F309569
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 202 | 120 | 202 | 370 |
Family's Representative Sequence
| Representative Sequence | 3300005544|Ga0070686_100001507|Ga0070686_1000015074 |
| Length | 423 |
| Sequence | MKDETATSFLILHPSSFILRRGGSAFVCYLFPENTSSTSKGIWKMSRKLHHVVIAPVIVLFIVFLVTPQTIAQQACFSAAERERVEKTAKVWRTPDPGYDPVLXXXXANGPRKGAPPVDDSGLAKPINCVANKDESPGSGTTPKFHCSVPGNTDNDGNLIRYKVKPHFKGQSPDKRNGEIYGEFLSSRFSKALGFFADDEWVADVNCPDCEKSLTSKFQGAPWSPSQPAAGIEMSLARGVDVNCNGKDSGSLSGSLEKLAANGAPRAEIDAFKLWLAFIDHGDTKTDNHKFACLDSKKDGNNRVCKPGEAVFYVSDMGSTFGFSASSEKKAKLETWKKKDPIKVSGGSCQANAKSVGDTNISEAGRQLLATQLQTLLDAEKSNGTITKVFRASRNAERDQPAEQWTAEFIRKARMIIDARCSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 2 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 29 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 30 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 31 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 36 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 39 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 40 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 92 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 98 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 99 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 100 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 101 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 102 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 103 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 105 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 106 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 107 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 108 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 109 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 110 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 111 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 112 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 113 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 114 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 115 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 116 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 117 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 118 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 119 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 120 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.99 |
| Rhizosphere | 99.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24748J21848_1000011 | 3300002074 | Bacteria | 157004 |
| 2 | JGI24034J26672_10000023 | 3300002239 | Bacteria | 115999 |
| 3 | JGI25406J46586_10002732 | 3300003203 | Bacteria | 8314 |
| 4 | JGI25406J46586_10037787 | 3300003203 | Bacteria | 1737 |
| 5 | Ga0065704_10130200 | 3300005289 | Bacteria | 1632 |
| 6 | Ga0065715_10006425 | 3300005293 | Bacteria | 4644 |
| 7 | Ga0065715_10121951 | 3300005293 | Bacteria | 2217 |
| 8 | Ga0065715_10146704 | 3300005293 | Unclassified | 1780 |
| 9 | Ga0070658_10006221 | 3300005327 | Bacteria | 9672 |
| 10 | Ga0070676_10106839 | 3300005328 | Unclassified | 1737 |
| 11 | Ga0070690_100011540 | 3300005330 | Bacteria | 5170 |
| 12 | Ga0070690_100182374 | 3300005330 | Unclassified | 1451 |
| 13 | Ga0070670_100000071 | 3300005331 | Bacteria | 102454 |
| 14 | Ga0070670_100069752 | 3300005331 | Bacteria | 3018 |
| 15 | Ga0070682_100005983 | 3300005337 | Bacteria | 6809 |
| 16 | Ga0070689_100337530 | 3300005340 | Bacteria | 1262 |
| 17 | Ga0070687_100028528 | 3300005343 | Bacteria | 2708 |
| 18 | Ga0070692_10002071 | 3300005345 | Bacteria | 7643 |
| 19 | Ga0070668_100010938 | 3300005347 | Bacteria | 6751 |
| 20 | Ga0070671_100026045 | 3300005355 | Bacteria | 4804 |
| 21 | Ga0070671_100067306 | 3300005355 | Unclassified | 2986 |
| 22 | Ga0070701_10048112 | 3300005438 | Bacteria | 2199 |
| 23 | Ga0070705_100155028 | 3300005440 | Bacteria | 1524 |
