F309569

General Info

Members Datasets Scaffolds Average Seq Length
202 120 202 370

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100001507|Ga0070686_1000015074
Length 423
Sequence MKDETATSFLILHPSSFILRRGGSAFVCYLFPENTSSTSKGIWKMSRKLHHVVIAPVIVLFIVFLVTPQTIAQQACFSAAERERVEKTAKVWRTPDPGYDPVLXXXXANGPRKGAPPVDDSGLAKPINCVANKDESPGSGTTPKFHCSVPGNTDNDGNLIRYKVKPHFKGQSPDKRNGEIYGEFLSSRFSKALGFFADDEWVADVNCPDCEKSLTSKFQGAPWSPSQPAAGIEMSLARGVDVNCNGKDSGSLSGSLEKLAANGAPRAEIDAFKLWLAFIDHGDTKTDNHKFACLDSKKDGNNRVCKPGEAVFYVSDMGSTFGFSASSEKKAKLETWKKKDPIKVSGGSCQANAKSVGDTNISEAGRQLLATQLQTLLDAEKSNGTITKVFRASRNAERDQPAEQWTAEFIRKARMIIDARCSK

Samples

Sample ID Description Type Environment
1 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
39 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
50 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
100 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
103 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
104 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
107 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
108 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
109 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
110 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
111 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
112 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
113 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
114 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
115 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
116 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
119 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
120 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.99
Rhizosphere 99.01
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24748J21848_1000011 3300002074 Bacteria 157004
2 JGI24034J26672_10000023 3300002239 Bacteria 115999
3 JGI25406J46586_10002732 3300003203 Bacteria 8314
4 JGI25406J46586_10037787 3300003203 Bacteria 1737
5 Ga0065704_10130200 3300005289 Bacteria 1632
6 Ga0065715_10006425 3300005293 Bacteria 4644
7 Ga0065715_10121951 3300005293 Bacteria 2217
8 Ga0065715_10146704 3300005293 Unclassified 1780
9 Ga0070658_10006221 3300005327 Bacteria 9672
10 Ga0070676_10106839 3300005328 Unclassified 1737
11 Ga0070690_100011540 3300005330 Bacteria 5170
12 Ga0070690_100182374 3300005330 Unclassified 1451
13 Ga0070670_100000071 3300005331 Bacteria 102454
14 Ga0070670_100069752 3300005331 Bacteria 3018
15 Ga0070682_100005983 3300005337 Bacteria 6809
16 Ga0070689_100337530 3300005340 Bacteria 1262
17 Ga0070687_100028528 3300005343 Bacteria 2708
18 Ga0070692_10002071 3300005345 Bacteria 7643
19 Ga0070668_100010938 3300005347 Bacteria 6751
20 Ga0070671_100026045 3300005355 Bacteria 4804
21 Ga0070671_100067306 3300005355 Unclassified 2986
22 Ga0070701_10048112 3300005438 Bacteria 2199
23 Ga0070705_100155028 3300005440 Bacteria 1524
24 Ga0070700_100069089 3300005441 Bacteria 2248
25 Ga0070700_100095598 3300005441 Bacteria 1948
26 Ga0070700_100102556 3300005441 Unclassified 1887
27 Ga0070694_100058682 3300005444 Bacteria 2619
28 Ga0070681_10001279 3300005458 Bacteria 21955
29 Ga0070681_10002615 3300005458 Bacteria 16525
30 Ga0070681_10097375 3300005458 Bacteria 2889
31 Ga0070706_100027995 3300005467 Bacteria 5184
32 Ga0070679_100002107 3300005530 Bacteria 17921
33 Ga0068853_100037909 3300005539 Unclassified 4104
34 Ga0070686_100001507 3300005544 Bacteria 13100
35 Ga0070686_100017121 3300005544 Bacteria 4230
36 Ga0070695_100013874 3300005545 Bacteria 4849
37 Ga0070695_100037710 3300005545 Unclassified 3047
38 Ga0070695_100040288 3300005545 Bacteria 2957
39 Ga0070695_100112095 3300005545 Unclassified 1853
40 Ga0070695_100136181 3300005545 Bacteria 1698
41 Ga0070696_100018024 3300005546 Bacteria 4769
42 Ga0070696_100045180 3300005546 Unclassified 3052
43 Ga0070696_100068770 3300005546 Bacteria 2487
44 Ga0070696_100078815 3300005546 Unclassified 2330
45 Ga0070693_100015350 3300005547 Bacteria 3942
46 Ga0070693_100097829 3300005547 Bacteria 1782
47 Ga0068859_100079882 3300005617 Bacteria 3311
48 Ga0068859_100312016 3300005617 Bacteria 1666
49 Ga0068864_100031327 3300005618 Bacteria 4512
50 Ga0068861_100001062 3300005719 Bacteria 16903
51 Ga0068861_100301474 3300005719 Bacteria 1388
52 Ga0068863_100326635 3300005841 Unclassified 1491
53 Ga0068858_100000253 3300005842 Bacteria 57137
54 Ga0068858_100151357 3300005842 Bacteria 2182
55 Ga0068858_100262951 3300005842 Bacteria 1640
56 Ga0068860_100015817 3300005843 Bacteria 7367
57 Ga0068860_100298313 3300005843 Bacteria 1578
58 Ga0068862_100103292 3300005844 Bacteria 2496
59 Ga0081539_10000875 3300005985 Bacteria 57733
60 Ga0081539_10000898 3300005985 Bacteria 56680
61 Ga0081539_10009246 3300005985 Bacteria 8291
62 Ga0097621_100002182 3300006237 Bacteria 13392
63 Ga0097621_100239784 3300006237 Bacteria 1585
64 Ga0068871_100033511 3300006358 Unclassified 4068
65 Ga0068871_100094212 3300006358 Bacteria 2500
66 Ga0075430_100021160 3300006846 Bacteria 5530
67 Ga0075431_100407420 3300006847 Unclassified 1360
68 Ga0075433_10013726 3300006852 Bacteria 6599
69 Ga0075433_10016436 3300006852 Bacteria 6100
70 Ga0075433_10033918 3300006852 Bacteria 4380
71 Ga0075433_10109171 3300006852 Bacteria 2454
72 Ga0075433_10149678 3300006852 Unclassified 2076
73 Ga0075434_100023284 3300006871 Bacteria 6033
74 Ga0075434_100037843 3300006871 Bacteria 4776
75 Ga0097620_100001775 3300006931 Bacteria 21958
76 Ga0097620_100079882 3300006931 Bacteria 3311
77 Ga0097620_100312011 3300006931 Bacteria 1666
78 Ga0111539_10141875 3300009094 Bacteria 2812
79 Ga0105247_10000003 3300009101 Bacteria 694517
80 Ga0105247_10000796 3300009101 Bacteria 24171
81 Ga0105247_10075375 3300009101 Bacteria 2117
82 Ga0114129_10003333 3300009147 Bacteria 22577
83 Ga0114129_10013748 3300009147 Bacteria 11539
84 Ga0114129_10060331 3300009147 Bacteria 5303
85 Ga0114129_10120226 3300009147 Bacteria 3617
86 Ga0114129_10127148 3300009147 Bacteria 3504
87 Ga0105243_10000436 3300009148 Bacteria 43715
88 Ga0105241_10010016 3300009174 Bacteria 6960
89 Ga0105241_10035512 3300009174 Bacteria 3749
90 Ga0105241_10052710 3300009174 Bacteria 3108
91 Ga0105241_10130777 3300009174 Bacteria 2032
92 Ga0105242_10005491 3300009176 Bacteria 9788
93 Ga0105242_10007815 3300009176 Bacteria 8231
94 Ga0105248_10002839 3300009177 Bacteria 19218
95 Ga0105237_10038445 3300009545 Bacteria 4831
96 Ga0105238_10005288 3300009551 Bacteria 12762
97 Ga0105238_10016593 3300009551 Bacteria 7456
98 Ga0105249_10000190 3300009553 Bacteria 70486
99 Ga0105249_10018628 3300009553 Bacteria 6183
100 Ga0105249_10024996 3300009553 Bacteria 5374
101 Ga0105249_10352561 3300009553 Bacteria 1491
102 Ga0105239_10185907 3300010375 Bacteria 2325
103 Ga0105239_10336311 3300010375 Bacteria 1704
104 Ga0105246_10016942 3300011119 Bacteria 4625
105 Ga0157374_10157301 3300013296 Bacteria 2212
106 Ga0157378_10000379 3300013297 Bacteria 43998
107 Ga0157378_10029599 3300013297 Bacteria 4836
108 Ga0157378_10050530 3300013297 Bacteria 3700
109 Ga0163162_10000039 3300013306 Bacteria 137338
110 Ga0163162_10025749 3300013306 Bacteria 5816
111 Ga0163162_10036014 3300013306 Bacteria 4930
112 Ga0163162_10058214 3300013306 Bacteria 3893
113 Ga0163162_10246423 3300013306 Bacteria 1918
114 Ga0163162_10475747 3300013306 Unclassified 1380
115 Ga0157372_10272958 3300013307 Bacteria 1965
116 Ga0157375_10006994 3300013308 Bacteria 9852
117 Ga0157375_10099315 3300013308 Bacteria 2990
118 Ga0163163_10000188 3300014325 Bacteria 63392
119 Ga0163163_10015359 3300014325 Bacteria 7076
120 Ga0163163_10081805 3300014325 Bacteria 3232
121 Ga0163163_10559636 3300014325 Bacteria 1206
122 Ga0207672_1000845 3300025223 Bacteria 3186
123 Ga0207710_10000001 3300025900 Bacteria 1797433
124 Ga0207710_10000602 3300025900 Bacteria 21021
125 Ga0207705_10013191 3300025909 Bacteria 5965
126 Ga0207707_10000080 3300025912 Bacteria 96693
127 Ga0207707_10094759 3300025912 Bacteria 2609
128 Ga0207660_10064045 3300025917 Bacteria 2652
129 Ga0207662_10031407 3300025918 Bacteria 3085
130 Ga0207652_10001974 3300025921 Bacteria 17736
131 Ga0207646_10008928 3300025922 Bacteria 9982
132 Ga0207681_10022570 3300025923 Bacteria 4015
133 Ga0207694_10001759 3300025924 Bacteria 18159
134 Ga0207694_10036361 3300025924 Bacteria 3780
135 Ga0207650_10000006 3300025925 Bacteria 544730
136 Ga0207644_10000356 3300025931 Bacteria 29717
137 Ga0207690_10082763 3300025932 Unclassified 2245
138 Ga0207686_10001528 3300025934 Bacteria 13044
139 Ga0207709_10000899 3300025935 Bacteria 22461
140 Ga0207709_10050732 3300025935 Unclassified 2539
141 Ga0207704_10068311 3300025938 Bacteria 2240
142 Ga0207711_10008138 3300025941 Bacteria 8776
143 Ga0207711_10015998 3300025941 Bacteria 6224
144 Ga0207711_10071984 3300025941 Unclassified 3001
145 Ga0207689_10013292 3300025942 Bacteria 7022
146 Ga0207651_10029074 3300025960 Bacteria 3497
147 Ga0207712_10000201 3300025961 Bacteria 60068
148 Ga0207712_10000530 3300025961 Bacteria 31311
149 Ga0207712_10025508 3300025961 Bacteria 3928
150 Ga0207668_10014015 3300025972 Bacteria 4955
151 Ga0207703_10000055 3300026035 Bacteria 143420
152 Ga0207703_10123949 3300026035 Bacteria 2222
153 Ga0207703_10157841 3300026035 Bacteria 1984
154 Ga0207639_10188457 3300026041 Bacteria 1760
155 Ga0207708_10000349 3300026075 Bacteria 36214
156 Ga0207708_10014186 3300026075 Bacteria 5958
157 Ga0207708_10074721 3300026075 Bacteria 2598
158 Ga0207641_10146180 3300026088 Bacteria 2138
159 Ga0207648_10065279 3300026089 Unclassified 3173
160 Ga0207648_10082833 3300026089 Bacteria 2798
161 Ga0207648_10308714 3300026089 Bacteria 1420
162 Ga0207676_10110436 3300026095 Bacteria 2300
163 Ga0207674_10090995 3300026116 Bacteria 3042
164 Ga0207674_10231045 3300026116 Bacteria 1797
165 Ga0207675_100004377 3300026118 Bacteria 13653
166 Ga0207675_100035973 3300026118 Bacteria 4618
167 Ga0207698_10289815 3300026142 Bacteria 1518
168 Ga0207428_10239235 3300027907 Bacteria 1357
169 Ga0268265_10197685 3300028380 Bacteria 1741
170 Ga0307405_10039701 3300031731 Bacteria 2847
171 Ga0307413_10106238 3300031824 Bacteria 1868
172 Ga0307412_10068634 3300031911 Bacteria 2411
173 Ga0307416_100397710 3300032002 Bacteria 1414
174 Ga0307414_10198261 3300032004 Bacteria 1630
175 Ga0307415_100076389 3300032126 Bacteria 2374
176 Ga0373951_0000933 3300035091 Bacteria 7866
177 Ga0373942_0008576 3300035207 Unclassified 2385
178 Ga0395901_0427062 3300038443 Unclassified 1358
179 Ga0242420_006628 3300038996 Bacteria 1834
180 Ga0495663_0000122 3300046525 Bacteria 32201
181 Ga0496106_0016249 3300048909 Bacteria 5506
182 Ga0496113_0090870 3300048916 Bacteria 2353
183 Ga0501298_001516 3300049521 Bacteria 3421
184 Ga0501038_0006008 3300049574 Bacteria 11233
185 Ga0501202_004073 3300049652 Bacteria 2543
186 Ga0501217_008487 3300049661 Bacteria 2220
187 Ga0501223_000547 3300049663 Bacteria 9060
188 Ga0501227_001707 3300049665 Bacteria 4872
189 Ga0501233_003139 3300049668 Bacteria 2959
190 Ga0501235_000440 3300049669 Bacteria 8077
191 Ga0501225_0012484 3300049705 Bacteria 2386
192 nmdc:mga05p37_187768_c1 3300050507 Bacteria 2512
193 nmdc:mga05p37_353921_c1 3300050507 Unclassified 1728
194 nmdc:mga05p37_482598_c1 3300050507 Bacteria 1427
195 nmdc:mga09592_19792_c1 3300050508 Bacteria 5529
196 nmdc:mga06r32_397770_c1 3300050510 Unclassified 1360
197 nmdc:mga0n895_173496_c1 3300050512 Bacteria 2188
198 nmdc:mga0n895_196727_c1 3300050512 Unclassified 2047
199 nmdc:mga08x19_14079_c1 3300050514 Bacteria 4847
200 nmdc:mga0a205_15301_c1 3300050515 Bacteria 7168
201 nmdc:mga0a205_20039_c1 3300050515 Bacteria 6310
202 nmdc:mga0a205_215746_c1 3300050515 Unclassified 1806

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10081805 Ga0163163_100818052 333
2 3300005293 Ga0065715_10006425 Ga0065715_100064252 336
3 3300005440 Ga0070705_100155028 Ga0070705_1001550282 336
4 3300005545 Ga0070695_100037710 Ga0070695_1000377102 336
5 3300005546 Ga0070696_100068770 Ga0070696_1000687702 336
6 3300009545 Ga0105237_10038445 Ga0105237_100384454 336
7 3300049668 Ga0501233_003139 Ga0501233_003139_1826_2935 336
8 3300046525 Ga0495663_0000122 Ga0495663_0000122_9795_10916 337
9 3300009148 Ga0105243_10000436 Ga0105243_1000043622 338
10 3300005458 Ga0070681_10002615 Ga0070681_100026155 340
11 3300006358 Ga0068871_100094212 Ga0068871_1000942122 340
12 3300009174 Ga0105241_10130777 Ga0105241_101307771 341
13 3300026089 Ga0207648_10082833 Ga0207648_100828332 341
14 3300005545 Ga0070695_100013874 Ga0070695_1000138745 342
15 3300005546 Ga0070696_100018024 Ga0070696_1000180242 342
16 3300005617 Ga0068859_100079882 Ga0068859_1000798822 342
17 3300006931 Ga0097620_100079882 Ga0097620_1000798822 342
18 3300009177 Ga0105248_10002839 Ga0105248_1000283912 342
19 3300026088 Ga0207641_10146180 Ga0207641_101461802 342
20 3300050515 nmdc:mga0a205_15301_c1 nmdc:mga0a205_15301_c1_5397_6536 342
21 3300010375 Ga0105239_10336311 Ga0105239_103363112 343
22 3300038996 Ga0242420_006628 Ga0242420_006628_621_1787 343
23 3300005331 Ga0070670_100069752 Ga0070670_1000697524 344
24 3300006847 Ga0075431_100407420 Ga0075431_1004074202 344
25 3300009147 Ga0114129_10003333 Ga0114129_100033333 344
26 3300009147 Ga0114129_10060331 Ga0114129_100603313 344
27 3300013296 Ga0157374_10157301 Ga0157374_101573013 344
28 3300013308 Ga0157375_10099315 Ga0157375_100993152 344
29 3300025942 Ga0207689_10013292 Ga0207689_100132922 344
30 3300035207 Ga0373942_0008576 Ga0373942_0008576_907_1992 344
31 3300050510 nmdc:mga06r32_397770_c1 nmdc:mga06r32_397770_c1_55_1197 344
32 3300009176 Ga0105242_10007815 Ga0105242_100078152 345
33 3300026089 Ga0207648_10065279 Ga0207648_100652792 345
34 3300031731 Ga0307405_10039701 Ga0307405_100397012 345
35 3300031824 Ga0307413_10106238 Ga0307413_101062382 345
36 3300031911 Ga0307412_10068634 Ga0307412_100686342 345
37 3300032004 Ga0307414_10198261 Ga0307414_101982612 345
38 3300032126 Ga0307415_100076389 Ga0307415_1000763892 345
39 3300049661 Ga0501217_008487 Ga0501217_008487_937_2079 345
40 3300049663 Ga0501223_000547 Ga0501223_000547_3960_5102 345
41 3300049665 Ga0501227_001707 Ga0501227_001707_1940_3082 345
42 3300049669 Ga0501235_000440 Ga0501235_000440_6483_7625 345
43 3300049705 Ga0501225_0012484 Ga0501225_0012484_972_2114 345
44 3300005355 Ga0070671_100067306 Ga0070671_1000673063 347
45 3300009101 Ga0105247_10000003 Ga0105247_10000003572 347
46 3300025223 Ga0207672_1000845 Ga0207672_10008452 347
47 3300005327 Ga0070658_10006221 Ga0070658_100062214 348
48 3300025909 Ga0207705_10013191 Ga0207705_100131914 348
49 3300050515 nmdc:mga0a205_20039_c1 nmdc:mga0a205_20039_c1_3174_4271 348
50 3300005355 Ga0070671_100026045 Ga0070671_1000260453 349
51 3300005293 Ga0065715_10146704 Ga0065715_101467042 350
52 3300005337 Ga0070682_100005983 Ga0070682_1000059835 350
53 3300005345 Ga0070692_10002071 Ga0070692_100020712 350
54 3300005441 Ga0070700_100102556 Ga0070700_1001025562 350
55 3300005539 Ga0068853_100037909 Ga0068853_1000379092 350
56 3300005545 Ga0070695_100136181 Ga0070695_1001361811 350
57 3300005842 Ga0068858_100151357 Ga0068858_1001513572 350
58 3300005843 Ga0068860_100015817 Ga0068860_1000158173 350
59 3300005985 Ga0081539_10009246 Ga0081539_100092462 350
60 3300006237 Ga0097621_100002182 Ga0097621_10000218212 350
61 3300006358 Ga0068871_100033511 Ga0068871_1000335115 350
62 3300009551 Ga0105238_10005288 Ga0105238_100052887 350
63 3300013297 Ga0157378_10029599 Ga0157378_100295993 350
64 3300013306 Ga0163162_10025749 Ga0163162_100257494 350
65 3300025924 Ga0207694_10036361 Ga0207694_100363614 350
66 3300026035 Ga0207703_10123949 Ga0207703_101239492 350
67 3300026041 Ga0207639_10188457 Ga0207639_101884572 350
68 3300006852 Ga0075433_10016436 Ga0075433_100164362 351
69 3300006871 Ga0075434_100023284 Ga0075434_1000232845 351
70 3300009174 Ga0105241_10035512 Ga0105241_100355123 351
71 3300014325 Ga0163163_10015359 Ga0163163_100153595 351
72 3300005546 Ga0070696_100045180 Ga0070696_1000451802 354
73 3300005546 Ga0070696_100078815 Ga0070696_1000788151 354
74 3300025935 Ga0207709_10050732 Ga0207709_100507322 354
75 3300005330 Ga0070690_100182374 Ga0070690_1001823741 355
76 3300005347 Ga0070668_100010938 Ga0070668_1000109382 355
77 3300005544 Ga0070686_100017121 Ga0070686_1000171212 355
78 3300005545 Ga0070695_100040288 Ga0070695_1000402882 355
79 3300006852 Ga0075433_10109171 Ga0075433_101091712 355
80 3300009553 Ga0105249_10000190 Ga0105249_1000019049 355
81 3300013297 Ga0157378_10050530 Ga0157378_100505302 355
82 3300013306 Ga0163162_10000039 Ga0163162_1000003927 355
83 3300025961 Ga0207712_10000201 Ga0207712_1000020116 355
84 3300025972 Ga0207668_10014015 Ga0207668_100140155 355
85 3300050507 nmdc:mga05p37_187768_c1 nmdc:mga05p37_187768_c1_281_1408 355
86 3300050512 nmdc:mga0n895_196727_c1 nmdc:mga0n895_196727_c1_26_1153 355
87 3300025941 Ga0207711_10008138 Ga0207711_100081388 356
88 3300049574 Ga0501038_0006008 Ga0501038_0006008_2566_3696 356
89 3300006852 Ga0075433_10013726 Ga0075433_100137263 357
90 3300006871 Ga0075434_100037843 Ga0075434_1000378432 357
91 3300006931 Ga0097620_100001775 Ga0097620_1000017753 357
92 3300025912 Ga0207707_10094759 Ga0207707_100947592 357
93 3300025932 Ga0207690_10082763 Ga0207690_100827632 357
94 3300025941 Ga0207711_10015998 Ga0207711_100159984 357
95 3300026075 Ga0207708_10000349 Ga0207708_1000034914 357
96 3300026118 Ga0207675_100004377 Ga0207675_10000437711 357
97 3300038443 Ga0395901_0427062 Ga0395901_0427062_124_1263 357
98 3300049521 Ga0501298_001516 Ga0501298_001516_842_1972 357
99 3300049652 Ga0501202_004073 Ga0501202_004073_1354_2484 357
100 3300003203 JGI25406J46586_10037787 JGI25406J46586_100377872 358
101 3300005289 Ga0065704_10130200 Ga0065704_101302001 358
102 3300005441 Ga0070700_100069089 Ga0070700_1000690892 358
103 3300005458 Ga0070681_10001279 Ga0070681_1000127911 358
104 3300005530 Ga0070679_100002107 Ga0070679_1000021079 358
105 3300005545 Ga0070695_100112095 Ga0070695_1001120952 358
106 3300005985 Ga0081539_10000898 Ga0081539_1000089811 358
107 3300006846 Ga0075430_100021160 Ga0075430_1000211607 358
108 3300006852 Ga0075433_10033918 Ga0075433_100339183 358
109 3300009147 Ga0114129_10127148 Ga0114129_101271484 358
110 3300009176 Ga0105242_10005491 Ga0105242_100054915 358
111 3300009553 Ga0105249_10352561 Ga0105249_103525612 358
112 3300010375 Ga0105239_10185907 Ga0105239_101859072 358
113 3300013297 Ga0157378_10000379 Ga0157378_1000037911 358
114 3300013306 Ga0163162_10475747 Ga0163162_104757471 358
115 3300013307 Ga0157372_10272958 Ga0157372_102729582 358
116 3300013308 Ga0157375_10006994 Ga0157375_100069942 358
117 3300014325 Ga0163163_10559636 Ga0163163_105596361 358
118 3300025912 Ga0207707_10000080 Ga0207707_1000008082 358
119 3300025917 Ga0207660_10064045 Ga0207660_100640452 358
120 3300025921 Ga0207652_10001974 Ga0207652_100019746 358
121 3300025934 Ga0207686_10001528 Ga0207686_100015289 358
122 3300025935 Ga0207709_10000899 Ga0207709_1000089919 358
123 3300025961 Ga0207712_10025508 Ga0207712_100255083 358
124 3300026075 Ga0207708_10074721 Ga0207708_100747212 358
125 3300048909 Ga0496106_0016249 Ga0496106_0016249_3902_5032 358
126 3300050507 nmdc:mga05p37_482598_c1 nmdc:mga05p37_482598_c1_162_1298 358
127 3300050508 nmdc:mga09592_19792_c1 nmdc:mga09592_19792_c1_1545_2681 358
128 3300050512 nmdc:mga0n895_173496_c1 nmdc:mga0n895_173496_c1_1012_2151 358
129 3300050514 nmdc:mga08x19_14079_c1 nmdc:mga08x19_14079_c1_1980_3128 358
130 3300003203 JGI25406J46586_10002732 JGI25406J46586_1000273210 359
131 3300005293 Ga0065715_10121951 Ga0065715_101219511 359
132 3300005328 Ga0070676_10106839 Ga0070676_101068392 359
133 3300005330 Ga0070690_100011540 Ga0070690_1000115402 359
134 3300005331 Ga0070670_100000071 Ga0070670_1000000719 359
135 3300005340 Ga0070689_100337530 Ga0070689_1003375301 359
136 3300005343 Ga0070687_100028528 Ga0070687_1000285282 359
137 3300005438 Ga0070701_10048112 Ga0070701_100481122 359
138 3300005441 Ga0070700_100095598 Ga0070700_1000955982 359
139 3300005444 Ga0070694_100058682 Ga0070694_1000586821 359
140 3300005458 Ga0070681_10097375 Ga0070681_100973752 359
141 3300005467 Ga0070706_100027995 Ga0070706_1000279952 359
142 3300005544 Ga0070686_100001507 Ga0070686_1000015074 359
143 3300005547 Ga0070693_100015350 Ga0070693_1000153501 359
144 3300005547 Ga0070693_100097829 Ga0070693_1000978292 359
145 3300005617 Ga0068859_100312016 Ga0068859_1003120161 359
146 3300005618 Ga0068864_100031327 Ga0068864_1000313272 359
147 3300005719 Ga0068861_100001062 Ga0068861_10000106214 359
148 3300005719 Ga0068861_100301474 Ga0068861_1003014741 359
149 3300005842 Ga0068858_100262951 Ga0068858_1002629512 359
150 3300005843 Ga0068860_100298313 Ga0068860_1002983132 359
151 3300005844 Ga0068862_100103292 Ga0068862_1001032922 359
152 3300005985 Ga0081539_10000875 Ga0081539_1000087512 359
153 3300006237 Ga0097621_100239784 Ga0097621_1002397841 359
154 3300006852 Ga0075433_10149678 Ga0075433_101496783 359
155 3300006931 Ga0097620_100312011 Ga0097620_1003120111 359
156 3300009094 Ga0111539_10141875 Ga0111539_101418752 359
157 3300009101 Ga0105247_10000796 Ga0105247_100007966 359
158 3300009101 Ga0105247_10075375 Ga0105247_100753752 359
159 3300009147 Ga0114129_10013748 Ga0114129_100137484 359
160 3300009147 Ga0114129_10120226 Ga0114129_101202262 359
161 3300009174 Ga0105241_10010016 Ga0105241_100100164 359
162 3300009174 Ga0105241_10052710 Ga0105241_100527103 359
163 3300009551 Ga0105238_10016593 Ga0105238_100165936 359
164 3300009553 Ga0105249_10018628 Ga0105249_100186282 359
165 3300009553 Ga0105249_10024996 Ga0105249_100249964 359
166 3300011119 Ga0105246_10016942 Ga0105246_100169421 359
167 3300013306 Ga0163162_10036014 Ga0163162_100360146 359
168 3300013306 Ga0163162_10058214 Ga0163162_100582142 359
169 3300013306 Ga0163162_10246423 Ga0163162_102464231 359
170 3300014325 Ga0163163_10000188 Ga0163163_100001889 359
171 3300025900 Ga0207710_10000602 Ga0207710_1000060214 359
172 3300025918 Ga0207662_10031407 Ga0207662_100314073 359
173 3300025922 Ga0207646_10008928 Ga0207646_100089282 359
174 3300025923 Ga0207681_10022570 Ga0207681_100225702 359
175 3300025924 Ga0207694_10001759 Ga0207694_100017597 359
176 3300025925 Ga0207650_10000006 Ga0207650_10000006296 359
177 3300025938 Ga0207704_10068311 Ga0207704_100683112 359
178 3300025941 Ga0207711_10071984 Ga0207711_100719843 359
179 3300025960 Ga0207651_10029074 Ga0207651_100290742 359
180 3300025961 Ga0207712_10000530 Ga0207712_100005304 359
181 3300026035 Ga0207703_10157841 Ga0207703_101578413 359
182 3300026075 Ga0207708_10014186 Ga0207708_100141864 359
183 3300026089 Ga0207648_10308714 Ga0207648_103087141 359
184 3300026095 Ga0207676_10110436 Ga0207676_101104362 359
185 3300026116 Ga0207674_10090995 Ga0207674_100909952 359
186 3300026116 Ga0207674_10231045 Ga0207674_102310452 359
187 3300026118 Ga0207675_100035973 Ga0207675_1000359731 359
188 3300026142 Ga0207698_10289815 Ga0207698_102898151 359
189 3300027907 Ga0207428_10239235 Ga0207428_102392351 359
190 3300028380 Ga0268265_10197685 Ga0268265_101976851 359
191 3300032002 Ga0307416_100397710 Ga0307416_1003977101 359
192 3300035091 Ga0373951_0000933 Ga0373951_0000933_2517_3656 359
193 3300048916 Ga0496113_0090870 Ga0496113_0090870_551_1690 359
194 3300050507 nmdc:mga05p37_353921_c1 nmdc:mga05p37_353921_c1_323_1477 359
195 3300050515 nmdc:mga0a205_215746_c1 nmdc:mga0a205_215746_c1_563_1705 359
196 3300002074 JGI24748J21848_1000011 JGI24748J21848_1000011124 361
197 3300002239 JGI24034J26672_10000023 JGI24034J26672_1000002396 361
198 3300005841 Ga0068863_100326635 Ga0068863_1003266352 361
199 3300005842 Ga0068858_100000253 Ga0068858_10000025320 361
200 3300025900 Ga0207710_10000001 Ga0207710_10000001738 361
201 3300025931 Ga0207644_10000356 Ga0207644_1000035617 361
202 3300026035 Ga0207703_10000055 Ga0207703_1000005519 361

Structural Annotation

Top 5 Hits

ID Description Score Start End
6npz-assembly2.cif.gz_B crystal structure of akt1 (aa 123-480) kinase with a bisubstrate 0.5073 78 255
4yzc-assembly2.cif.gz_B crystal structure of pire1alpha in complex with staurosporine 0.5062 73 256
3akl-assembly1.cif.gz_B crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.5031 71 356
3akk-assembly2.cif.gz_C crystal structure of a helicobacter pylori proinflammatory kinase ctka 0.497 63 356
6aak-assembly1.cif.gz_B crystal structure of jak3 in complex with peficitinib 0.4956 66 255
ID Description Score Start End Superfamily
af_A0A1D6JZC0_31_105_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.697 69 106 2.30.30.140
af_Q90ZY4_22_371_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.5197 66 255 1.10.510.10
af_K7VFV1_30_374_1.10.510.10 Mainly Alpha;Orthogonal Bundle;Transferase(Phosphotransferase); domain 1;Transferase(Phosphotransferase) domain 1 0.4947 72 255 1.10.510.10
3uo2A02 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.481 301 361 1.20.1280.20
af_I1J666_165_416_1.10.1070.11 Mainly Alpha;Orthogonal Bundle;Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, Domain 5;Phosphatidylinositol 3-/4-kinase, catalytic domain 0.464 94 359 1.10.1070.11
ID Description Score Start End GO Terms
AF-A0A352EZ08-F1-model_v4 Uncharacterized protein 0.9454 29 361
AF-A0A352EZ08-F1-model_v4 Uncharacterized protein 0.8723 29 361
AF-A0A7V9ZPT2-F1-model_v4 Uncharacterized protein 0.8169 182 361
AF-A0A7V9ZPT2-F1-model_v4 Uncharacterized protein 0.8007 182 361
AF-A0A2V8HAP8-F1-model_v4 Uncharacterized protein 0.7817 67 361

Feature Viewer

pLDDT pTM Quality
82.14 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map