F307685

General Info

Members Datasets Scaffolds Average Seq Length
200 159 400 209

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0012645|Ga0496104_0012645_2370_3134
Length 254
Sequence LSVIAGLVPATPIRRALCFLERGGRAKPGHDRAFAAGRAATDNKEIKMIKMWGRNTSSNVQKAMFAVGELGLAYERIDIGGSFGKNREAAYLAMNPNGLVPTLEEDGFLLWESNSIIRYLAAKFGAGKLEPADPRTRARANQWMDWQLSVMGPAIAPVFWGMIRTPPAERNHKAIDEGKVKTTAAVKMLDEQFAKTAYAAGEAFSMGDIPIAIMSYRYRKLVPERPALPNFERWYAAIAARPAFTEHVSSIPLT

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
9 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
25 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
43 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
49 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
50 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
75 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
76 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
77 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
80 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
85 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
94 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
95 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
96 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
97 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
98 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
99 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
100 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
101 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
106 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
112 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
113 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
114 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
115 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
127 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
128 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
129 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
134 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
135 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
136 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
142 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
143 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
144 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
145 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
146 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
147 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
148 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
149 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
150 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
151 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
152 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
153 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
154 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
155 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
156 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
157 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
158 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.5
Nodule 0
Rhizoplane 7
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 1.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0012645 3300048907 Bacteria 7599
2 JGI24742J22300_10026049 3300002244 Bacteria 1012
3 JGI25405J52794_10052440 3300003911 Bacteria 875
4 Ga0070658_10072393 3300005327 Bacteria 2825