| 24 | Ga0070700_100069089 | 3300005441 | Bacteria | 2248 |
| 25 | Ga0070700_100095598 | 3300005441 | Bacteria | 1948 |
| 26 | Ga0070700_100102556 | 3300005441 | Unclassified | 1887 |
| 27 | Ga0070694_100058682 | 3300005444 | Bacteria | 2619 |
| 28 | Ga0070681_10001279 | 3300005458 | Bacteria | 21955 |
| 29 | Ga0070681_10002615 | 3300005458 | Bacteria | 16525 |
| 30 | Ga0070681_10097375 | 3300005458 | Bacteria | 2889 |
| 31 | Ga0070706_100027995 | 3300005467 | Bacteria | 5184 |
| 32 | Ga0070679_100002107 | 3300005530 | Bacteria | 17921 |
| 33 | Ga0068853_100037909 | 3300005539 | Unclassified | 4104 |
| 34 | Ga0070686_100001507 | 3300005544 | Bacteria | 13100 |
| 35 | Ga0070686_100017121 | 3300005544 | Bacteria | 4230 |
| 36 | Ga0070695_100013874 | 3300005545 | Bacteria | 4849 |
| 37 | Ga0070695_100037710 | 3300005545 | Unclassified | 3047 |
| 38 | Ga0070695_100040288 | 3300005545 | Bacteria | 2957 |
| 39 | Ga0070695_100112095 | 3300005545 | Unclassified | 1853 |
| 40 | Ga0070695_100136181 | 3300005545 | Bacteria | 1698 |
| 41 | Ga0070696_100018024 | 3300005546 | Bacteria | 4769 |
| 42 | Ga0070696_100045180 | 3300005546 | Unclassified | 3052 |
| 43 | Ga0070696_100068770 | 3300005546 | Bacteria | 2487 |
| 44 | Ga0070696_100078815 | 3300005546 | Unclassified | 2330 |
| 45 | Ga0070693_100015350 | 3300005547 | Bacteria | 3942 |
| 46 | Ga0070693_100097829 | 3300005547 | Bacteria | 1782 |
| 47 | Ga0068859_100079882 | 3300005617 | Bacteria | 3311 |
| 48 | Ga0068859_100312016 | 3300005617 | Bacteria | 1666 |
| 49 | Ga0068864_100031327 | 3300005618 | Bacteria | 4512 |
| 50 | Ga0068861_100001062 | 3300005719 | Bacteria | 16903 |
| 51 | Ga0068861_100301474 | 3300005719 | Bacteria | 1388 |
| 52 | Ga0068863_100326635 | 3300005841 | Unclassified | 1491 |
| 53 | Ga0068858_100000253 | 3300005842 | Bacteria | 57137 |
| 54 | Ga0068858_100151357 | 3300005842 | Bacteria | 2182 |
| 55 | Ga0068858_100262951 | 3300005842 | Bacteria | 1640 |
| 56 | Ga0068860_100015817 | 3300005843 | Bacteria | 7367 |
| 57 | Ga0068860_100298313 | 3300005843 | Bacteria | 1578 |
| 58 | Ga0068862_100103292 | 3300005844 | Bacteria | 2496 |
| 59 | Ga0081539_10000875 | 3300005985 | Bacteria | 57733 |
| 60 | Ga0081539_10000898 | 3300005985 | Bacteria | 56680 |
| 61 | Ga0081539_10009246 | 3300005985 | Bacteria | 8291 |
| 62 | Ga0097621_100002182 | 3300006237 | Bacteria | 13392 |
| 63 | Ga0097621_100239784 | 3300006237 | Bacteria | 1585 |
| 64 | Ga0068871_100033511 | 3300006358 | Unclassified | 4068 |
| 65 | Ga0068871_100094212 | 3300006358 | Bacteria | 2500 |
| 66 | Ga0075430_100021160 | 3300006846 | Bacteria | 5530 |
| 67 | Ga0075431_100407420 | 3300006847 | Unclassified | 1360 |
| 68 | Ga0075433_10013726 | 3300006852 | Bacteria | 6599 |
| 69 | Ga0075433_10016436 | 3300006852 | Bacteria | 6100 |
| 70 | Ga0075433_10033918 | 3300006852 | Bacteria | 4380 |
| 71 | Ga0075433_10109171 | 3300006852 | Bacteria | 2454 |
| 72 | Ga0075433_10149678 | 3300006852 | Unclassified | 2076 |
| 73 | Ga0075434_100023284 | 3300006871 | Bacteria | 6033 |
| 74 | Ga0075434_100037843 | 3300006871 | Bacteria | 4776 |
| 75 | Ga0097620_100001775 | 3300006931 | Bacteria | 21958 |
| 76 | Ga0097620_100079882 | 3300006931 | Bacteria | 3311 |
| 77 | Ga0097620_100312011 | 3300006931 | Bacteria | 1666 |
| 78 | Ga0111539_10141875 | 3300009094 | Bacteria | 2812 |
| 79 | Ga0105247_10000003 | 3300009101 | Bacteria | 694517 |
| 80 | Ga0105247_10000796 | 3300009101 | Bacteria | 24171 |
| 81 | Ga0105247_10075375 | 3300009101 | Bacteria | 2117 |
| 82 | Ga0114129_10003333 | 3300009147 | Bacteria | 22577 |
| 83 | Ga0114129_10013748 | 3300009147 | Bacteria | 11539 |
| 84 | Ga0114129_10060331 | 3300009147 | Bacteria | 5303 |
| 85 | Ga0114129_10120226 | 3300009147 | Bacteria | 3617 |
| 86 | Ga0114129_10127148 | 3300009147 | Bacteria | 3504 |
| 87 | Ga0105243_10000436 | 3300009148 | Bacteria | 43715 |
