F307920

General Info

Members Datasets Scaffolds Average Seq Length
200 155 198 155

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004167301|3004168675
Length 183
Sequence AAPLPLSDQEPFDWTDLAKMCLVSRDRDKKERPMIALNVNGEDRSVDVPEDMPLLWVLRDVIGLTGTKFGCGIAQCGACTVQLDGQPVRSCVLPIASVGTRRVTTIEAIGATAGGKKVQQAWLDLEVIQCGYCQSGQIMSASALLERNPDPSDSDIDAAMSGNICRCGTYTRIRAAIKQAAKA

Samples

Sample ID Description Type Environment
1 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
2 3004167301 Mesorhizobium loti 582 Isolate Unclassified
3 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
40 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
43 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
84 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
88 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
89 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
91 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
96 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
97 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
98 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
101 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
104 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
105 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
106 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
107 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
111 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
112 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
113 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
114 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
115 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
116 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
117 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
125 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
126 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
127 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
128 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
129 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
130 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
131 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
132 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
133 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
134 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
135 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
136 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
137 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
138 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
141 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
148 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
149 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
150 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
151 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
152 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
153 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
154 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
155 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0.5
Isolates 1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13
Nodule 0
Rhizoplane 2.5
Rhizosphere 76
Stem 0
Stem Tuber 0
Unclassified 8.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1033031 3300000549 Bacteria 607
2 JGI25165J46597_1000026 3300003214 Bacteria 332550
3 rootH1_10118173 3300003323 Bacteria 5644
4 JGI25160J50197_1000068 3300003354 Bacteria 112790
5 JGI25161J50226_1000048 3300003374 Bacteria 112790
6 JGI25404J52841_10001078 3300003659 Bacteria 4574
7 JGI25404J52841_10009803 3300003659 Bacteria 2053
8 Ga0055543_1000046 3300004625 Bacteria 113628
9 Ga0065165_1000175 3300005262 Bacteria 113628
10 Ga0065704_10618524 3300005289 Bacteria 598
11 Ga0070676_10538650 3300005328 Bacteria 834
12 Ga0070660_100944381 3300005339 Bacteria 728
13 Ga0070659_101958558 3300005366 Bacteria 526
14 Ga0070709_10065627 3300005434 Bacteria 2325
15 Ga0070709_10329528 3300005434 Bacteria 1123
16 Ga0070714_100016739 3300005435 Bacteria 5928
17 Ga0070714_100807442 3300005435 Bacteria 909
18 Ga0070713_100018537 3300005436 Bacteria 5289
19 Ga0070713_100376471 3300005436 Bacteria 1322
