F309396

General Info

Members Datasets Scaffolds Average Seq Length
202 124 405 422

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100126115|Ga0070680_1001261151
Length 449
Sequence MQVKLGLKENWRQFTLLVIINAFVGGMVGLERSILPRIAEAEFRIAAKTAIFSFIIVFGIVKAITNYFTGALANKAGRKNLLIIGWLFGIPVPFVLMFAGSWSWIVAANVLLGINQGLTWSSTVVMKIDLVGEKQRGFAMGLNEFSGYVSVAVVAFFTGWIASKYGLRPYPFYIGVVLSLLGFFGSWLLVKDTKNHVAAEVTTSKVPRLKNIFWDTTLHNRNLSAVTQAGLVNNLNDGMAWGILPILLASKGFNMEAIGVVTAIYPAVWGIGQLFTGKMADHFCKKDLLFFGMLLQGIALVVLLFAQTLSHFIILSSFLGIGTALVYPTFLATVADNTHPTDRAKSIGVFRLWRDSGYAIGAILTGIIADTFGIHASILTIGVITIFSAGVIWFRMNCGSHHAVKLFGWLQFDKKKYNIPKILFIKVANLRKAGNLSTLKSEPLIQQIN

Samples

Sample ID Description Type Environment
1 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
107 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
110 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
111 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
117 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
118 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
120 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
123 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
124 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.5
Nodule 0
Rhizoplane 0.5
Rhizosphere 95.05
Stem 0
Stem Tuber 0
Unclassified 15.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070680_100126115 3300005336 Unclassified 2139
2 JGI24751J29686_10000691 3300002459 Bacteria 8376
3 rootH2_10017634 3300003320 Bacteria 8830
4 rootH2_10074965 3300003320 Bacteria 3997
5 rootH2_10080795 3300003320 Bacteria 9683
6 rootH2_10229425 3300003320 Bacteria 2315
7 rootL2_10065433 3300003322 Bacteria 23193
8 rootH1_10000149 3300003316 Bacteria 16615
9 rootH1_10000149 3300003323 Bacteria 69780
10 rootH1_10192967 3300003323 Bacteria 4283
11 Ga0070658_10003549 3300005327 Bacteria 12805
12 Ga0070690_100015840 3300005330 Unclassified 4505
13 Ga0070670_100010934 3300005331 Bacteria 7753
14 Ga0070670_100031050 3300005331 Bacteria 4601
15 Ga0068869_100144873 3300005334 Bacteria 1837
16 Ga0068869_100147797 3300005334 Bacteria 1820
17 Ga0068869_100158839 3300005334 Unclassified 1758
18 Ga0070666_10001098 3300005335 Bacteria 16532
19 Ga0070666_10030755 3300005335 Bacteria 3539
20 Ga0070680_100183404 3300005336 Bacteria 1763
21 Ga0070689_100122034 3300005340 Bacteria 2082
22 Ga0070675_100026068 3300005354 Bacteria 4689
23 Ga0070675_100043103 3300005354 Bacteria 3686
24 Ga0070675_100121856 3300005354 Bacteria 2216
25 Ga0070688_100014568 3300005365 Bacteria 4459
26 Ga0070659_100075055 3300005366 Bacteria 2694
27 Ga0070667_100005087 3300005367 Bacteria 11007
28 Ga0070700_100109309 3300005441 Bacteria 1835
29 Ga0070694_100115949 3300005444 Bacteria 1915
30 Ga0070681_10264814 3300005458 Bacteria 1631
31 Ga0070698_100009578 3300005471 Bacteria 10366
32 Ga0070698_100031733 3300005471 Bacteria 5475
33 Ga0070679_100041440 3300005530 Bacteria 4582
34 Ga0070679_100079253 3300005530 Unclassified 3274
35 Ga0070684_100008631 3300005535 Bacteria 7983
36 Ga0070684_100070787 3300005535 Bacteria 3070
37 Ga0068853_100057675 3300005539 Bacteria 3352
38 Ga0070665_100004105 3300005548 Bacteria 15317
39 Ga0068855_100017368 3300005563 Bacteria 8658