| 88 | Ga0105241_10010016 | 3300009174 | Bacteria | 6960 |
| 89 | Ga0105241_10035512 | 3300009174 | Bacteria | 3749 |
| 90 | Ga0105241_10052710 | 3300009174 | Bacteria | 3108 |
| 91 | Ga0105241_10130777 | 3300009174 | Bacteria | 2032 |
| 92 | Ga0105242_10005491 | 3300009176 | Bacteria | 9788 |
| 93 | Ga0105242_10007815 | 3300009176 | Bacteria | 8231 |
| 94 | Ga0105248_10002839 | 3300009177 | Bacteria | 19218 |
| 95 | Ga0105237_10038445 | 3300009545 | Bacteria | 4831 |
| 96 | Ga0105238_10005288 | 3300009551 | Bacteria | 12762 |
| 97 | Ga0105238_10016593 | 3300009551 | Bacteria | 7456 |
| 98 | Ga0105249_10000190 | 3300009553 | Bacteria | 70486 |
| 99 | Ga0105249_10018628 | 3300009553 | Bacteria | 6183 |
| 100 | Ga0105249_10024996 | 3300009553 | Bacteria | 5374 |
| 101 | Ga0105249_10352561 | 3300009553 | Bacteria | 1491 |
| 102 | Ga0105239_10185907 | 3300010375 | Bacteria | 2325 |
| 103 | Ga0105239_10336311 | 3300010375 | Bacteria | 1704 |
| 104 | Ga0105246_10016942 | 3300011119 | Bacteria | 4625 |
| 105 | Ga0157374_10157301 | 3300013296 | Bacteria | 2212 |
| 106 | Ga0157378_10000379 | 3300013297 | Bacteria | 43998 |
| 107 | Ga0157378_10029599 | 3300013297 | Bacteria | 4836 |
| 108 | Ga0157378_10050530 | 3300013297 | Bacteria | 3700 |
| 109 | Ga0163162_10000039 | 3300013306 | Bacteria | 137338 |
| 110 | Ga0163162_10025749 | 3300013306 | Bacteria | 5816 |
| 111 | Ga0163162_10036014 | 3300013306 | Bacteria | 4930 |
| 112 | Ga0163162_10058214 | 3300013306 | Bacteria | 3893 |
| 113 | Ga0163162_10246423 | 3300013306 | Bacteria | 1918 |
| 114 | Ga0163162_10475747 | 3300013306 | Unclassified | 1380 |
| 115 | Ga0157372_10272958 | 3300013307 | Bacteria | 1965 |
| 116 | Ga0157375_10006994 | 3300013308 | Bacteria | 9852 |
| 117 | Ga0157375_10099315 | 3300013308 | Bacteria | 2990 |
| 118 | Ga0163163_10000188 | 3300014325 | Bacteria | 63392 |
| 119 | Ga0163163_10015359 | 3300014325 | Bacteria | 7076 |
| 120 | Ga0163163_10081805 | 3300014325 | Bacteria | 3232 |
| 121 | Ga0163163_10559636 | 3300014325 | Bacteria | 1206 |
| 122 | Ga0207672_1000845 | 3300025223 | Bacteria | 3186 |
| 123 | Ga0207710_10000001 | 3300025900 | Bacteria | 1797433 |
| 124 | Ga0207710_10000602 | 3300025900 | Bacteria | 21021 |
| 125 | Ga0207705_10013191 | 3300025909 | Bacteria | 5965 |
| 126 | Ga0207707_10000080 | 3300025912 | Bacteria | 96693 |
| 127 | Ga0207707_10094759 | 3300025912 | Bacteria | 2609 |
| 128 | Ga0207660_10064045 | 3300025917 | Bacteria | 2652 |
| 129 | Ga0207662_10031407 | 3300025918 | Bacteria | 3085 |
| 130 | Ga0207652_10001974 | 3300025921 | Bacteria | 17736 |
| 131 | Ga0207646_10008928 | 3300025922 | Bacteria | 9982 |
| 132 | Ga0207681_10022570 | 3300025923 | Bacteria | 4015 |
| 133 | Ga0207694_10001759 | 3300025924 | Bacteria | 18159 |
| 134 | Ga0207694_10036361 | 3300025924 | Bacteria | 3780 |
| 135 | Ga0207650_10000006 | 3300025925 | Bacteria | 544730 |
| 136 | Ga0207644_10000356 | 3300025931 | Bacteria | 29717 |
| 137 | Ga0207690_10082763 | 3300025932 | Unclassified | 2245 |
| 138 | Ga0207686_10001528 | 3300025934 | Bacteria | 13044 |
| 139 | Ga0207709_10000899 | 3300025935 | Bacteria | 22461 |
| 140 | Ga0207709_10050732 | 3300025935 | Unclassified | 2539 |
| 141 | Ga0207704_10068311 | 3300025938 | Bacteria | 2240 |
| 142 | Ga0207711_10008138 | 3300025941 | Bacteria | 8776 |
| 143 | Ga0207711_10015998 | 3300025941 | Bacteria | 6224 |
| 144 | Ga0207711_10071984 | 3300025941 | Unclassified | 3001 |
| 145 | Ga0207689_10013292 | 3300025942 | Bacteria | 7022 |
| 146 | Ga0207651_10029074 | 3300025960 | Bacteria | 3497 |
| 147 | Ga0207712_10000201 | 3300025961 | Bacteria | 60068 |
| 148 | Ga0207712_10000530 | 3300025961 | Bacteria | 31311 |
| 149 | Ga0207712_10025508 | 3300025961 | Bacteria | 3928 |
| 150 | Ga0207668_10014015 | 3300025972 | Bacteria | 4955 |
| 151 | Ga0207703_10000055 | 3300026035 | Bacteria | 143420 |
