F308813

General Info

Members Datasets Scaffolds Average Seq Length
201 152 402 152

Family's Representative Sequence

Representative Sequence 3300041408|Ga0439453_0000207|Ga0439453_0000207_737_1240
Length 167
Sequence MPELWRSSIAPVTTTLELGRVTDRKPPFKYSALARVWFSDTDAQGIVYYGRYLPYFDHARVEYHRHLGPIDVGERDFVMRACTIEYHAPARFDDLLEIFVRAARVGRTSVAYECAAYRVDDDLLMVTAQQTLVLVDLERRQPCAVPESFVERVEAFEDGDLVVAGRT

Samples

Sample ID Description Type Environment
1 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
2 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
28 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
29 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
54 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
55 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
56 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
57 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
58 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
59 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
60 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
61 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
62 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
63 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
64 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
65 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
66 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
67 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
68 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
69 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
70 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
71 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
72 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
75 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
76 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
77 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
78 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
79 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
80 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
81 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
82 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
86 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
87 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
88 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
89 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
90 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
91 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
92 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
93 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
94 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
95 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
96 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
97 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
103 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
104 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
114 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
115 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
116 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
117 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
130 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
131 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
132 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
133 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
134 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
135 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
136 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
137 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
138 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
139 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
146 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
147 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
150 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
151 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
152 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1
Nodule 0
Rhizoplane 4.48
Rhizosphere 94.03
Stem 0
Stem Tuber 0
Unclassified 14.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0439453_0000207 3300041408 Bacteria 5732
2 JGI24747J21853_1029679 3300001978 Unclassified 622
3 JGI25407J50210_10008769 3300003373 Bacteria 2552
4 Ga0070676_10263317 3300005328 Bacteria 1155
5 Ga0068869_100989001 3300005334 Bacteria 732
6 Ga0068868_100019224 3300005338 Bacteria 5118
7 Ga0070660_101671270 3300005339 Unclassified 542
8 Ga0070691_10051896 3300005341 Bacteria 1960
9 Ga0070675_101054914 3300005354 Bacteria 747
10 Ga0070674_100091722 3300005356 Bacteria 2195
11 Ga0070663_100209091 3300005455 Bacteria 1527
12 Ga0070662_100089563 3300005457 Bacteria 2308
13 Ga0070662_101063158 3300005457 Unclassified 694
14 Ga0068867_101063922 3300005459 Bacteria 737
15 Ga0070698_101091139 3300005471 Bacteria 746
16 Ga0070697_100724645 3300005536 Bacteria 878
17 Ga0070672_100148481 3300005543 Bacteria 1938
18 Ga0070704_101899707 3300005549 Unclassified 552
19 Ga0068855_100134069 3300005563 Bacteria 2826
20 Ga0068856_100954919 3300005614 Bacteria 876
21 Ga0068856_100958992 3300005614 Unclassified 874
22 Ga0068856_101488141 3300005614 Bacteria 691
23 Ga0068864_101228150 3300005618 Unclassified 749
24 Ga0081455_10000913 3300005937 Bacteria 37895
25 Ga0081455_10005481 3300005937 Bacteria 13915
26 Ga0081455_10044812 3300005937 Bacteria 3853
27 Ga0081455_10069230 3300005937 Bacteria 2935
28 Ga0081538_10003936 3300005981 Bacteria 13849
29 Ga0081538_10020541 3300005981 Bacteria 4853
30 Ga0081540_1015688 3300005983 Bacteria 4782
31 Ga0081540_1080729 3300005983 Bacteria 1465
32 Ga0075365_10224946 3300006038 Bacteria 1317
33 Ga0075364_10461540 3300006051 Bacteria 868
34 Ga0075432_10033767 3300006058 Unclassified 1775
35 Ga0075430_100415798 3300006846 Bacteria 1110
36 Ga0075431_100100751 3300006847 Unclassified 2980
37 Ga0075434_100335809 3300006871 Bacteria 1532
38 Ga0075436_100063463 3300006914 Unclassified 2553
39 Ga0075436_100083419 3300006914 Bacteria 2217
40 Ga0075435_100051587 3300007076 Bacteria 3314
41 Ga0111539_10132914 3300009094 Bacteria 2914
42 Ga0111539_10316269 3300009094 Bacteria 1817
43 Ga0111539_10341075 3300009094 Bacteria 1744
44 Ga0105245_11604389 3300009098 Bacteria 702
45 Ga0114129_10030335 3300009147 Bacteria 7652
46 Ga0114129_10270282 3300009147 Unclassified 2275
47 Ga0114129_12653006 3300009147 Bacteria 597
48 Ga0105243_11007767 3300009148 Bacteria 836
49 Ga0105242_10455720 3300009176 Bacteria 1207
50 Ga0105249_11729738 3300009553 Bacteria 698
51 Ga0105239_10021084 3300010375 Bacteria 7190
52 Ga0105239_11319513 3300010375 Bacteria 832
53 Ga0157335_1036193 3300012492 Unclassified 539
54 Ga0163162_10240297 3300013306 Unclassified 1942
55 Ga0157372_10100964 3300013307 Bacteria 3293
56 Ga0163163_10857856 3300014325 Unclassified 971
57 Ga0163163_11905172 3300014325 Bacteria 654
58 Ga0207688_10047206 3300025901 Bacteria 2405
59 Ga0207687_10877212 3300025927 Bacteria 767
60 Ga0207690_10248751 3300025932 Bacteria 1372
61 Ga0207706_10090939 3300025933 Bacteria 2683
62 Ga0207709_10902359 3300025935 Bacteria 718
63 Ga0207691_10180907 3300025940 Bacteria 1842
64 Ga0207667_10382240 3300025949 Bacteria 1434
65 Ga0207677_10017128 3300026023 Bacteria 4312