20 Ga0070713_101307035 3300005436 Bacteria 703
21 Ga0070711_100327740 3300005439 Bacteria 1225
22 Ga0070700_100041464 3300005441 Bacteria 2822
23 Ga0068867_100488817 3300005459 Bacteria 1056
24 Ga0070706_100018562 3300005467 Bacteria 6412
25 Ga0070707_100015594 3300005468 Bacteria 7132
26 Ga0070698_100002660 3300005471 Bacteria 19709
27 Ga0070698_100496294 3300005471 Bacteria 1158
28 Ga0070699_100091701 3300005518 Bacteria 2657
29 Ga0070699_100103908 3300005518 Bacteria 2491
30 Ga0070697_100000029 3300005536 Bacteria 114092
31 Ga0070697_100028823 3300005536 Bacteria 4447
32 Ga0070697_100823081 3300005536 Bacteria 822
33 Ga0070695_100073527 3300005545 Bacteria 2244
34 Ga0070696_100188127 3300005546 Bacteria 1535
35 Ga0070664_101017036 3300005564 Bacteria 779
36 Ga0068854_100124724 3300005578 Bacteria 1960
37 Ga0068856_100280643 3300005614 Bacteria 1682
38 Ga0068852_100487279 3300005616 Bacteria 1226
39 Ga0081455_10007064 3300005937 Bacteria 11914
40 Ga0081455_10035932 3300005937 Bacteria 4418
41 Ga0081538_10094033 3300005981 Bacteria 1536
42 Ga0081540_1010054 3300005983 Bacteria 6442
43 Ga0081540_1024525 3300005983 Bacteria 3499
44 Ga0081540_1029739 3300005983 Bacteria 3038
45 Ga0081539_10258577 3300005985 Bacteria 769
46 Ga0075365_10000222 3300006038 Bacteria 19233
47 Ga0075363_100011545 3300006048 Bacteria 4233
48 Ga0075364_10025763 3300006051 Bacteria 3746
49 Ga0070716_100168312 3300006173 Bacteria 1428
50 Ga0075362_10272343 3300006177 Bacteria 836
51 Ga0075370_10163357 3300006353 Bacteria 1307
52 Ga0105244_10329989 3300009036 Bacteria 704
53 Ga0105240_10294688 3300009093 Bacteria 1858
54 Ga0111539_10047344 3300009094 Bacteria 5139
55 Ga0105237_10460551 3300009545 Bacteria 1278
56 Ga0105237_10879353 3300009545 Bacteria 903
57 Ga0105238_10140033 3300009551 Bacteria 2396
58 Ga0105238_10292446 3300009551 Bacteria 1611
59 Ga0105239_10050876 3300010375 Bacteria 4543
60 Ga0105239_10743640 3300010375 Bacteria 1122
61 Ga0105239_11656531 3300010375 Bacteria 740
62 Ga0157369_10141626 3300013105 Bacteria 2544
63 Ga0163162_13337461 3300013306 Bacteria 513
64 Ga0157372_11085105 3300013307 Bacteria 926
65 Ga0157372_11114252 3300013307 Bacteria 913
66 Ga0157379_10022276 3300014968 Bacteria 5612
67 Ga0157376_10106348 3300014969 Bacteria 2461
68 Ga0213872_10008362 3300021361 Bacteria 5011
69 Ga0213872_10015712 3300021361 Bacteria 3518
70 Ga0213872_10052905 3300021361 Unclassified 1842
71 Ga0209233_1000030 3300025261 Bacteria 636702
72 Ga0209130_1000144 3300025284 Bacteria 114000
73 Ga0209564_1000180 3300025295 Bacteria 151009
74 Ga0207426_1000126 3300025302 Bacteria 213341
75 Ga0207656_10598185 3300025321 Bacteria 563
76 Ga0207692_10035634 3300025898 Bacteria 2419
77 Ga0207688_10235818 3300025901 Bacteria 1105
78 Ga0207705_10098032 3300025909 Bacteria 2153
79 Ga0207684_10017429 3300025910 Bacteria 6162
80 Ga0207684_10093917 3300025910 Bacteria 2558
81 Ga0207654_10261516 3300025911 Bacteria 1164
82 Ga0207695_10341141 3300025913 Bacteria 1386
83 Ga0207671_10821811 3300025914 Bacteria 736
84 Ga0207663_10908933 3300025916 Bacteria 704
85 Ga0207662_10255130 3300025918 Bacteria 1152
86 Ga0207657_10095444 3300025919 Bacteria 2474
87 Ga0207694_10055343 3300025924 Bacteria 3080
88 Ga0207694_10122510 3300025924 Bacteria 2077
89 Ga0207700_10672759 3300025928 Bacteria 923
90 Ga0207664_10008958 3300025929 Bacteria 7006
91 Ga0207690_11577488 3300025932 Bacteria 549
92 Ga0207665_10054573 3300025939 Bacteria 2695
93 Ga0207667_10524114 3300025949 Bacteria 1200
94 Ga0207639_10690278 3300026041 Bacteria 947
95 Ga0207639_11113000 3300026041 Bacteria 741
96 Ga0207678_10177239 3300026067 Bacteria 1820
97 Ga0207708_10145459 3300026075 Bacteria 1862
98 Ga0207674_11308597 3300026116 Bacteria 694
99 Ga0207683_10157287 3300026121 Bacteria 2053
100 Ga0207698_10944181 3300026142 Bacteria 871
101 Ga0207428_10118304 3300027907 Bacteria 2033
102 Ga0268266_10284438 3300028379 Bacteria 1539
103 Ga0268266_11857672 3300028379 Bacteria 577
104 Ga0316575_10108535 3300031665 Bacteria 1132
105 Ga0316579_10143665 3300031691 Bacteria 1151
106 Ga0316579_10436625 3300031691 Unclassified 633
107 Ga0316577_10119707 3300031733 Bacteria 1479
108 Ga0316577_10228218 3300031733 Bacteria 1053
109 Ga0316577_10625747 3300031733 Bacteria 612