| 152 | Ga0207703_10123949 | 3300026035 | Bacteria | 2222 |
| 153 | Ga0207703_10157841 | 3300026035 | Bacteria | 1984 |
| 154 | Ga0207639_10188457 | 3300026041 | Bacteria | 1760 |
| 155 | Ga0207708_10000349 | 3300026075 | Bacteria | 36214 |
| 156 | Ga0207708_10014186 | 3300026075 | Bacteria | 5958 |
| 157 | Ga0207708_10074721 | 3300026075 | Bacteria | 2598 |
| 158 | Ga0207641_10146180 | 3300026088 | Bacteria | 2138 |
| 159 | Ga0207648_10065279 | 3300026089 | Unclassified | 3173 |
| 160 | Ga0207648_10082833 | 3300026089 | Bacteria | 2798 |
| 161 | Ga0207648_10308714 | 3300026089 | Bacteria | 1420 |
| 162 | Ga0207676_10110436 | 3300026095 | Bacteria | 2300 |
| 163 | Ga0207674_10090995 | 3300026116 | Bacteria | 3042 |
| 164 | Ga0207674_10231045 | 3300026116 | Bacteria | 1797 |
| 165 | Ga0207675_100004377 | 3300026118 | Bacteria | 13653 |
| 166 | Ga0207675_100035973 | 3300026118 | Bacteria | 4618 |
| 167 | Ga0207698_10289815 | 3300026142 | Bacteria | 1518 |
| 168 | Ga0207428_10239235 | 3300027907 | Bacteria | 1357 |
| 169 | Ga0268265_10197685 | 3300028380 | Bacteria | 1741 |
| 170 | Ga0307405_10039701 | 3300031731 | Bacteria | 2847 |
| 171 | Ga0307413_10106238 | 3300031824 | Bacteria | 1868 |
| 172 | Ga0307412_10068634 | 3300031911 | Bacteria | 2411 |
| 173 | Ga0307416_100397710 | 3300032002 | Bacteria | 1414 |
| 174 | Ga0307414_10198261 | 3300032004 | Bacteria | 1630 |
| 175 | Ga0307415_100076389 | 3300032126 | Bacteria | 2374 |
| 176 | Ga0373951_0000933 | 3300035091 | Bacteria | 7866 |
| 177 | Ga0373942_0008576 | 3300035207 | Unclassified | 2385 |
| 178 | Ga0395901_0427062 | 3300038443 | Unclassified | 1358 |
| 179 | Ga0242420_006628 | 3300038996 | Bacteria | 1834 |
| 180 | Ga0495663_0000122 | 3300046525 | Bacteria | 32201 |
| 181 | Ga0496106_0016249 | 3300048909 | Bacteria | 5506 |
| 182 | Ga0496113_0090870 | 3300048916 | Bacteria | 2353 |
| 183 | Ga0501298_001516 | 3300049521 | Bacteria | 3421 |
| 184 | Ga0501038_0006008 | 3300049574 | Bacteria | 11233 |
| 185 | Ga0501202_004073 | 3300049652 | Bacteria | 2543 |
| 186 | Ga0501217_008487 | 3300049661 | Bacteria | 2220 |
| 187 | Ga0501223_000547 | 3300049663 | Bacteria | 9060 |
| 188 | Ga0501227_001707 | 3300049665 | Bacteria | 4872 |
| 189 | Ga0501233_003139 | 3300049668 | Bacteria | 2959 |
| 190 | Ga0501235_000440 | 3300049669 | Bacteria | 8077 |
| 191 | Ga0501225_0012484 | 3300049705 | Bacteria | 2386 |
| 192 | nmdc:mga05p37_187768_c1 | 3300050507 | Bacteria | 2512 |
| 193 | nmdc:mga05p37_353921_c1 | 3300050507 | Unclassified | 1728 |
| 194 | nmdc:mga05p37_482598_c1 | 3300050507 | Bacteria | 1427 |
| 195 | nmdc:mga09592_19792_c1 | 3300050508 | Bacteria | 5529 |
| 196 | nmdc:mga06r32_397770_c1 | 3300050510 | Unclassified | 1360 |
| 197 | nmdc:mga0n895_173496_c1 | 3300050512 | Bacteria | 2188 |
| 198 | nmdc:mga0n895_196727_c1 | 3300050512 | Unclassified | 2047 |
| 199 | nmdc:mga08x19_14079_c1 | 3300050514 | Bacteria | 4847 |
| 200 | nmdc:mga0a205_15301_c1 | 3300050515 | Bacteria | 7168 |
| 201 | nmdc:mga0a205_20039_c1 | 3300050515 | Bacteria | 6310 |
| 202 | nmdc:mga0a205_215746_c1 | 3300050515 | Unclassified | 1806 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300014325 | Ga0163163_10081805 | Ga0163163_100818052 | 333 |
| 2 | 3300005293 | Ga0065715_10006425 | Ga0065715_100064252 | 336 |
| 3 | 3300005440 | Ga0070705_100155028 | Ga0070705_1001550282 | 336 |
| 4 | 3300005545 | Ga0070695_100037710 | Ga0070695_1000377102 | 336 |
| 5 | 3300005546 | Ga0070696_100068770 | Ga0070696_1000687702 | 336 |
| 6 | 3300009545 | Ga0105237_10038445 | Ga0105237_100384454 | 336 |
| 7 | 3300049668 | Ga0501233_003139 | Ga0501233_003139_1826_2935 | 336 |
| 8 | 3300046525 | Ga0495663_0000122 | Ga0495663_0000122_9795_10916 | 337 |
| 9 | 3300009148 | Ga0105243_10000436 | Ga0105243_1000043622 | 338 |
| 10 | 3300005458 | Ga0070681_10002615 | Ga0070681_100026155 | 340 |