5 Ga0070680_100018386 3300005336 Bacteria 5521
6 Ga0070660_100031854 3300005339 Bacteria 3964
7 Ga0070687_100223081 3300005343 Bacteria 1156
8 Ga0070669_100056288 3300005353 Bacteria 2883
9 Ga0070675_100019830 3300005354 Bacteria 5363
10 Ga0070675_100355543 3300005354 Bacteria 1300
11 Ga0070714_100421286 3300005435 Bacteria 1265
12 Ga0070713_100100098 3300005436 Bacteria 2509
13 Ga0070713_100389459 3300005436 Bacteria 1300
14 Ga0070713_100623010 3300005436 Bacteria 1026
15 Ga0070710_10009606 3300005437 Bacteria 4737
16 Ga0070711_100313370 3300005439 Bacteria 1251
17 Ga0070700_100761873 3300005441 Bacteria 776
18 Ga0070678_100354861 3300005456 Bacteria 1262
19 Ga0070662_100261260 3300005457 Bacteria 1395
20 Ga0068867_100604683 3300005459 Bacteria 957
21 Ga0070679_100062201 3300005530 Bacteria 3721
22 Ga0068853_100661572 3300005539 Bacteria 995
23 Ga0070672_100078322 3300005543 Bacteria 2644
24 Ga0070695_100213348 3300005545 Bacteria 1387
25 Ga0068854_100531891 3300005578 Bacteria 994
26 Ga0068852_100021558 3300005616 Bacteria 5148
27 Ga0081455_10001256 3300005937 Bacteria 31653
28 Ga0081539_10012462 3300005985 Bacteria 6552
29 Ga0081539_10183439 3300005985 Bacteria 980
30 Ga0070717_10064008 3300006028 Bacteria 3054
31 Ga0070717_10329991 3300006028 Bacteria 1361
32 Ga0075363_100034235 3300006048 Bacteria 2651
33 Ga0075363_100124443 3300006048 Bacteria 1442
34 Ga0075364_10052321 3300006051 Bacteria 2668
35 Ga0075364_10070773 3300006051 Bacteria 2297
36 Ga0075364_10089725 3300006051 Bacteria 2039
37 Ga0070712_100004886 3300006175 Bacteria 8290
38 Ga0075367_10015237 3300006178 Bacteria 4173
39 Ga0075369_10048829 3300006186 Bacteria 1827
40 Ga0075366_10037966 3300006195 Bacteria 2844
41 Ga0075370_10193045 3300006353 Bacteria 1200
42 Ga0075428_100063730 3300006844 Bacteria 4036
43 Ga0075428_100234681 3300006844 Bacteria 1979
44 Ga0075430_100043252 3300006846 Bacteria 3807
45 Ga0075431_100000059 3300006847 Bacteria 61740
46 Ga0075431_100125075 3300006847 Bacteria 2653
47 Ga0075429_100001315 3300006880 Bacteria 20255
48 Ga0099795_10000280 3300007788 Bacteria 9133
49 Ga0099795_10315839 3300007788 Bacteria 691
50 Ga0111539_10002614 3300009094 Bacteria 23869
51 Ga0111539_10136149 3300009094 Bacteria 2876
52 Ga0114129_10001483 3300009147 Bacteria 31789
53 Ga0114129_10193297 3300009147 Bacteria 2761
54 Ga0114129_10512963 3300009147 Bacteria 1564
55 Ga0105243_11867570 3300009148 Bacteria 633
56 Ga0099796_10002721 3300010159 Bacteria 3952
57 Ga0099796_10176889 3300010159 Bacteria 854
58 Ga0157371_10153489 3300013102 Bacteria 1643
59 Ga0157370_10574799 3300013104 Unclassified 1033
60 Ga0157378_10355101 3300013297 Bacteria 1433
61 Ga0157377_10547557 3300014745 Bacteria 817
62 Ga0163161_10310693 3300017792 Bacteria 1244
63 Ga0213874_10229412 3300021377 Bacteria 678
64 Ga0209758_1000351 3300025297 Bacteria 83626
65 Ga0207697_10211708 3300025315 Bacteria 854
66 Ga0207692_10022376 3300025898 Bacteria 2907
67 Ga0207642_10164756 3300025899 Bacteria 1194
68 Ga0207705_10354096 3300025909 Bacteria 1131
69 Ga0207707_10354741 3300025912 Bacteria 1263
70 Ga0207693_10002841 3300025915 Bacteria 15002
71 Ga0207693_10046298 3300025915 Bacteria 3417
72 Ga0207663_10244095 3300025916 Bacteria 1319
73 Ga0207660_10030920 3300025917 Bacteria 3683
74 Ga0207662_10236045 3300025918 Bacteria 1196
75 Ga0207657_10064785 3300025919 Bacteria 3118
76 Ga0207652_10040319 3300025921 Bacteria 3965
77 Ga0207681_10113281 3300025923 Bacteria 1977
78 Ga0207659_10461843 3300025926 Bacteria 1071