110 Ga0307413_10827331 3300031824 Bacteria 780
111 Ga0307414_10106643 3300032004 Bacteria 2121
112 Ga0307414_10554022 3300032004 Bacteria 1025
113 Ga0316585_10113430 3300032137 Bacteria 891
114 Ga0316593_10424620 3300032168 Unclassified 516
115 Ga0373934_0165804 3300035086 Unclassified 906
116 Ga0373956_0547597 3300035119 Bacteria 552
117 Ga0373937_0020066 3300036401 Bacteria 5988
118 Ga0373937_1222549 3300036401 Bacteria 700
119 Ga0373937_1534245 3300036401 Bacteria 613
120 Ga0316584_0060482 3300036712 Bacteria 2837
121 Ga0316584_0100664 3300036712 Bacteria 2164
122 Ga0316584_0230362 3300036712 Bacteria 1358
123 Ga0316584_0449901 3300036712 Unclassified 911
124 Ga0395900_0846787 3300037418 Bacteria 840
125 Ga0400490_30923 3300038726 Bacteria 1625
126 Ga0400485_02224 3300038735 Bacteria 24988
127 Ga0400487_04258 3300039110 Bacteria 2059
128 Ga0400487_12764 3300039110 Bacteria 1248
129 Ga0436360_0295363 3300039438 Bacteria 717
130 Ga0436361_0014433 3300039447 Bacteria 18226
131 Ga0436361_0672748 3300039447 Bacteria 1453
132 Ga0436361_0777956 3300039447 Bacteria 3087
133 Ga0436361_0800019 3300039447 Unclassified 3101
134 Ga0451853_4017219 3300041512 Bacteria 675
135 Ga0439463_010950 3300042016 Bacteria 2228
136 Ga0439446_0123909 3300042156 Bacteria 834
137 Ga0439460_0328359 3300042461 Bacteria 537
138 Ga0451577_0475314 3300042876 Bacteria 1135
139 Ga0453683_0373266 3300044673 Bacteria 918
140 Ga0453684_0136281 3300044712 Bacteria 2939
141 Ga0466959_0264405 3300045049 Bacteria 1184
142 Ga0451576_0012819 3300045051 Bacteria 9407
143 Ga0495603_0056811 3300046455 Bacteria 2316
144 Ga0495591_048655 3300046458 Bacteria 1168
145 Ga0495638_0007149 3300046460 Bacteria 8042
146 Ga0495651_0000220 3300046462 Bacteria 43557
147 Ga0495607_0000847 3300046501 Bacteria 28896
148 Ga0495606_0011377 3300046507 Bacteria 7263
149 Ga0495606_0175516 3300046507 Bacteria 1240
150 Ga0495616_0141739 3300046513 Bacteria 1093
151 Ga0495637_0011329 3300046520 Bacteria 4288
152 Ga0495654_0223671 3300046530 Bacteria 795
153 Ga0495625_0225648 3300046660 Bacteria 1225
154 Ga0495671_0094240 3300046692 Bacteria 1465
155 Ga0495649_0000027 3300046694 Bacteria 164157
156 Ga0495676_0003901 3300047321 Bacteria 13558
157 Ga0495683_0000412 3300047323 Bacteria 34264
158 Ga0495675_0299822 3300047444 Bacteria 955
159 Ga0495684_0554570 3300047471 Bacteria 782
160 Ga0495686_0000247 3300047472 Bacteria 97327
161 Ga0495686_0000893 3300047472 Bacteria 37575
162 Ga0495686_0037396 3300047472 Bacteria 3110
163 Ga0495602_0228189 3300048088 Bacteria 1401
164 Ga0495602_0462134 3300048088 Bacteria 894
165 Ga0496103_0342852 3300048906 Bacteria 961
166 Ga0496104_0952069 3300048907 Bacteria 763
167 Ga0496105_0144235 3300048908 Bacteria 1959
168 Ga0496109_0603113 3300048912 Bacteria 1034
169 Ga0496115_0057939 3300048918 Bacteria 3117
170 Ga0496116_0268782 3300048919 Bacteria 835
171 Ga0496118_0139947 3300048921 Bacteria 1536
172 Ga0496119_0052899 3300048922 Bacteria 2484
173 Ga0496119_0538728 3300048922 Bacteria 538
174 Ga0496121_0010866 3300048924 Bacteria 10178
175 Ga0496124_0324103 3300048927 Bacteria 1102
176 Ga0496125_0088685 3300048928 Bacteria 2330
177 Ga0496125_0648376 3300048928 Bacteria 569
178 Ga0496126_0002788 3300048929 Bacteria 23004
179 Ga0496126_0043331 3300048929 Bacteria 4152
180 Ga0501080_0554861 3300049742 Bacteria 1023
181 Ga0501083_0105879 3300049744 Bacteria 1852
182 nmdc:mga03683_357515_c1 3300050489 Bacteria 692
183 nmdc:mga03n38_263957_c1 3300050490 Bacteria 914
184 nmdc:mga0yw44_57440_c1 3300050492 Bacteria 2374
185 nmdc:mga0yw44_819152_c1 3300050492 Bacteria 632
186 nmdc:mga06z11_158797_c1 3300050494 Bacteria 1291
187 nmdc:mga04h51_472480_c1 3300050495 Bacteria 533
188 nmdc:mga08y16_77568_c1 3300050511 Unclassified 3464
189 Ga0495595_0315712 3300053084 Bacteria 787
190 Ga0495619_0433996 3300053085 Bacteria 906
191 Ga0495619_0778521 3300053085 Bacteria 648
192 Ga0500592_002090 3300053116 Bacteria 3218
193 Ga0500618_001123 3300053125 Bacteria 13053
194 Ga0500588_0015390 3300053146 Bacteria 1957
195 Ga0500590_039148 3300053148 Bacteria 2444
196 Ga0500619_000071 3300053154 Bacteria 29375
197 Ga0500634_0027431 3300053161 Bacteria 3103
198 Ga0501082_1317080 3300060353 Bacteria 631