| 11 | 3300006358 | Ga0068871_100094212 | Ga0068871_1000942122 | 340 |
| 12 | 3300009174 | Ga0105241_10130777 | Ga0105241_101307771 | 341 |
| 13 | 3300026089 | Ga0207648_10082833 | Ga0207648_100828332 | 341 |
| 14 | 3300005545 | Ga0070695_100013874 | Ga0070695_1000138745 | 342 |
| 15 | 3300005546 | Ga0070696_100018024 | Ga0070696_1000180242 | 342 |
| 16 | 3300005617 | Ga0068859_100079882 | Ga0068859_1000798822 | 342 |
| 17 | 3300006931 | Ga0097620_100079882 | Ga0097620_1000798822 | 342 |
| 18 | 3300009177 | Ga0105248_10002839 | Ga0105248_1000283912 | 342 |
| 19 | 3300026088 | Ga0207641_10146180 | Ga0207641_101461802 | 342 |
| 20 | 3300050515 | nmdc:mga0a205_15301_c1 | nmdc:mga0a205_15301_c1_5397_6536 | 342 |
| 21 | 3300010375 | Ga0105239_10336311 | Ga0105239_103363112 | 343 |
| 22 | 3300038996 | Ga0242420_006628 | Ga0242420_006628_621_1787 | 343 |
| 23 | 3300005331 | Ga0070670_100069752 | Ga0070670_1000697524 | 344 |
| 24 | 3300006847 | Ga0075431_100407420 | Ga0075431_1004074202 | 344 |
| 25 | 3300009147 | Ga0114129_10003333 | Ga0114129_100033333 | 344 |
| 26 | 3300009147 | Ga0114129_10060331 | Ga0114129_100603313 | 344 |
| 27 | 3300013296 | Ga0157374_10157301 | Ga0157374_101573013 | 344 |
| 28 | 3300013308 | Ga0157375_10099315 | Ga0157375_100993152 | 344 |
| 29 | 3300025942 | Ga0207689_10013292 | Ga0207689_100132922 | 344 |
| 30 | 3300035207 | Ga0373942_0008576 | Ga0373942_0008576_907_1992 | 344 |
| 31 | 3300050510 | nmdc:mga06r32_397770_c1 | nmdc:mga06r32_397770_c1_55_1197 | 344 |
| 32 | 3300009176 | Ga0105242_10007815 | Ga0105242_100078152 | 345 |
| 33 | 3300026089 | Ga0207648_10065279 | Ga0207648_100652792 | 345 |
| 34 | 3300031731 | Ga0307405_10039701 | Ga0307405_100397012 | 345 |
| 35 | 3300031824 | Ga0307413_10106238 | Ga0307413_101062382 | 345 |
| 36 | 3300031911 | Ga0307412_10068634 | Ga0307412_100686342 | 345 |
| 37 | 3300032004 | Ga0307414_10198261 | Ga0307414_101982612 | 345 |
| 38 | 3300032126 | Ga0307415_100076389 | Ga0307415_1000763892 | 345 |
| 39 | 3300049661 | Ga0501217_008487 | Ga0501217_008487_937_2079 | 345 |
| 40 | 3300049663 | Ga0501223_000547 | Ga0501223_000547_3960_5102 | 345 |
| 41 | 3300049665 | Ga0501227_001707 | Ga0501227_001707_1940_3082 | 345 |
| 42 | 3300049669 | Ga0501235_000440 | Ga0501235_000440_6483_7625 | 345 |
| 43 | 3300049705 | Ga0501225_0012484 | Ga0501225_0012484_972_2114 | 345 |
| 44 | 3300005355 | Ga0070671_100067306 | Ga0070671_1000673063 | 347 |
| 45 | 3300009101 | Ga0105247_10000003 | Ga0105247_10000003572 | 347 |
| 46 | 3300025223 | Ga0207672_1000845 | Ga0207672_10008452 | 347 |
| 47 | 3300005327 | Ga0070658_10006221 | Ga0070658_100062214 | 348 |
| 48 | 3300025909 | Ga0207705_10013191 | Ga0207705_100131914 | 348 |
| 49 | 3300050515 | nmdc:mga0a205_20039_c1 | nmdc:mga0a205_20039_c1_3174_4271 | 348 |
| 50 | 3300005355 | Ga0070671_100026045 | Ga0070671_1000260453 | 349 |
| 51 | 3300005293 | Ga0065715_10146704 | Ga0065715_101467042 | 350 |
| 52 | 3300005337 | Ga0070682_100005983 | Ga0070682_1000059835 | 350 |
| 53 | 3300005345 | Ga0070692_10002071 | Ga0070692_100020712 | 350 |
| 54 | 3300005441 | Ga0070700_100102556 | Ga0070700_1001025562 | 350 |
| 55 | 3300005539 | Ga0068853_100037909 | Ga0068853_1000379092 | 350 |
| 56 | 3300005545 | Ga0070695_100136181 | Ga0070695_1001361811 | 350 |
| 57 | 3300005842 | Ga0068858_100151357 | Ga0068858_1001513572 | 350 |
| 58 | 3300005843 | Ga0068860_100015817 | Ga0068860_1000158173 | 350 |
| 59 | 3300005985 | Ga0081539_10009246 | Ga0081539_100092462 | 350 |
| 60 | 3300006237 | Ga0097621_100002182 | Ga0097621_10000218212 | 350 |
| 61 | 3300006358 | Ga0068871_100033511 | Ga0068871_1000335115 | 350 |
| 62 | 3300009551 | Ga0105238_10005288 | Ga0105238_100052887 | 350 |
| 63 | 3300013297 | Ga0157378_10029599 | Ga0157378_100295993 | 350 |
| 64 | 3300013306 | Ga0163162_10025749 | Ga0163162_100257494 | 350 |