79 Ga0207659_10667070 3300025926 Bacteria 889
80 Ga0207706_10520887 3300025933 Bacteria 1025
81 Ga0207651_10592894 3300025960 Bacteria 968
82 Ga0207640_10147212 3300025981 Bacteria 1725
83 Ga0207708_10514765 3300026075 Bacteria 1005
84 Ga0207708_10639227 3300026075 Bacteria 905
85 Ga0207683_10746348 3300026121 Bacteria 908
86 Ga0207698_10208454 3300026142 Unclassified 1756
87 Ga0207428_10004947 3300027907 Bacteria 12546
88 Ga0265338_10335325 3300028800 Bacteria 1091
89 Ga0265325_10000031 3300031241 Bacteria 102905
90 Ga0265325_10076077 3300031241 Bacteria 1676
91 Ga0265339_10210334 3300031249 Bacteria 956
92 Ga0265313_10045754 3300031595 Bacteria 2129
93 Ga0316575_10095813 3300031665 Bacteria 1204
94 Ga0316578_10112522 3300031728 Bacteria 1635
95 Ga0307405_10565196 3300031731 Bacteria 923
96 Ga0316577_10152457 3300031733 Bacteria 1303
97 Ga0307416_100203575 3300032002 Bacteria 1881
98 Ga0373934_0107009 3300035086 Bacteria 1133
99 Ga0373939_0001244 3300035114 Bacteria 6229
100 Ga0373945_0091841 3300035116 Bacteria 1176
101 Ga0373953_0111213 3300035117 Bacteria 1158
102 Ga0373956_0270405 3300035119 Bacteria 808
103 Ga0316574_0003494 3300035398 Bacteria 8110
104 Ga0373924_0233287 3300035410 Bacteria 814
105 Ga0373935_0829005 3300035692 Bacteria 683
106 Ga0373927_0030065 3300035695 Bacteria 3544
107 Ga0373933_0036900 3300035724 Bacteria 2864
108 Ga0373937_0007729 3300036401 Bacteria 9319
109 Ga0316582_0191902 3300036647 Bacteria 1392
110 Ga0316584_0013412 3300036712 Bacteria 5800
111 Ga0373925_0007759 3300037068 Bacteria 7811
112 Ga0436364_0147076 3300037853 Bacteria 2105
113 Ga0436365_0271377 3300039437 Bacteria 847
114 Ga0436365_1874922 3300039437 Bacteria 941
115 Ga0436363_1202092 3300039450 Bacteria 977
116 Ga0436363_1226724 3300039450 Bacteria 1754
117 Ga0439441_004985 3300042001 Bacteria 2040
118 Ga0439460_0114276 3300042461 Bacteria 878
119 Ga0451576_0000647 3300045051 Bacteria 71894
120 Ga0495629_0090087 3300046459 Bacteria 2140
121 Ga0495638_0304031 3300046460 Bacteria 858
122 Ga0495607_0348041 3300046501 Bacteria 685
123 Ga0495640_0045824 3300046533 Bacteria 3033
124 Ga0495634_0107680 3300046642 Bacteria 1795
125 Ga0495659_0161540 3300046664 Bacteria 905
126 Ga0495602_0201161 3300048088 Bacteria 1520
127 Ga0496104_0000671 3300048907 Bacteria 29392
128 Ga0496105_0010223 3300048908 Bacteria 7376
129 Ga0496108_0375816 3300048911 Bacteria 1241
130 Ga0496109_1304289 3300048912 Bacteria 662
131 Ga0496110_0055740 3300048913 Bacteria 3478
132 Ga0496110_0082635 3300048913 Bacteria 2865
133 Ga0496111_0150383 3300048914 Bacteria 1727
134 Ga0496111_0450655 3300048914 Unclassified 949
135 Ga0496112_0446498 3300048915 Bacteria 1231
136 Ga0496113_0028045 3300048916 Bacteria 4045
137 Ga0496114_0041565 3300048917 Bacteria 3811
138 Ga0496114_0311175 3300048917 Bacteria 1391
139 Ga0496115_0657741 3300048918 Bacteria 828
140 Ga0501031_0553914 3300049568 Bacteria 740
141 Ga0501032_0005634 3300049569 Bacteria 9278
142 Ga0501032_0018272 3300049569 Bacteria 4914
143 Ga0501033_0022523 3300049570 Bacteria 4753
144 Ga0501034_0025921 3300049571 Bacteria 5971
145 Ga0501034_0220382 3300049571 Bacteria 1850
146 Ga0501036_0038944 3300049572 Bacteria 4025
147 Ga0501038_0014982 3300049574 Bacteria 7060
148 Ga0501039_0009306 3300049575 Bacteria 7482
149 Ga0501043_0025011 3300049579 Bacteria 4684
150 Ga0501046_0081708 3300049580 Bacteria 2495
151 Ga0501046_0381155 3300049580 Bacteria 1021
152 Ga0501047_0030133 3300049581 Bacteria 5231