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300036401 Ga0373937_1222549 Ga0373937_1222549_297_686 127
2 3300005436 Ga0070713_100018537 Ga0070713_1000185371 132
3 3300006173 Ga0070716_100168312 Ga0070716_1001683122 132
4 3300025928 Ga0207700_10672759 Ga0207700_106727592 132
5 3300025939 Ga0207665_10054573 Ga0207665_100545733 132
6 3300005434 Ga0070709_10065627 Ga0070709_100656273 133
7 3300005435 Ga0070714_100016739 Ga0070714_1000167392 133
8 3300025916 Ga0207663_10908933 Ga0207663_109089332 133
9 3300025929 Ga0207664_10008958 Ga0207664_100089582 133
10 3300005459 Ga0068867_100488817 Ga0068867_1004888171 145
11 3300005985 Ga0081539_10258577 Ga0081539_102585772 145
12 iso_pu_bacteria 2917554339 2917554909 147
13 3300042156 Ga0439446_0123909 Ga0439446_0123909_88_549 148
14 3300005471 Ga0070698_100496294 Ga0070698_1004962941 149
15 3300005536 Ga0070697_100000029 Ga0070697_10000002997 149
16 3300021361 Ga0213872_10008362 Ga0213872_100083622 149
17 3300021361 Ga0213872_10015712 Ga0213872_100157123 149
18 3300021361 Ga0213872_10052905 Ga0213872_100529052 149
19 3300025910 Ga0207684_10093917 Ga0207684_100939172 149
20 3300039438 Ga0436360_0295363 Ga0436360_0295363_167_616 149
21 3300039447 Ga0436361_0014433 Ga0436361_0014433_14981_15430 149
22 3300039447 Ga0436361_0777956 Ga0436361_0777956_258_707 149
23 3300039447 Ga0436361_0800019 Ga0436361_0800019_2612_3061 149
24 3300005436 Ga0070713_100376471 Ga0070713_1003764713 150
25 3300006177 Ga0075362_10272343 Ga0075362_102723432 150
26 3300009094 Ga0111539_10047344 Ga0111539_100473447 150
27 3300025898 Ga0207692_10035634 Ga0207692_100356343 150
28 3300025918 Ga0207662_10255130 Ga0207662_102551302 150
29 3300026121 Ga0207683_10157287 Ga0207683_101572872 150
30 3300027907 Ga0207428_10118304 Ga0207428_101183042 150
31 3300028379 Ga0268266_10284438 Ga0268266_102844382 150
32 3300031665 Ga0316575_10108535 Ga0316575_101085351 150
33 3300031691 Ga0316579_10436625 Ga0316579_104366252 150
34 3300031733 Ga0316577_10119707 Ga0316577_101197071 150
35 3300031733 Ga0316577_10228218 Ga0316577_102282181 150
36 3300031733 Ga0316577_10625747 Ga0316577_106257471 150
37 3300032137 Ga0316585_10113430 Ga0316585_101134302 150
38 3300032168 Ga0316593_10424620 Ga0316593_104246201 150
39 3300035119 Ga0373956_0547597 Ga0373956_0547597_43_501 150
40 3300036401 Ga0373937_0020066 Ga0373937_0020066_2913_3371 150
41 3300036401 Ga0373937_1534245 Ga0373937_1534245_80_538 150
42 3300036712 Ga0316584_0060482 Ga0316584_0060482_2259_2711 150
43 3300036712 Ga0316584_0100664 Ga0316584_0100664_1446_1904 150
44 3300036712 Ga0316584_0230362 Ga0316584_0230362_562_1020 150
45 3300044673 Ga0453683_0373266 Ga0453683_0373266_35_493 150
46 3300044712 Ga0453684_0136281 Ga0453684_0136281_878_1336 150
47 3300045051 Ga0451576_0012819 Ga0451576_0012819_5727_6185 150
48 3300046455 Ga0495603_0056811 Ga0495603_0056811_1699_2151 150
49 3300046660 Ga0495625_0225648 Ga0495625_0225648_324_776 150
50 3300046692 Ga0495671_0094240 Ga0495671_0094240_769_1221 150
51 3300046694 Ga0495649_0000027 Ga0495649_0000027_153171_153623 150