| 65 | 3300025924 | Ga0207694_10036361 | Ga0207694_100363614 | 350 |
| 66 | 3300026035 | Ga0207703_10123949 | Ga0207703_101239492 | 350 |
| 67 | 3300026041 | Ga0207639_10188457 | Ga0207639_101884572 | 350 |
| 68 | 3300006852 | Ga0075433_10016436 | Ga0075433_100164362 | 351 |
| 69 | 3300006871 | Ga0075434_100023284 | Ga0075434_1000232845 | 351 |
| 70 | 3300009174 | Ga0105241_10035512 | Ga0105241_100355123 | 351 |
| 71 | 3300014325 | Ga0163163_10015359 | Ga0163163_100153595 | 351 |
| 72 | 3300005546 | Ga0070696_100045180 | Ga0070696_1000451802 | 354 |
| 73 | 3300005546 | Ga0070696_100078815 | Ga0070696_1000788151 | 354 |
| 74 | 3300025935 | Ga0207709_10050732 | Ga0207709_100507322 | 354 |
| 75 | 3300005330 | Ga0070690_100182374 | Ga0070690_1001823741 | 355 |
| 76 | 3300005347 | Ga0070668_100010938 | Ga0070668_1000109382 | 355 |
| 77 | 3300005544 | Ga0070686_100017121 | Ga0070686_1000171212 | 355 |
| 78 | 3300005545 | Ga0070695_100040288 | Ga0070695_1000402882 | 355 |
| 79 | 3300006852 | Ga0075433_10109171 | Ga0075433_101091712 | 355 |
| 80 | 3300009553 | Ga0105249_10000190 | Ga0105249_1000019049 | 355 |
| 81 | 3300013297 | Ga0157378_10050530 | Ga0157378_100505302 | 355 |
| 82 | 3300013306 | Ga0163162_10000039 | Ga0163162_1000003927 | 355 |
| 83 | 3300025961 | Ga0207712_10000201 | Ga0207712_1000020116 | 355 |
| 84 | 3300025972 | Ga0207668_10014015 | Ga0207668_100140155 | 355 |
| 85 | 3300050507 | nmdc:mga05p37_187768_c1 | nmdc:mga05p37_187768_c1_281_1408 | 355 |
| 86 | 3300050512 | nmdc:mga0n895_196727_c1 | nmdc:mga0n895_196727_c1_26_1153 | 355 |
| 87 | 3300025941 | Ga0207711_10008138 | Ga0207711_100081388 | 356 |
| 88 | 3300049574 | Ga0501038_0006008 | Ga0501038_0006008_2566_3696 | 356 |
| 89 | 3300006852 | Ga0075433_10013726 | Ga0075433_100137263 | 357 |
| 90 | 3300006871 | Ga0075434_100037843 | Ga0075434_1000378432 | 357 |
| 91 | 3300006931 | Ga0097620_100001775 | Ga0097620_1000017753 | 357 |
| 92 | 3300025912 | Ga0207707_10094759 | Ga0207707_100947592 | 357 |
| 93 | 3300025932 | Ga0207690_10082763 | Ga0207690_100827632 | 357 |
| 94 | 3300025941 | Ga0207711_10015998 | Ga0207711_100159984 | 357 |
| 95 | 3300026075 | Ga0207708_10000349 | Ga0207708_1000034914 | 357 |
| 96 | 3300026118 | Ga0207675_100004377 | Ga0207675_10000437711 | 357 |
| 97 | 3300038443 | Ga0395901_0427062 | Ga0395901_0427062_124_1263 | 357 |
| 98 | 3300049521 | Ga0501298_001516 | Ga0501298_001516_842_1972 | 357 |
| 99 | 3300049652 | Ga0501202_004073 | Ga0501202_004073_1354_2484 | 357 |
| 100 | 3300003203 | JGI25406J46586_10037787 | JGI25406J46586_100377872 | 358 |
| 101 | 3300005289 | Ga0065704_10130200 | Ga0065704_101302001 | 358 |
| 102 | 3300005441 | Ga0070700_100069089 | Ga0070700_1000690892 | 358 |
| 103 | 3300005458 | Ga0070681_10001279 | Ga0070681_1000127911 | 358 |
| 104 | 3300005530 | Ga0070679_100002107 | Ga0070679_1000021079 | 358 |
| 105 | 3300005545 | Ga0070695_100112095 | Ga0070695_1001120952 | 358 |
| 106 | 3300005985 | Ga0081539_10000898 | Ga0081539_1000089811 | 358 |
| 107 | 3300006846 | Ga0075430_100021160 | Ga0075430_1000211607 | 358 |
| 108 | 3300006852 | Ga0075433_10033918 | Ga0075433_100339183 | 358 |
| 109 | 3300009147 | Ga0114129_10127148 | Ga0114129_101271484 | 358 |
| 110 | 3300009176 | Ga0105242_10005491 | Ga0105242_100054915 | 358 |
| 111 | 3300009553 | Ga0105249_10352561 | Ga0105249_103525612 | 358 |
| 112 | 3300010375 | Ga0105239_10185907 | Ga0105239_101859072 | 358 |
| 113 | 3300013297 | Ga0157378_10000379 | Ga0157378_1000037911 | 358 |
| 114 | 3300013306 | Ga0163162_10475747 | Ga0163162_104757471 | 358 |
| 115 | 3300013307 | Ga0157372_10272958 | Ga0157372_102729582 | 358 |
| 116 | 3300013308 | Ga0157375_10006994 | Ga0157375_100069942 | 358 |
| 117 | 3300014325 | Ga0163163_10559636 | Ga0163163_105596361 | 358 |
| 118 | 3300025912 | Ga0207707_10000080 | Ga0207707_1000008082 | 358 |
| 119 | 3300025917 | Ga0207660_10064045 | Ga0207660_100640452 | 358 |