153 Ga0501047_0234337 3300049581 Bacteria 1688
154 Ga0501048_0010569 3300049582 Bacteria 6888
155 Ga0501067_0021882 3300049583 Bacteria 3537
156 Ga0501068_0724050 3300049584 Bacteria 651
157 Ga0501069_0007504 3300049585 Bacteria 5727
158 Ga0501070_0055172 3300049586 Bacteria 3293
159 Ga0501071_0056783 3300049587 Bacteria 2829
160 Ga0501073_0007521 3300049589 Bacteria 8092
161 Ga0501073_0079213 3300049589 Bacteria 2287
162 Ga0501074_0011700 3300049590 Bacteria 6377
163 Ga0501076_0144801 3300049592 Bacteria 1932
164 Ga0501076_0267371 3300049592 Bacteria 1400
165 Ga0501079_0081555 3300049741 Bacteria 2501
166 Ga0501080_0029935 3300049742 Bacteria 5068
167 Ga0501083_0021302 3300049744 Bacteria 4504
168 Ga0501035_0025863 3300049822 Bacteria 5378
169 Ga0501035_0716243 3300049822 Bacteria 806
170 Ga0501044_0000411 3300049823 Bacteria 52862
171 Ga0501044_0032586 3300049823 Bacteria 5476
172 Ga0501045_0057517 3300049824 Bacteria 2845
173 nmdc:mga03n38_457203_c1 3300050490 Bacteria 711
174 nmdc:mga00v17_58326_c1 3300050491 Bacteria 2365
175 nmdc:mga00v17_68278_c1 3300050491 Bacteria 2197
176 nmdc:mga0yw44_58568_c1 3300050492 Bacteria 2354
177 nmdc:mga0k408_30671_c1 3300050493 Bacteria 3066
178 nmdc:mga06z11_93151_c1 3300050494 Bacteria 1640
179 nmdc:mga04h51_13137_c1 3300050495 Bacteria 2340
180 nmdc:mga05p37_1121934_c1 3300050507 Bacteria 821
181 nmdc:mga05p37_285_c1 3300050507 Bacteria 52916
182 nmdc:mga09592_664_c1 3300050508 Bacteria 24142
183 nmdc:mga0qj67_6051_c1 3300050509 Bacteria 8860
184 nmdc:mga06r32_118_c1 3300050510 Bacteria 56778
185 nmdc:mga08y16_64084_c1 3300050511 Bacteria 3838
186 nmdc:mga08y16_89_c1 3300050511 Bacteria 76793
187 nmdc:mga0n895_1047109_c1 3300050512 Bacteria 795
188 nmdc:mga0n895_232267_c1 3300050512 Bacteria 1872
189 Ga0500643_003972 3300053087 Bacteria 6840
190 Ga0500644_0001859 3300053088 Bacteria 5440
191 Ga0500595_000001 3300053119 Bacteria 1088438
192 Ga0500655_080851 3300053133 Bacteria 669
193 Ga0500604_0045548 3300053151 Bacteria 1339
194 Ga0500616_0000001 3300053153 Bacteria 1986011
195 Ga0500616_0139148 3300053153 Bacteria 1137
196 Ga0500645_000418 3300053730 Bacteria 29391
197 Ga0501084_0009605 3300054114 Bacteria 8002
198 Ga0501084_0241812 3300054114 Bacteria 1524
199 Ga0501084_0412691 3300054114 Bacteria 1141
200 Ga0501084_1116771 3300054114 Bacteria 662
201 Ga0496104_0012645
202 JGI24742J22300_10026049
203 JGI25405J52794_10052440
204 Ga0070658_10072393
205 Ga0070680_100018386
206 Ga0070660_100031854
207 Ga0070687_100223081
208 Ga0070669_100056288
209 Ga0070675_100019830
210 Ga0070675_100355543
211 Ga0070714_100421286
212 Ga0070713_100100098
213 Ga0070713_100389459
214 Ga0070713_100623010
215 Ga0070710_10009606
216 Ga0070711_100313370
217 Ga0070700_100761873
218 Ga0070678_100354861
219 Ga0070662_100261260
220 Ga0068867_100604683
221 Ga0070679_100062201
222 Ga0068853_100661572
223 Ga0070672_100078322
224 Ga0070695_100213348
225 Ga0068854_100531891
226 Ga0068852_100021558
227 Ga0081455_10001256
228 Ga0081539_10012462
229 Ga0081539_10183439
230 Ga0070717_10064008
231 Ga0070717_10329991
232 Ga0075363_100034235
233 Ga0075363_100124443
234 Ga0075364_10052321
235 Ga0075364_10070773
236 Ga0075364_10089725
237 Ga0070712_100004886
238 Ga0075367_10015237
239 Ga0075369_10048829
240 Ga0075366_10037966
241 Ga0075370_10193045
242 Ga0075428_100063730
243 Ga0075428_100234681
244 Ga0075430_100043252
245 Ga0075431_100000059
246 Ga0075431_100125075
247 Ga0075429_100001315
248 Ga0099795_10000280