52 3300047321 Ga0495676_0003901 Ga0495676_0003901_7522_7974 150
53 3300047323 Ga0495683_0000412 Ga0495683_0000412_10574_11026 150
54 3300047444 Ga0495675_0299822 Ga0495675_0299822_202_660 150
55 3300047471 Ga0495684_0554570 Ga0495684_0554570_54_512 150
56 3300048088 Ga0495602_0462134 Ga0495602_0462134_271_729 150
57 3300050489 nmdc:mga03683_357515_c1 nmdc:mga03683_357515_c1_47_499 150
58 3300050492 nmdc:mga0yw44_819152_c1 nmdc:mga0yw44_819152_c1_83_535 150
59 3300050511 nmdc:mga08y16_77568_c1 nmdc:mga08y16_77568_c1_2397_2855 150
60 3300053084 Ga0495595_0315712 Ga0495595_0315712_189_647 150
61 3300053085 Ga0495619_0433996 Ga0495619_0433996_78_536 150
62 3300053085 Ga0495619_0778521 Ga0495619_0778521_173_631 150
63 3300053125 Ga0500618_001123 Ga0500618_001123_2045_2497 150
64 3300053146 Ga0500588_0015390 Ga0500588_0015390_513_965 150
65 3300005289 Ga0065704_10618524 Ga0065704_106185241 151
66 3300005339 Ga0070660_100944381 Ga0070660_1009443812 151
67 3300005434 Ga0070709_10329528 Ga0070709_103295282 151
68 3300005467 Ga0070706_100018562 Ga0070706_1000185623 151
69 3300005471 Ga0070698_100002660 Ga0070698_1000026608 151
70 3300005518 Ga0070699_100091701 Ga0070699_1000917012 151
71 3300005518 Ga0070699_100103908 Ga0070699_1001039083 151
72 3300005536 Ga0070697_100028823 Ga0070697_1000288233 151
73 3300005536 Ga0070697_100823081 Ga0070697_1008230812 151
74 3300005545 Ga0070695_100073527 Ga0070695_1000735273 151
75 3300005546 Ga0070696_100188127 Ga0070696_1001881271 151
76 3300025910 Ga0207684_10017429 Ga0207684_100174293 151
77 3300026041 Ga0207639_11113000 Ga0207639_111130002 151
78 3300026116 Ga0207674_11308597 Ga0207674_113085972 151
79 3300038726 Ga0400490_30923 Ga0400490_30923_42_503 151
80 3300039110 Ga0400487_12764 Ga0400487_12764_97_558 151
81 3300046458 Ga0495591_048655 Ga0495591_048655_182_649 151
82 3300046460 Ga0495638_0007149 Ga0495638_0007149_702_1175 151
83 3300046462 Ga0495651_0000220 Ga0495651_0000220_4271_4816 151
84 3300046501 Ga0495607_0000847 Ga0495607_0000847_26027_26494 151
85 3300046507 Ga0495606_0175516 Ga0495606_0175516_10_477 151
86 3300046513 Ga0495616_0141739 Ga0495616_0141739_429_896 151
87 3300046520 Ga0495637_0011329 Ga0495637_0011329_1079_1546 151
88 3300046530 Ga0495654_0223671 Ga0495654_0223671_114_581 151
89 3300048088 Ga0495602_0228189 Ga0495602_0228189_600_1145 151
90 3300049742 Ga0501080_0554861 Ga0501080_0554861_206_667 151
91 3300053116 Ga0500592_002090 Ga0500592_002090_97_570 151
92 3300003214 JGI25165J46597_1000026 JGI25165J46597_100002652 152
93 3300003323 rootH1_10118173 rootH1_101181732 152
94 3300003354 JGI25160J50197_1000068 JGI25160J50197_100006864 152
95 3300003374 JGI25161J50226_1000048 JGI25161J50226_100004864 152
96 3300003659 JGI25404J52841_10009803 JGI25404J52841_100098033 152
97 3300004625 Ga0055543_1000046 Ga0055543_100004640 152
98 3300005262 Ga0065165_1000175 Ga0065165_100017565 152
99 3300005328 Ga0070676_10538650 Ga0070676_105386502 152
100 3300005366 Ga0070659_101958558 Ga0070659_1019585581 152