40 Ga0068855_100089691 3300005563 Unclassified 3549
41 Ga0068855_100183528 3300005563 Bacteria 2364
42 Ga0070664_100150210 3300005564 Unclassified 2056
43 Ga0068857_100125392 3300005577 Unclassified 2314
44 Ga0068852_100051983 3300005616 Bacteria 3520
45 Ga0068859_100009461 3300005617 Bacteria 9841
46 Ga0068859_100055757 3300005617 Unclassified 3976
47 Ga0068859_100119552 3300005617 Unclassified 2701
48 Ga0068859_100137290 3300005617 Bacteria 2519
49 Ga0068859_100199408 3300005617 Bacteria 2086
50 Ga0068864_100020352 3300005618 Bacteria 5551
51 Ga0068864_100240420 3300005618 Bacteria 1677
52 Ga0068851_10003674 3300005834 Bacteria 6848
53 Ga0068863_100082620 3300005841 Bacteria 3044
54 Ga0068858_100018897 3300005842 Bacteria 6449
55 Ga0068858_100098500 3300005842 Bacteria 2726
56 Ga0068860_100000034 3300005843 Bacteria 243128
57 Ga0068860_100068697 3300005843 Bacteria 3367
58 Ga0081455_10064423 3300005937 Bacteria 3068
59 Ga0068871_100047153 3300006358 Bacteria 3474
60 Ga0075428_100021584 3300006844 Bacteria 7130
61 Ga0075431_100013911 3300006847 Bacteria 8125
62 Ga0075434_100046852 3300006871 Bacteria 4290
63 Ga0075429_100004595 3300006880 Bacteria 11868
64 Ga0075429_100010480 3300006880 Bacteria 8017
65 Ga0097620_100009461 3300006931 Bacteria 9841
66 Ga0097620_100055758 3300006931 Unclassified 3976
67 Ga0097620_100119552 3300006931 Unclassified 2701
68 Ga0097620_100137295 3300006931 Bacteria 2519
69 Ga0097620_100199418 3300006931 Bacteria 2086
70 Ga0105240_10087932 3300009093 Bacteria 3803
71 Ga0105240_10254150 3300009093 Bacteria 2030
72 Ga0111539_10012732 3300009094 Bacteria 10533
73 Ga0114129_10005019 3300009147 Bacteria 18623
74 Ga0114129_10034043 3300009147 Bacteria 7196
75 Ga0105241_10009176 3300009174 Bacteria 7280
76 Ga0105242_10019496 3300009176 Bacteria 5315
77 Ga0105248_10076448 3300009177 Bacteria 3763
78 Ga0105248_10281457 3300009177 Bacteria 1872
79 Ga0105237_10029505 3300009545 Bacteria 5575
80 Ga0105249_10001544 3300009553 Bacteria 20201
81 Ga0105249_10013899 3300009553 Bacteria 7117
82 Ga0105249_10014857 3300009553 Bacteria 6885
83 Ga0105249_10017061 3300009553 Bacteria 6444
84 Ga0105249_10081460 3300009553 Unclassified 3009
85 Ga0105239_10000456 3300010375 Bacteria 59689
86 Ga0105239_10021931 3300010375 Bacteria 7040
87 Ga0157373_10012191 3300013100 Bacteria 6320
88 Ga0157373_10022371 3300013100 Bacteria 4587
89 Ga0157371_10067236 3300013102 Bacteria 2537
90 Ga0157371_10124226 3300013102 Unclassified 1835
91 Ga0157370_10011021 3300013104 Bacteria 9484
92 Ga0157369_10002420 3300013105 Bacteria 22427
93 Ga0157374_10007455 3300013296 Bacteria 9331
94 Ga0157374_10076697 3300013296 Bacteria 3161
95 Ga0157378_10000333 3300013297 Bacteria 46410
96 Ga0157378_10080885 3300013297 Bacteria 2936
97 Ga0163162_10000604 3300013306 Bacteria 33260
98 Ga0163162_10008919 3300013306 Bacteria 9753
99 Ga0163162_10245815 3300013306 Bacteria 1921
100 Ga0157375_10002956 3300013308 Bacteria 14749
101 Ga0157375_10009828 3300013308 Bacteria 8412
102 Ga0157375_10025289 3300013308 Bacteria 5513
103 Ga0157375_10066197 3300013308 Bacteria 3606
104 Ga0163163_10000078 3300014325 Bacteria 107017
105 Ga0163163_10018170 3300014325 Bacteria 6575