| 120 | 3300025921 | Ga0207652_10001974 | Ga0207652_100019746 | 358 |
| 121 | 3300025934 | Ga0207686_10001528 | Ga0207686_100015289 | 358 |
| 122 | 3300025935 | Ga0207709_10000899 | Ga0207709_1000089919 | 358 |
| 123 | 3300025961 | Ga0207712_10025508 | Ga0207712_100255083 | 358 |
| 124 | 3300026075 | Ga0207708_10074721 | Ga0207708_100747212 | 358 |
| 125 | 3300048909 | Ga0496106_0016249 | Ga0496106_0016249_3902_5032 | 358 |
| 126 | 3300050507 | nmdc:mga05p37_482598_c1 | nmdc:mga05p37_482598_c1_162_1298 | 358 |
| 127 | 3300050508 | nmdc:mga09592_19792_c1 | nmdc:mga09592_19792_c1_1545_2681 | 358 |
| 128 | 3300050512 | nmdc:mga0n895_173496_c1 | nmdc:mga0n895_173496_c1_1012_2151 | 358 |
| 129 | 3300050514 | nmdc:mga08x19_14079_c1 | nmdc:mga08x19_14079_c1_1980_3128 | 358 |
| 130 | 3300003203 | JGI25406J46586_10002732 | JGI25406J46586_1000273210 | 359 |
| 131 | 3300005293 | Ga0065715_10121951 | Ga0065715_101219511 | 359 |
| 132 | 3300005328 | Ga0070676_10106839 | Ga0070676_101068392 | 359 |
| 133 | 3300005330 | Ga0070690_100011540 | Ga0070690_1000115402 | 359 |
| 134 | 3300005331 | Ga0070670_100000071 | Ga0070670_1000000719 | 359 |
| 135 | 3300005340 | Ga0070689_100337530 | Ga0070689_1003375301 | 359 |
| 136 | 3300005343 | Ga0070687_100028528 | Ga0070687_1000285282 | 359 |
| 137 | 3300005438 | Ga0070701_10048112 | Ga0070701_100481122 | 359 |
| 138 | 3300005441 | Ga0070700_100095598 | Ga0070700_1000955982 | 359 |
| 139 | 3300005444 | Ga0070694_100058682 | Ga0070694_1000586821 | 359 |
| 140 | 3300005458 | Ga0070681_10097375 | Ga0070681_100973752 | 359 |
| 141 | 3300005467 | Ga0070706_100027995 | Ga0070706_1000279952 | 359 |
| 142 | 3300005544 | Ga0070686_100001507 | Ga0070686_1000015074 | 359 |
| 143 | 3300005547 | Ga0070693_100015350 | Ga0070693_1000153501 | 359 |
| 144 | 3300005547 | Ga0070693_100097829 | Ga0070693_1000978292 | 359 |
| 145 | 3300005617 | Ga0068859_100312016 | Ga0068859_1003120161 | 359 |
| 146 | 3300005618 | Ga0068864_100031327 | Ga0068864_1000313272 | 359 |
| 147 | 3300005719 | Ga0068861_100001062 | Ga0068861_10000106214 | 359 |
| 148 | 3300005719 | Ga0068861_100301474 | Ga0068861_1003014741 | 359 |
| 149 | 3300005842 | Ga0068858_100262951 | Ga0068858_1002629512 | 359 |
| 150 | 3300005843 | Ga0068860_100298313 | Ga0068860_1002983132 | 359 |
| 151 | 3300005844 | Ga0068862_100103292 | Ga0068862_1001032922 | 359 |
| 152 | 3300005985 | Ga0081539_10000875 | Ga0081539_1000087512 | 359 |
| 153 | 3300006237 | Ga0097621_100239784 | Ga0097621_1002397841 | 359 |
| 154 | 3300006852 | Ga0075433_10149678 | Ga0075433_101496783 | 359 |
| 155 | 3300006931 | Ga0097620_100312011 | Ga0097620_1003120111 | 359 |
| 156 | 3300009094 | Ga0111539_10141875 | Ga0111539_101418752 | 359 |
| 157 | 3300009101 | Ga0105247_10000796 | Ga0105247_100007966 | 359 |
| 158 | 3300009101 | Ga0105247_10075375 | Ga0105247_100753752 | 359 |
| 159 | 3300009147 | Ga0114129_10013748 | Ga0114129_100137484 | 359 |
| 160 | 3300009147 | Ga0114129_10120226 | Ga0114129_101202262 | 359 |
| 161 | 3300009174 | Ga0105241_10010016 | Ga0105241_100100164 | 359 |
| 162 | 3300009174 | Ga0105241_10052710 | Ga0105241_100527103 | 359 |
| 163 | 3300009551 | Ga0105238_10016593 | Ga0105238_100165936 | 359 |
| 164 | 3300009553 | Ga0105249_10018628 | Ga0105249_100186282 | 359 |
| 165 | 3300009553 | Ga0105249_10024996 | Ga0105249_100249964 | 359 |
| 166 | 3300011119 | Ga0105246_10016942 | Ga0105246_100169421 | 359 |
| 167 | 3300013306 | Ga0163162_10036014 | Ga0163162_100360146 | 359 |
| 168 | 3300013306 | Ga0163162_10058214 | Ga0163162_100582142 | 359 |
| 169 | 3300013306 | Ga0163162_10246423 | Ga0163162_102464231 | 359 |
| 170 | 3300014325 | Ga0163163_10000188 | Ga0163163_100001889 | 359 |
| 171 | 3300025900 | Ga0207710_10000602 | Ga0207710_1000060214 | 359 |
| 172 | 3300025918 | Ga0207662_10031407 | Ga0207662_100314073 | 359 |