101 3300005468 Ga0070707_100015594 Ga0070707_1000155943 152
102 3300005564 Ga0070664_101017036 Ga0070664_1010170362 152
103 3300005578 Ga0068854_100124724 Ga0068854_1001247242 152
104 3300005614 Ga0068856_100280643 Ga0068856_1002806432 152
105 3300005616 Ga0068852_100487279 Ga0068852_1004872792 152
106 3300005937 Ga0081455_10007064 Ga0081455_100070647 152
107 3300005981 Ga0081538_10094033 Ga0081538_100940332 152
108 3300005983 Ga0081540_1010054 Ga0081540_10100541 152
109 3300005983 Ga0081540_1024525 Ga0081540_10245256 152
110 3300005983 Ga0081540_1029739 Ga0081540_10297393 152
111 3300006038 Ga0075365_10000222 Ga0075365_100002224 152
112 3300006048 Ga0075363_100011545 Ga0075363_1000115451 152
113 3300006051 Ga0075364_10025763 Ga0075364_100257633 152
114 3300006353 Ga0075370_10163357 Ga0075370_101633572 152
115 3300009093 Ga0105240_10294688 Ga0105240_102946882 152
116 3300009545 Ga0105237_10460551 Ga0105237_104605512 152
117 3300009545 Ga0105237_10879353 Ga0105237_108793532 152
118 3300009551 Ga0105238_10140033 Ga0105238_101400333 152
119 3300009551 Ga0105238_10292446 Ga0105238_102924462 152
120 3300010375 Ga0105239_10050876 Ga0105239_100508766 152
121 3300010375 Ga0105239_10743640 Ga0105239_107436401 152
122 3300010375 Ga0105239_11656531 Ga0105239_116565312 152
123 3300013105 Ga0157369_10141626 Ga0157369_101416261 152
124 3300013306 Ga0163162_13337461 Ga0163162_133374611 152
125 3300013307 Ga0157372_11085105 Ga0157372_110851051 152
126 3300013307 Ga0157372_11114252 Ga0157372_111142522 152
127 3300014968 Ga0157379_10022276 Ga0157379_100222762 152
128 3300014969 Ga0157376_10106348 Ga0157376_101063483 152
129 3300025261 Ga0209233_1000030 Ga0209233_1000030345 152
130 3300025284 Ga0209130_1000144 Ga0209130_100014462 152
131 3300025302 Ga0207426_1000126 Ga0207426_100012661 152
132 3300025321 Ga0207656_10598185 Ga0207656_105981851 152
133 3300025901 Ga0207688_10235818 Ga0207688_102358182 152
134 3300025909 Ga0207705_10098032 Ga0207705_100980322 152
135 3300025911 Ga0207654_10261516 Ga0207654_102615162 152
136 3300025913 Ga0207695_10341141 Ga0207695_103411412 152
137 3300025914 Ga0207671_10821811 Ga0207671_108218112 152
138 3300025919 Ga0207657_10095444 Ga0207657_100954442 152
139 3300025924 Ga0207694_10055343 Ga0207694_100553433 152
140 3300025924 Ga0207694_10122510 Ga0207694_101225103 152
141 3300025932 Ga0207690_11577488 Ga0207690_115774881 152
142 3300025949 Ga0207667_10524114 Ga0207667_105241142 152
143 3300026041 Ga0207639_10690278 Ga0207639_106902781 152
144 3300026067 Ga0207678_10177239 Ga0207678_101772392 152
145 3300026142 Ga0207698_10944181 Ga0207698_109441812 152
146 3300028379 Ga0268266_11857672 Ga0268266_118576721 152
147 3300031691 Ga0316579_10143665 Ga0316579_101436652 152
148 3300031824 Ga0307413_10827331 Ga0307413_108273311 152
149 3300032004 Ga0307414_10106643 Ga0307414_101066432 152
150 3300039447 Ga0436361_0672748 Ga0436361_0672748_208_666 152
151 3300041512 Ga0451853_4017219 Ga0451853_4017219_148_606 152
152 3300042016 Ga0439463_010950 Ga0439463_010950_1653_2144 152