106 Ga0157380_10010861 3300014326 Bacteria 6566
107 Ga0157380_10071221 3300014326 Bacteria 2812
108 Ga0182008_10004834 3300014497 Bacteria 7786
109 Ga0157377_10087325 3300014745 Unclassified 1835
110 Ga0157379_10111672 3300014968 Bacteria 2455
111 Ga0163161_10117775 3300017792 Bacteria 1993
112 Ga0207656_10013552 3300025321 Bacteria 3120
113 Ga0207680_10019169 3300025903 Bacteria 3655
114 Ga0207680_10019400 3300025903 Unclassified 3636
115 Ga0207705_10003033 3300025909 Bacteria 12807
116 Ga0207707_10005997 3300025912 Bacteria 10637
117 Ga0207707_10241227 3300025912 Unclassified 1571
118 Ga0207660_10104714 3300025917 Bacteria 2119
119 Ga0207660_10145834 3300025917 Unclassified 1814
120 Ga0207657_10054961 3300025919 Unclassified 3441
121 Ga0207652_10012891 3300025921 Bacteria 6762
122 Ga0207652_10246973 3300025921 Unclassified 1609
123 Ga0207650_10020054 3300025925 Bacteria 4709
124 Ga0207659_10077536 3300025926 Bacteria 2446
125 Ga0207659_10096653 3300025926 Bacteria 2217
126 Ga0207659_10100637 3300025926 Bacteria 2178
127 Ga0207690_10189728 3300025932 Unclassified 1554
128 Ga0207706_10009203 3300025933 Bacteria 9074
129 Ga0207706_10162822 3300025933 Unclassified 1961
130 Ga0207686_10146075 3300025934 Bacteria 1640
131 Ga0207670_10023878 3300025936 Bacteria 3813
132 Ga0207670_10033277 3300025936 Bacteria 3320
133 Ga0207691_10001432 3300025940 Bacteria 23824
134 Ga0207691_10031075 3300025940 Unclassified 4988
135 Ga0207689_10001373 3300025942 Bacteria 23344
136 Ga0207689_10002252 3300025942 Bacteria 18073
137 Ga0207689_10167128 3300025942 Bacteria 1812
138 Ga0207689_10167837 3300025942 Bacteria 1808
139 Ga0207661_10016656 3300025944 Bacteria 5425
140 Ga0207679_10057637 3300025945 Unclassified 2874
141 Ga0207679_10153047 3300025945 Bacteria 1880
142 Ga0207667_10015444 3300025949 Bacteria 8673
143 Ga0207667_10303352 3300025949 Bacteria 1632
144 Ga0207712_10011135 3300025961 Bacteria 5725
145 Ga0207712_10019302 3300025961 Bacteria 4450
146 Ga0207712_10066197 3300025961 Unclassified 2582
147 Ga0207668_10000554 3300025972 Bacteria 23448
148 Ga0207668_10011914 3300025972 Bacteria 5305
149 Ga0207668_10046174 3300025972 Unclassified 2975
150 Ga0207658_10001247 3300025986 Bacteria 20115
151 Ga0207658_10062201 3300025986 Bacteria 2793
152 Ga0207703_10002419 3300026035 Bacteria 16208
153 Ga0207639_10118714 3300026041 Bacteria 2169
154 Ga0207708_10028162 3300026075 Unclassified 4255
155 Ga0207648_10029671 3300026089 Bacteria 4850
156 Ga0207648_10096859 3300026089 Unclassified 2582
157 Ga0207676_10009649 3300026095 Bacteria 6869
158 Ga0207676_10011571 3300026095 Bacteria 6310
159 Ga0207674_10096464 3300026116 Unclassified 2942
160 Ga0207675_100000346 3300026118 Bacteria 44265
161 Ga0207675_100019197 3300026118 Bacteria 6379
162 Ga0209971_1009221 3300027682 Bacteria 2338
163 Ga0209974_10007821 3300027876 Bacteria 3674
164 Ga0268266_10053614 3300028379 Bacteria 3465
165 Ga0268264_10000012 3300028381 Bacteria 521740
166 Ga0307512_10087437 3300030522 Bacteria 2195
167 Ga0307408_100000069 3300031548 Bacteria 120480
168 Ga0307408_100001203 3300031548 Bacteria 19536
169 Ga0307412_10122997 3300031911 Bacteria 1871
170 Ga0307409_100102106 3300031995 Bacteria 2382