66 Ga0207702_10177818 3300026078 Bacteria 1957
67 Ga0207648_10313370 3300026089 Bacteria 1409
68 Ga0207428_10000892 3300027907 Bacteria 33470
69 Ga0307408_102132694 3300031548 Unclassified 541
70 Ga0307405_10022059 3300031731 Bacteria 3593
71 Ga0307413_10413295 3300031824 Bacteria 1060
72 Ga0307413_10470513 3300031824 Bacteria 1002
73 Ga0307410_10146222 3300031852 Bacteria 1754
74 Ga0307406_10227949 3300031901 Bacteria 1389
75 Ga0307406_10284610 3300031901 Bacteria 1263
76 Ga0307407_10037901 3300031903 Bacteria 2667
77 Ga0307412_10043059 3300031911 Bacteria 2938
78 Ga0307409_100004590 3300031995 Bacteria 7788
79 Ga0307409_100246398 3300031995 Bacteria 1631
80 Ga0307416_100278893 3300032002 Bacteria 1646
81 Ga0307416_100715879 3300032002 Bacteria 1091
82 Ga0307414_10614385 3300032004 Bacteria 976
83 Ga0307411_10036255 3300032005 Bacteria 3088
84 Ga0307411_10587523 3300032005 Bacteria 956
85 Ga0307415_100022083 3300032126 Bacteria 3922
86 Ga0307415_102107954 3300032126 Unclassified 551
87 Ga0373951_0197549 3300035091 Unclassified 585
88 Ga0373931_0497826 3300035691 Bacteria 786
89 Ga0373925_0470012 3300037068 Bacteria 1031
90 Ga0395899_0026408 3300037312 Bacteria 4382
91 Ga0395899_0147157 3300037312 Bacteria 1672
92 Ga0395899_0735057 3300037312 Bacteria 616
93 Ga0395900_0409718 3300037418 Bacteria 1318
94 Ga0395900_0487580 3300037418 Bacteria 1184
95 Ga0395900_0704876 3300037418 Bacteria 943
96 Ga0395900_0733422 3300037418 Unclassified 919
97 Ga0395898_0571336 3300037466 Bacteria 1073
98 Ga0395905_0118148 3300037471 Bacteria 2492
99 Ga0395905_1736339 3300037471 Bacteria 529
100 Ga0395901_0331068 3300038443 Bacteria 1574
101 Ga0395901_0395049 3300038443 Bacteria 1421
102 Ga0439439_0010857 3300041406 Bacteria 2184
103 Ga0439461_0015656 3300041410 Bacteria 1455
104 Ga0451791_0017355 3300041451 Bacteria 711
105 Ga0451839_1072024 3300041496 Bacteria 683
106 Ga0439431_0029743 3300041997 Bacteria 1351
107 Ga0439431_0069038 3300041997 Bacteria 939
108 Ga0439433_0079462 3300041999 Bacteria 797
109 Ga0439437_008964 3300042000 Bacteria 1131
110 Ga0439441_008503 3300042001 Bacteria 1679
111 Ga0439445_0159159 3300042004 Bacteria 659
112 Ga0439448_0007527 3300042005 Bacteria 3158
113 Ga0439449_0146445 3300042007 Bacteria 880
114 Ga0439450_003110 3300042008 Bacteria 2705
115 Ga0439451_012964 3300042009 Bacteria 1684
116 Ga0439451_118626 3300042009 Bacteria 538
117 Ga0439454_060386 3300042011 Bacteria 657
118 Ga0439462_0002883 3300042015 Bacteria 4065
119 Ga0450920_015060 3300042122 Bacteria 1468
120 Ga0450920_097906 3300042122 Bacteria 608
121 Ga0450907_026403 3300042146 Bacteria 984
122 Ga0450910_021933 3300042147 Bacteria 969
123 Ga0439446_0001284 3300042156 Bacteria 5640
124 Ga0439446_0004576 3300042156 Bacteria 3507
125 Ga0439458_0006117 3300042157 Bacteria 2687
126 Ga0439458_0046345 3300042157 Bacteria 1065
127 Ga0439434_0101524 3300042435 Bacteria 927
128 Ga0439435_0085302 3300042436 Bacteria 953
129 Ga0439464_0092516 3300042439 Bacteria 913
130 Ga0450918_006671 3300042531 Bacteria 2054
131 Ga0451576_0016562 3300045051 Bacteria 8130
132 Ga0451576_0367039 3300045051 Bacteria 1508
133 Ga0451576_0456503 3300045051 Bacteria 1342
134 Ga0495651_1022351 3300046462 Unclassified 501
135 Ga0495616_0421627 3300046513 Unclassified 545
136 Ga0495630_0313610 3300046517 Bacteria 1199
137 Ga0495632_0420593 3300046519 Unclassified 582
138 Ga0495637_0084732 3300046520 Bacteria 1259
139 Ga0495644_0398483 3300046523 Unclassified 545
140 Ga0495609_0170317 3300046538 Bacteria 920
141 Ga0495656_0022284 3300046615 Bacteria 2479
142 Ga0495657_0080585 3300046675 Bacteria 2107
143 Ga0495647_0293366 3300046681 Bacteria 732
144 Ga0495658_0053806 3300046683 Bacteria 2287