153 3300042461 Ga0439460_0328359 Ga0439460_0328359_19_510 152
154 3300042876 Ga0451577_0475314 Ga0451577_0475314_476_940 152
155 3300046507 Ga0495606_0011377 Ga0495606_0011377_1296_1754 152
156 3300047472 Ga0495686_0000247 Ga0495686_0000247_8372_8830 152
157 3300047472 Ga0495686_0000893 Ga0495686_0000893_13110_13604 152
158 3300047472 Ga0495686_0037396 Ga0495686_0037396_2007_2465 152
159 3300048906 Ga0496103_0342852 Ga0496103_0342852_306_764 152
160 3300048907 Ga0496104_0952069 Ga0496104_0952069_85_543 152
161 3300048908 Ga0496105_0144235 Ga0496105_0144235_1313_1771 152
162 3300048912 Ga0496109_0603113 Ga0496109_0603113_183_641 152
163 3300048918 Ga0496115_0057939 Ga0496115_0057939_2588_3046 152
164 3300048922 Ga0496119_0538728 Ga0496119_0538728_41_499 152
165 3300048924 Ga0496121_0010866 Ga0496121_0010866_6987_7445 152
166 3300048927 Ga0496124_0324103 Ga0496124_0324103_196_654 152
167 3300048928 Ga0496125_0648376 Ga0496125_0648376_10_468 152
168 3300048929 Ga0496126_0002788 Ga0496126_0002788_11230_11703 152
169 3300048929 Ga0496126_0043331 Ga0496126_0043331_1450_1908 152
170 3300049744 Ga0501083_0105879 Ga0501083_0105879_815_1273 152
171 3300050490 nmdc:mga03n38_263957_c1 nmdc:mga03n38_263957_c1_216_674 152
172 3300050492 nmdc:mga0yw44_57440_c1 nmdc:mga0yw44_57440_c1_1661_2119 152
173 3300050494 nmdc:mga06z11_158797_c1 nmdc:mga06z11_158797_c1_226_684 152
174 3300050495 nmdc:mga04h51_472480_c1 nmdc:mga04h51_472480_c1_62_520 152
175 3300053148 Ga0500590_039148 Ga0500590_039148_1432_1914 152
176 3300060353 Ga0501082_1317080 Ga0501082_1317080_60_521 152
177 3300005436 Ga0070713_101307035 Ga0070713_1013070351 153
178 3300036712 Ga0316584_0449901 Ga0316584_0449901_55_576 153
179 3300037418 Ga0395900_0846787 Ga0395900_0846787_126_608 153
180 3300045049 Ga0466959_0264405 Ga0466959_0264405_213_695 153
181 3300048921 Ga0496118_0139947 Ga0496118_0139947_1000_1476 153
182 3300005937 Ga0081455_10035932 Ga0081455_100359322 154
183 3300005435 Ga0070714_100807442 Ga0070714_1008074422 155
184 3300005439 Ga0070711_100327740 Ga0070711_1003277402 155
185 3300005441 Ga0070700_100041464 Ga0070700_1000414642 155
186 3300009036 Ga0105244_10329989 Ga0105244_103299892 155
187 3300025295 Ga0209564_1000180 Ga0209564_1000180130 155
188 3300026075 Ga0207708_10145459 Ga0207708_101454592 155
189 3300032004 Ga0307414_10554022 Ga0307414_105540221 155
190 3300035086 Ga0373934_0165804 Ga0373934_0165804_125_646 155
191 3300038735 Ga0400485_02224 Ga0400485_02224_1091_1615 155
192 3300039110 Ga0400487_04258 Ga0400487_04258_1338_1862 155
193 3300048919 Ga0496116_0268782 Ga0496116_0268782_252_764 155
194 3300048922 Ga0496119_0052899 Ga0496119_0052899_1450_1962 155
195 3300048928 Ga0496125_0088685 Ga0496125_0088685_785_1297 155
196 3300053154 Ga0500619_000071 Ga0500619_000071_7912_8436 155
197 3300053161 Ga0500634_0027431 Ga0500634_0027431_1660_2145 155
198 iso_pu_bacteria 3004167301 3004168675 155
199 3300000549 LJQas_1033031 LJQas_10330311 157
200 3300003659 JGI25404J52841_10001078 JGI25404J52841_100010785 157