249 Ga0099795_10315839
250 Ga0111539_10002614
251 Ga0111539_10136149
252 Ga0114129_10001483
253 Ga0114129_10193297
254 Ga0114129_10512963
255 Ga0105243_11867570
256 Ga0099796_10002721
257 Ga0099796_10176889
258 Ga0157371_10153489
259 Ga0157370_10574799
260 Ga0157378_10355101
261 Ga0157377_10547557
262 Ga0163161_10310693
263 Ga0213874_10229412
264 Ga0209758_1000351
265 Ga0207697_10211708
266 Ga0207692_10022376
267 Ga0207642_10164756
268 Ga0207705_10354096
269 Ga0207707_10354741
270 Ga0207693_10002841
271 Ga0207693_10046298
272 Ga0207663_10244095
273 Ga0207660_10030920
274 Ga0207662_10236045
275 Ga0207657_10064785
276 Ga0207652_10040319
277 Ga0207681_10113281
278 Ga0207659_10461843
279 Ga0207659_10667070
280 Ga0207706_10520887
281 Ga0207651_10592894
282 Ga0207640_10147212
283 Ga0207708_10514765
284 Ga0207708_10639227
285 Ga0207683_10746348
286 Ga0207698_10208454
287 Ga0207428_10004947
288 Ga0265338_10335325
289 Ga0265325_10000031
290 Ga0265325_10076077
291 Ga0265339_10210334
292 Ga0265313_10045754
293 Ga0316575_10095813
294 Ga0316578_10112522
295 Ga0307405_10565196
296 Ga0316577_10152457
297 Ga0307416_100203575
298 Ga0373934_0107009
299 Ga0373939_0001244
300 Ga0373945_0091841
301 Ga0373953_0111213
302 Ga0373956_0270405
303 Ga0316574_0003494
304 Ga0373924_0233287
305 Ga0373935_0829005
306 Ga0373927_0030065
307 Ga0373933_0036900
308 Ga0373937_0007729
309 Ga0316582_0191902
310 Ga0316584_0013412
311 Ga0373925_0007759
312 Ga0436364_0147076
313 Ga0436365_0271377
314 Ga0436365_1874922
315 Ga0436363_1202092
316 Ga0436363_1226724
317 Ga0439441_004985
318 Ga0439460_0114276
319 Ga0451576_0000647
320 Ga0495629_0090087
321 Ga0495638_0304031
322 Ga0495607_0348041
323 Ga0495640_0045824
324 Ga0495634_0107680
325 Ga0495659_0161540
326 Ga0495602_0201161
327 Ga0496104_0000671
328 Ga0496105_0010223
329 Ga0496108_0375816
330 Ga0496109_1304289
331 Ga0496110_0055740
332 Ga0496110_0082635
333 Ga0496111_0150383
334 Ga0496111_0450655
335 Ga0496112_0446498
336 Ga0496113_0028045
337 Ga0496114_0041565
338 Ga0496114_0311175
339 Ga0496115_0657741
340 Ga0501031_0553914
341 Ga0501032_0005634
342 Ga0501032_0018272
343 Ga0501033_0022523
344 Ga0501034_0025921
345 Ga0501034_0220382
346 Ga0501036_0038944
347 Ga0501038_0014982
348 Ga0501039_0009306
349 Ga0501043_0025011
350 Ga0501046_0081708
351 Ga0501046_0381155
352 Ga0501047_0030133
353 Ga0501047_0234337
354 Ga0501048_0010569
355 Ga0501067_0021882
356 Ga0501068_0724050
357 Ga0501069_0007504
358 Ga0501070_0055172
359 Ga0501071_0056783
360 Ga0501073_0007521
361 Ga0501073_0079213
362 Ga0501074_0011700
363 Ga0501076_0144801
364 Ga0501076_0267371
365 Ga0501079_0081555
366 Ga0501080_0029935
367 Ga0501083_0021302
368 Ga0501035_0025863
369 Ga0501035_0716243
370 Ga0501044_0000411
371 Ga0501044_0032586
372 Ga0501045_0057517
373 nmdc:mga03n38_457203_c1
374 nmdc:mga00v17_58326_c1
375 nmdc:mga00v17_68278_c1
376 nmdc:mga0yw44_58568_c1
377 nmdc:mga0k408_30671_c1
378 nmdc:mga06z11_93151_c1
379 nmdc:mga04h51_13137_c1
380 nmdc:mga05p37_1121934_c1
381 nmdc:mga05p37_285_c1
382 nmdc:mga09592_664_c1
383 nmdc:mga0qj67_6051_c1
384 nmdc:mga06r32_118_c1
385 nmdc:mga08y16_64084_c1
386 nmdc:mga08y16_89_c1
387 nmdc:mga0n895_1047109_c1
388 nmdc:mga0n895_232267_c1
389 Ga0500643_003972
390 Ga0500644_0001859
391 Ga0500595_000001
392 Ga0500655_080851
393 Ga0500604_0045548
394 Ga0500616_0000001
395 Ga0500616_0139148
396 Ga0500645_000418
397 Ga0501084_0009605
398 Ga0501084_0241812
399 Ga0501084_0412691
400 Ga0501084_1116771

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

47

122

0.95

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

56

123

0.92

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

52

131

0.89

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

144

242

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9557 1 208
4kh7-assembly2.cif.gz_A crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9547 1 208
4kh7-assembly3.cif.gz_B crystal structure of a glutathione transferase family member from salmonella enterica ty2, target efi-507262, with bound glutathione 0.9513 1 208
6nv6-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri with glutathione bound 0.9506 2 208
6nxv-assembly4.cif.gz_D crystal structure of the theta class glutathione s-transferase from the citrus canker pathogen xanthomonas axonopodis pv. citri, apo form 0.9498 2 208
ID Description Score Start End Superfamily
4kh7A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9626 86 202 1.20.1050.10
4ke3A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9529 1 79 3.40.30.10
4ielA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9527 1 77 3.40.30.10
4kh7A02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9464 86 202 1.20.1050.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9349 1 77 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A537Q271-F1-model_v4 Glutathione S-transferase family protein 0.9729 1 197 GO:0016740
AF-A0A6L5FLF7-F1-model_v4 Glutathione S-transferase 0.9682 1 208 GO:0016740
AF-A0A537R9W3-F1-model_v4 Glutathione S-transferase family protein 0.9637 1 208 GO:0016740
AF-A0A6I7P3E0-F1-model_v4 Glutathione S-transferase family protein 0.9637 1 208 GO:0016740
AF-A0A5B9DMV0-F1-model_v4 Glutathione S-transferase family protein 0.963 2 204 GO:0016740

Map