145 Ga0495613_0253295 3300046689 Bacteria 1228
146 Ga0495670_0260306 3300046691 Bacteria 926
147 Ga0495589_0330531 3300046794 Unclassified 704
148 Ga0495581_0136225 3300047315 Bacteria 1431
149 Ga0495676_0117069 3300047321 Bacteria 1945
150 Ga0495685_140291 3300047447 Bacteria 788
151 Ga0496104_0117101 3300048907 Bacteria 2557
152 Ga0496104_0593743 3300048907 Bacteria 1018
153 Ga0496105_0199411 3300048908 Bacteria 1634
154 Ga0496109_0181834 3300048912 Bacteria 1975
155 Ga0496110_0691321 3300048913 Bacteria 921
156 Ga0496112_0521173 3300048915 Unclassified 1123
157 Ga0496113_0643101 3300048916 Bacteria 848
158 Ga0496114_0058228 3300048917 Bacteria 3226
159 Ga0501037_0553483 3300049573 Bacteria 776
160 Ga0501039_0439358 3300049575 Unclassified 1025
161 Ga0501040_0305081 3300049576 Bacteria 1138
162 Ga0501067_0318940 3300049583 Bacteria 865
163 Ga0501068_0163711 3300049584 Unclassified 1402
164 Ga0501068_0399283 3300049584 Unclassified 886
165 Ga0501069_0011660 3300049585 Bacteria 4660
166 Ga0501072_0222867 3300049588 Bacteria 1503
167 Ga0501074_0306859 3300049590 Bacteria 1127
168 Ga0501075_0344765 3300049591 Unclassified 1135
169 Ga0501076_0633170 3300049592 Bacteria 882
170 Ga0501076_0704271 3300049592 Bacteria 834
171 Ga0501077_0137200 3300049593 Bacteria 1551
172 Ga0501202_010067 3300049652 Bacteria 1747
173 Ga0501243_078097 3300049675 Bacteria 640
174 Ga0501079_0631358 3300049741 Bacteria 843
175 Ga0501080_0666913 3300049742 Bacteria 919
176 Ga0501081_0055630 3300049743 Bacteria 2734
177 Ga0501081_0967227 3300049743 Bacteria 643
178 Ga0501083_0626736 3300049744 Bacteria 700
179 Ga0501035_0614051 3300049822 Bacteria 885
180 Ga0501045_0291644 3300049824 Bacteria 1214
181 Ga0501045_0467820 3300049824 Bacteria 937
182 nmdc:mga05p37_96740_c1 3300050507 Bacteria 3637
183 nmdc:mga08y16_30964_c1 3300050511 Bacteria 5627
184 nmdc:mga0n895_80042_c1 3300050512 Bacteria 3255
185 nmdc:mga0rr50_965156_c1 3300050513 Unclassified 726
186 nmdc:mga08x19_402163_c1 3300050514 Unclassified 961
187 nmdc:mga08x19_70634_c1 3300050514 Bacteria 2275
188 nmdc:mga0a205_1160457_c1 3300050515 Bacteria 620
189 nmdc:mga0a205_18378_c1 3300050515 Bacteria 6572
190 Ga0495619_0213329 3300053085 Bacteria 1337
191 Ga0501084_0089199 3300054114 Bacteria 2588
192 Ga0501084_0294367 3300054114 Bacteria 1371
193 Ga0501084_1024741 3300054114 Bacteria 693
194 Ga0501084_1314327 3300054114 Bacteria 606
195 Ga0590075_009093 3300059424 Bacteria 2378
196 Ga0501082_0060852 3300060353 Bacteria 3251
197 Ga0501082_0358604 3300060353 Bacteria 1272
198 Ga0530510_0013733 3300061734 Bacteria 5700
199 Ga0530510_0199185 3300061734 Bacteria 1487
200 Ga0530510_0297211 3300061734 Bacteria 1208
201 Ga0530510_0398642 3300061734 Bacteria 1037
202 Ga0439453_0000207
203 JGI24747J21853_1029679
204 JGI25407J50210_10008769
205 Ga0070676_10263317
206 Ga0068869_100989001
207 Ga0068868_100019224
208 Ga0070660_101671270
209 Ga0070691_10051896
210 Ga0070675_101054914
211 Ga0070674_100091722
212 Ga0070663_100209091
213 Ga0070662_100089563
214 Ga0070662_101063158
215 Ga0068867_101063922
216 Ga0070698_101091139
217 Ga0070697_100724645
218 Ga0070672_100148481
219 Ga0070704_101899707
220 Ga0068855_100134069
221 Ga0068856_100954919
222 Ga0068856_100958992
223 Ga0068856_101488141
224 Ga0068864_101228150
225 Ga0081455_10000913
226 Ga0081455_10005481
227 Ga0081455_10044812
228 Ga0081455_10069230
229 Ga0081538_10003936
230 Ga0081538_10020541
231 Ga0081540_1015688
232 Ga0081540_1080729
233 Ga0075365_10224946
234 Ga0075364_10461540
235 Ga0075432_10033767
236 Ga0075430_100415798
237 Ga0075431_100100751
238 Ga0075434_100335809
239 Ga0075436_100063463
240 Ga0075436_100083419
241 Ga0075435_100051587