| 173 | 3300025922 | Ga0207646_10008928 | Ga0207646_100089282 | 359 |
| 174 | 3300025923 | Ga0207681_10022570 | Ga0207681_100225702 | 359 |
| 175 | 3300025924 | Ga0207694_10001759 | Ga0207694_100017597 | 359 |
| 176 | 3300025925 | Ga0207650_10000006 | Ga0207650_10000006296 | 359 |
| 177 | 3300025938 | Ga0207704_10068311 | Ga0207704_100683112 | 359 |
| 178 | 3300025941 | Ga0207711_10071984 | Ga0207711_100719843 | 359 |
| 179 | 3300025960 | Ga0207651_10029074 | Ga0207651_100290742 | 359 |
| 180 | 3300025961 | Ga0207712_10000530 | Ga0207712_100005304 | 359 |
| 181 | 3300026035 | Ga0207703_10157841 | Ga0207703_101578413 | 359 |
| 182 | 3300026075 | Ga0207708_10014186 | Ga0207708_100141864 | 359 |
| 183 | 3300026089 | Ga0207648_10308714 | Ga0207648_103087141 | 359 |
| 184 | 3300026095 | Ga0207676_10110436 | Ga0207676_101104362 | 359 |
| 185 | 3300026116 | Ga0207674_10090995 | Ga0207674_100909952 | 359 |
| 186 | 3300026116 | Ga0207674_10231045 | Ga0207674_102310452 | 359 |
| 187 | 3300026118 | Ga0207675_100035973 | Ga0207675_1000359731 | 359 |
| 188 | 3300026142 | Ga0207698_10289815 | Ga0207698_102898151 | 359 |
| 189 | 3300027907 | Ga0207428_10239235 | Ga0207428_102392351 | 359 |
| 190 | 3300028380 | Ga0268265_10197685 | Ga0268265_101976851 | 359 |
| 191 | 3300032002 | Ga0307416_100397710 | Ga0307416_1003977101 | 359 |
| 192 | 3300035091 | Ga0373951_0000933 | Ga0373951_0000933_2517_3656 | 359 |
| 193 | 3300048916 | Ga0496113_0090870 | Ga0496113_0090870_551_1690 | 359 |
| 194 | 3300050507 | nmdc:mga05p37_353921_c1 | nmdc:mga05p37_353921_c1_323_1477 | 359 |
| 195 | 3300050515 | nmdc:mga0a205_215746_c1 | nmdc:mga0a205_215746_c1_563_1705 | 359 |
| 196 | 3300002074 | JGI24748J21848_1000011 | JGI24748J21848_1000011124 | 361 |
| 197 | 3300002239 | JGI24034J26672_10000023 | JGI24034J26672_1000002396 | 361 |
| 198 | 3300005841 | Ga0068863_100326635 | Ga0068863_1003266352 | 361 |
| 199 | 3300005842 | Ga0068858_100000253 | Ga0068858_10000025320 | 361 |
| 200 | 3300025900 | Ga0207710_10000001 | Ga0207710_10000001738 | 361 |
| 201 | 3300025931 | Ga0207644_10000356 | Ga0207644_1000035617 | 361 |
| 202 | 3300026035 | Ga0207703_10000055 | Ga0207703_1000005519 | 361 |
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6npz-assembly2.cif.gz_B | crystal structure of akt1 (aa 123-480) kinase with a bisubstrate | 0.5073 | 78 | 255 |
| 4yzc-assembly2.cif.gz_B | crystal structure of pire1alpha in complex with staurosporine | 0.5062 | 73 | 256 |
| 3akl-assembly1.cif.gz_B | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.5031 | 71 | 356 |
| 3akk-assembly2.cif.gz_C | crystal structure of a helicobacter pylori proinflammatory kinase ctka | 0.497 | 63 | 356 |
| 6aak-assembly1.cif.gz_B | crystal structure of jak3 in complex with peficitinib | 0.4956 | 66 | 255 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6JZC0_31_105_2.30.30.140 | Mainly Beta;Roll;SH3 type barrels.; | 0.697 | 69 | 106 | 2.30.30.140 |
| af_Q90ZY4_22_371_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.5197 | 66 | 255 | 1.10.510.10 |
| af_K7VFV1_30_374_1.10.510.10 | Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 | 0.4947 | 72 | 255 | 1.10.510.10 |
| 3uo2A02 | Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain | 0.481 | 301 | 361 | 1.20.1280.20 |
| af_I1J666_165_416_1.10.1070.11 | Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain | 0.464 | 94 | 359 | 1.10.1070.11 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A352EZ08-F1-model_v4 | Uncharacterized protein | 0.9454 | 29 | 361 |
|
| AF-A0A352EZ08-F1-model_v4 | Uncharacterized protein | 0.8723 | 29 | 361 |
|
| AF-A0A7V9ZPT2-F1-model_v4 | Uncharacterized protein | 0.8169 | 182 | 361 |
|
| AF-A0A7V9ZPT2-F1-model_v4 | Uncharacterized protein | 0.8007 | 182 | 361 |
|
| AF-A0A2V8HAP8-F1-model_v4 | Uncharacterized protein | 0.7817 | 67 | 361 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar