
392 Ga0500573_0283986
393 Ga0500625_051333
394 Ga0590071_026198
395 Ga0590074_064021
396 Ga0587079_029355
397 2515851843
398 2585257844
399 2643879471
400 2644662918
401 2644698128
402 2856314237
403 2906414659
404 2932402224

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

25

160

0.91

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

27

149

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9032 1 145
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8974 1 145
2i5x-assembly1.cif.gz_A engineering the ptpbeta catalytic domain with improved crystallization properties 0.7977 112 144
2i5x-assembly2.cif.gz_B engineering the ptpbeta catalytic domain with improved crystallization properties 0.7826 112 144
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.7813 112 144
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8923 2 145 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8864 2 145 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8436 90 145 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8392 9 143 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8251 9 143 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A346XUA4-F1-model_v4 Glyoxalase family protein 0.9184 6 145 GO:0004493
GO:0046491
AF-A0A858RR96-F1-model_v4 VOC family protein 0.917 6 145
AF-A0A841K6N3-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9158 56 145 GO:0016829
GO:0051213
AF-A0A0S2FWJ6-F1-model_v4 deleted 0.9156 57 145
AF-A0A346XUA4-F1-model_v4 Glyoxalase family protein 0.9123 6 145 GO:0004493
GO:0046491

Map