242 Ga0111539_10132914
243 Ga0111539_10316269
244 Ga0111539_10341075
245 Ga0105245_11604389
246 Ga0114129_10030335
247 Ga0114129_10270282
248 Ga0114129_12653006
249 Ga0105243_11007767
250 Ga0105242_10455720
251 Ga0105249_11729738
252 Ga0105239_10021084
253 Ga0105239_11319513
254 Ga0157335_1036193
255 Ga0163162_10240297
256 Ga0157372_10100964
257 Ga0163163_10857856
258 Ga0163163_11905172
259 Ga0207688_10047206
260 Ga0207687_10877212
261 Ga0207690_10248751
262 Ga0207706_10090939
263 Ga0207709_10902359
264 Ga0207691_10180907
265 Ga0207667_10382240
266 Ga0207677_10017128
267 Ga0207702_10177818
268 Ga0207648_10313370
269 Ga0207428_10000892
270 Ga0307408_102132694
271 Ga0307405_10022059
272 Ga0307413_10413295
273 Ga0307413_10470513
274 Ga0307410_10146222
275 Ga0307406_10227949
276 Ga0307406_10284610
277 Ga0307407_10037901
278 Ga0307412_10043059
279 Ga0307409_100004590
280 Ga0307409_100246398
281 Ga0307416_100278893
282 Ga0307416_100715879
283 Ga0307414_10614385
284 Ga0307411_10036255
285 Ga0307411_10587523
286 Ga0307415_100022083
287 Ga0307415_102107954
288 Ga0373951_0197549
289 Ga0373931_0497826
290 Ga0373925_0470012
291 Ga0395899_0026408
292 Ga0395899_0147157
293 Ga0395899_0735057
294 Ga0395900_0409718
295 Ga0395900_0487580
296 Ga0395900_0704876
297 Ga0395900_0733422
298 Ga0395898_0571336
299 Ga0395905_0118148
300 Ga0395905_1736339
301 Ga0395901_0331068
302 Ga0395901_0395049
303 Ga0439439_0010857
304 Ga0439461_0015656
305 Ga0451791_0017355
306 Ga0451839_1072024
307 Ga0439431_0029743
308 Ga0439431_0069038
309 Ga0439433_0079462
310 Ga0439437_008964
311 Ga0439441_008503
312 Ga0439445_0159159
313 Ga0439448_0007527
314 Ga0439449_0146445
315 Ga0439450_003110
316 Ga0439451_012964
317 Ga0439451_118626
318 Ga0439454_060386
319 Ga0439462_0002883
320 Ga0450920_015060
321 Ga0450920_097906
322 Ga0450907_026403
323 Ga0450910_021933
324 Ga0439446_0001284
325 Ga0439446_0004576
326 Ga0439458_0006117
327 Ga0439458_0046345
328 Ga0439434_0101524
329 Ga0439435_0085302
330 Ga0439464_0092516
331 Ga0450918_006671
332 Ga0451576_0016562
333 Ga0451576_0367039
334 Ga0451576_0456503
335 Ga0495651_1022351
336 Ga0495616_0421627
337 Ga0495630_0313610
338 Ga0495632_0420593
339 Ga0495637_0084732
340 Ga0495644_0398483
341 Ga0495609_0170317
342 Ga0495656_0022284
343 Ga0495657_0080585
344 Ga0495647_0293366
345 Ga0495658_0053806
346 Ga0495613_0253295
347 Ga0495670_0260306
348 Ga0495589_0330531
349 Ga0495581_0136225
350 Ga0495676_0117069
351 Ga0495685_140291
352 Ga0496104_0117101
353 Ga0496104_0593743
354 Ga0496105_0199411
355 Ga0496109_0181834
356 Ga0496110_0691321
357 Ga0496112_0521173
358 Ga0496113_0643101
359 Ga0496114_0058228
360 Ga0501037_0553483
361 Ga0501039_0439358
362 Ga0501040_0305081
363 Ga0501067_0318940
364 Ga0501068_0163711
365 Ga0501068_0399283
366 Ga0501069_0011660
367 Ga0501072_0222867
368 Ga0501074_0306859
369 Ga0501075_0344765
370 Ga0501076_0633170
371 Ga0501076_0704271
372 Ga0501077_0137200
373 Ga0501202_010067
374 Ga0501243_078097
375 Ga0501079_0631358
376 Ga0501080_0666913
377 Ga0501081_0055630
378 Ga0501081_0967227
379 Ga0501083_0626736
380 Ga0501035_0614051
381 Ga0501045_0291644
382 Ga0501045_0467820
383 nmdc:mga05p37_96740_c1
384 nmdc:mga08y16_30964_c1
385 nmdc:mga0n895_80042_c1
386 nmdc:mga0rr50_965156_c1
387 nmdc:mga08x19_402163_c1
388 nmdc:mga08x19_70634_c1
389 nmdc:mga0a205_1160457_c1
390 nmdc:mga0a205_18378_c1
391 Ga0495619_0213329
392 Ga0501084_0089199
393 Ga0501084_0294367
394 Ga0501084_1024741
395 Ga0501084_1314327
396 Ga0590075_009093
397 Ga0501082_0060852
398 Ga0501082_0358604
399 Ga0530510_0013733
400 Ga0530510_0199185
401 Ga0530510_0297211
402 Ga0530510_0398642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03061

4HBT

Thioesterase superfamily

44

125

0.97

PF13279

4HBT_2

Thioesterase-like superfamily

36

153

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3bbj-assembly1.cif.gz_B crystal structure of a putative thioesterase ii (tfu_2367) from thermobifida fusca yx at 2.45 a resolution 0.9224 71 122
3bbj-assembly1.cif.gz_A crystal structure of a putative thioesterase ii (tfu_2367) from thermobifida fusca yx at 2.45 a resolution 0.9216 71 122
4ae8-assembly2.cif.gz_D crystal structure of human them4 0.9178 65 122
4qfw-assembly2.cif.gz_B crystal structure of acyl-coa thioesterase tesb from yersinia pestis 0.8969 63 123
5v10-assembly1.cif.gz_B-2 crystal structure of the putative tol-pal system-associated acyl-coa thioesterase from pseudomonas aeruginosa pao1 0.8783 18 142
ID Description Score Start End Superfamily
af_P41903_5_339_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9282 65 124 2.40.160.210
3bbjB00 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.9224 71 122 2.40.160.210
af_A0A1D6I7U7_1_80_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9075 63 136 3.10.129.10
af_K7KLB0_34_136_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9062 67 120 3.10.129.10
af_Q95Q68_98_406_2.40.160.210 Mainly Beta;Beta Barrel;Porin;Acyl-CoA thioesterase, double hotdog domain 0.8987 65 123 2.40.160.210
ID Description Score Start End GO Terms
AF-A0A7V9BBS9-F1-model_v4 Thioesterase family protein 0.949 60 152
AF-A0A7V9BBS9-F1-model_v4 Thioesterase family protein 0.9391 60 152
AF-A0A538ETK9-F1-model_v4 Acyl-CoA thioesterase 0.9309 2 152 GO:0047617
AF-A0A538ETK9-F1-model_v4 Acyl-CoA thioesterase 0.9191 2 152 GO:0047617
AF-A0A538I1P5-F1-model_v4 Acyl-CoA thioesterase 0.9159 2 150 GO:0047617

Map