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

105

178

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

37

100

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dgj-assembly1.cif.gz_A crystal structure of the aldehyde oxidoreductase from desulfovibrio desulfuricans atcc 27774 0.9702 5 153
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.9655 5 153
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9633 5 153
8gy3-assembly1.cif.gz_B cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans 0.9632 5 153
1ffv-assembly1.cif.gz_A carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9617 5 153
ID Description Score Start End Superfamily
1t3qD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9633 88 150 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9599 81 153 1.10.150.120
1alo002 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9521 77 153 1.10.150.120
5y6qA01 Alpha Beta;Roll;Ubiquitin-like (UB roll);Beta-grasp domain 0.9518 5 79 3.10.20.30
1ffuD02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.9484 82 153 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A370NBK9-F1-model_v4 (2Fe-2S)-binding protein 0.9912 5 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A7V9I8F5-F1-model_v4 (2Fe-2S)-binding protein 0.9912 4 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A2R4FEC1-F1-model_v4 (2Fe-2S)-binding protein 0.9909 5 152 GO:0016491
GO:0046872
GO:0051537
AF-A0A536XSI9-F1-model_v4 (2Fe-2S)-binding protein 0.9908 7 153 GO:0016491
GO:0046872
GO:0051537
AF-A0A3A0FAW6-F1-model_v4 2Fe-2S ferredoxin-type domain-containing protein 0.9906 2 153 GO:0016491
GO:0046872
GO:0051537

Feature Viewer

pLDDT pTM Quality
93.89 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map