171 Ga0307409_100169856 3300031995 Bacteria 1918
172 Ga0307414_10016598 3300032004 Bacteria 4479
173 Ga0307414_10096448 3300032004 Bacteria 2213
174 Ga0395901_0003215 3300038443 Bacteria 16441
175 Ga0395901_0007346 3300038443 Bacteria 11121
176 Ga0439462_0029076 3300042015 Bacteria 1462
177 Ga0451577_0001655 3300042876 Bacteria 28814
178 Ga0451577_0003054 3300042876 Bacteria 19022
179 Ga0451577_0067617 3300042876 Unclassified 3187
180 Ga0466969_0000404 3300044656 Bacteria 23765
181 Ga0466972_0000120 3300044658 Bacteria 66494
182 Ga0453683_0079893 3300044673 Unclassified 2048
183 Ga0453683_0113447 3300044673 Bacteria 1705
184 Ga0453684_0000549 3300044712 Bacteria 141927
185 Ga0453684_0085810 3300044712 Bacteria 3910
186 Ga0466957_0116130 3300044842 Bacteria 1702
187 Ga0466967_0036093 3300045976 Bacteria 4217
188 Ga0496110_0114292 3300048913 Unclassified 2429
189 Ga0501031_0065846 3300049568 Bacteria 2361
190 Ga0501034_0000007 3300049571 Bacteria 357805
191 Ga0501043_0148276 3300049579 Bacteria 1836
192 Ga0501048_0152848 3300049582 Bacteria 1633
193 Ga0501071_0088576 3300049587 Bacteria 2271
194 Ga0501257_000491 3300049686 Bacteria 7862
195 Ga0501225_0001225 3300049705 Bacteria 7992
196 Ga0501044_0128102 3300049823 Bacteria 2534
197 Ga0501045_0059643 3300049824 Bacteria 2796
198 nmdc:mga05p37_2112_c2 3300050507 Bacteria 18623
199 nmdc:mga09592_21593_c1 3300050508 Bacteria 5306
200 nmdc:mga09592_4334_c1 3300050508 Bacteria 11471
201 nmdc:mga08y16_75490_c1 3300050511 Unclassified 3514
202 nmdc:mga0n895_32285_c1 3300050512 Bacteria 5024
203 Ga0500622_0037141 3300053156 Bacteria 2545
204 Ga0070680_100126115
205 JGI24751J29686_10000691
206 rootH2_10017634
207 rootH2_10074965
208 rootH2_10080795
209 rootH2_10229425
210 rootL2_10065433
211 rootH1_10000149
212 rootH1_10192967
213 Ga0070658_10003549
214 Ga0070690_100015840
215 Ga0070670_100010934
216 Ga0070670_100031050
217 Ga0068869_100144873
218 Ga0068869_100147797
219 Ga0068869_100158839
220 Ga0070666_10001098
221 Ga0070666_10030755
222 Ga0070680_100183404
223 Ga0070689_100122034
224 Ga0070675_100026068
225 Ga0070675_100043103
226 Ga0070675_100121856
227 Ga0070688_100014568
228 Ga0070659_100075055
229 Ga0070667_100005087
230 Ga0070700_100109309
231 Ga0070694_100115949
232 Ga0070681_10264814
233 Ga0070698_100009578
234 Ga0070698_100031733
235 Ga0070679_100041440
236 Ga0070679_100079253
237 Ga0070684_100008631
238 Ga0070684_100070787
239 Ga0068853_100057675
240 Ga0070665_100004105
241 Ga0068855_100017368
242 Ga0068855_100089691
243 Ga0068855_100183528
244 Ga0070664_100150210
245 Ga0068857_100125392
246 Ga0068852_100051983
247 Ga0068859_100009461
248 Ga0068859_100055757
249 Ga0068859_100119552
250 Ga0068859_100137290
251 Ga0068859_100199408
252 Ga0068864_100020352
253 Ga0068864_100240420
254 Ga0068851_10003674
255 Ga0068863_100082620
256 Ga0068858_100018897
257 Ga0068858_100098500
258 Ga0068860_100000034
259 Ga0068860_100068697
260 Ga0081455_10064423
261 Ga0068871_100047153
262 Ga0075428_100021584
263 Ga0075431_100013911
264 Ga0075434_100046852
265 Ga0075429_100004595
266 Ga0075429_100010480
267 Ga0097620_100009461
268 Ga0097620_100055758
269 Ga0097620_100119552
270 Ga0097620_100137295
271 Ga0097620_100199418
272 Ga0105240_10087932
273 Ga0105240_10254150
274 Ga0111539_10012732
275 Ga0114129_10005019
276 Ga0114129_10034043
277 Ga0105241_10009176
278 Ga0105242_10019496
279 Ga0105248_10076448
280 Ga0105248_10281457
281 Ga0105237_10029505
282 Ga0105249_10001544
283 Ga0105249_10013899
284 Ga0105249_10014857
285 Ga0105249_10017061
286 Ga0105249_10081460
287 Ga0105239_10000456
288 Ga0105239_10021931
289 Ga0157373_10012191
290 Ga0157373_10022371
291 Ga0157371_10067236
292 Ga0157371_10124226
293 Ga0157370_10011021
294 Ga0157369_10002420
295 Ga0157374_10007455
296 Ga0157374_10076697
297 Ga0157378_10000333
298 Ga0157378_10080885
299 Ga0163162_10000604
300 Ga0163162_10008919
301 Ga0163162_10245815
302 Ga0157375_10002956
303 Ga0157375_10009828
304 Ga0157375_10025289
305 Ga0157375_10066197
306 Ga0163163_10000078
307 Ga0163163_10018170
308 Ga0157380_10010861
309 Ga0157380_10071221
310 Ga0182008_10004834
311 Ga0157377_10087325
312 Ga0157379_10111672
313 Ga0163161_10117775
314 Ga0207656_10013552
315 Ga0207680_10019169
316 Ga0207680_10019400
317 Ga0207705_10003033
318 Ga0207707_10005997
319 Ga0207707_10241227
320 Ga0207660_10104714
321 Ga0207660_10145834
322 Ga0207657_10054961
323 Ga0207652_10012891
324 Ga0207652_10246973
325 Ga0207650_10020054
326 Ga0207659_10077536
327 Ga0207659_10096653
328 Ga0207659_10100637
329 Ga0207690_10189728
330 Ga0207706_10009203
331 Ga0207706_10162822
332 Ga0207686_10146075
333 Ga0207670_10023878
334 Ga0207670_10033277
335 Ga0207691_10001432
336 Ga0207691_10031075
337 Ga0207689_10001373
338 Ga0207689_10002252
339 Ga0207689_10167128
340 Ga0207689_10167837
341 Ga0207661_10016656
342 Ga0207679_10057637
343 Ga0207679_10153047
344 Ga0207667_10015444
345 Ga0207667_10303352
346 Ga0207712_10011135
347 Ga0207712_10019302
348 Ga0207712_10066197
349 Ga0207668_10000554
350 Ga0207668_10011914
351 Ga0207668_10046174
352 Ga0207658_10001247
353 Ga0207658_10062201
354 Ga0207703_10002419
355 Ga0207639_10118714
356 Ga0207708_10028162
357 Ga0207648_10029671
358 Ga0207648_10096859
359 Ga0207676_10009649
360 Ga0207676_10011571
361 Ga0207674_10096464
362 Ga0207675_100000346
363 Ga0207675_100019197
364 Ga0209971_1009221
365 Ga0209974_10007821
366 Ga0268266_10053614
367 Ga0268264_10000012
368 Ga0307512_10087437
369 Ga0307408_100000069
370 Ga0307408_100001203
371 Ga0307412_10122997
372 Ga0307409_100102106
373 Ga0307409_100169856
374 Ga0307414_10016598
375 Ga0307414_10096448
376 Ga0395901_0003215
377 Ga0395901_0007346
378 Ga0439462_0029076
379 Ga0451577_0001655
380 Ga0451577_0003054
381 Ga0451577_0067617
382 Ga0466969_0000404
383 Ga0466972_0000120
384 Ga0453683_0079893
385 Ga0453683_0113447
386 Ga0453684_0000549
387 Ga0453684_0085810
388 Ga0466957_0116130
389 Ga0466967_0036093
390 Ga0496110_0114292
391 Ga0501031_0065846
392 Ga0501034_0000007
393 Ga0501043_0148276
394 Ga0501048_0152848
395 Ga0501071_0088576
396 Ga0501257_000491
397 Ga0501225_0001225
398 Ga0501044_0128102
399 Ga0501045_0059643
400 nmdc:mga05p37_2112_c2
401 nmdc:mga09592_21593_c1
402 nmdc:mga09592_4334_c1
403 nmdc:mga08y16_75490_c1
404 nmdc:mga0n895_32285_c1
405 Ga0500622_0037141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07690

MFS_1

Major Facilitator Superfamily

226

406

0.92

PF12832

MFS_1_like

MFS_1 like family

238

424

0.8

PF07690

MFS_1

Major Facilitator Superfamily

16

229

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.8291 11 379
6s4m-assembly1.cif.gz_A crystal structure of the human organic anion transporter mfsd10 (tetran) 0.7939 11 375
8jta-assembly1.cif.gz_A human vmat2 complex with tetrabenazine 0.7928 11 382
8hpk-assembly1.cif.gz_A crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form 0.786 11 379
8thr-assembly1.cif.gz_A structure of the human vesicular monoamine transporter 2 (vmat2) bound to tetrabenazine in an occluded conformation 0.7813 14 382
ID Description Score Start End Superfamily
af_Q4E404_13_230_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9172 15 188 1.20.1250.20
af_Q8R090_126_283_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9004 49 190 1.20.1250.20
af_Q2FXH1_4_180_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8909 13 189 1.20.1250.20
af_Q8MP22_241_464_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.888 13 190 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8846 11 192 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A3N5NU18-F1-model_v4 MFS transporter 0.9923 2 204 GO:0016020
GO:0022857
AF-A0A3N5GU30-F1-model_v4 MFS transporter 0.9863 1 187 GO:0016020
GO:0022857
AF-A0A7W6EUA7-F1-model_v4 Putative MFS family arabinose efflux permease 0.9845 1 186 GO:0016020
GO:0022857
AF-A0A6L4A6Y3-F1-model_v4 MFS transporter 0.9838 1 206 GO:0016020
GO:0022857
AF-A0A2N5XHG0-F1-model_v4 MFS transporter 0.9812 2 201 GO:0016020
GO:0022857

Map