F306982

General Info

Members Datasets Scaffolds Average Seq Length
200 146 400 160

Family's Representative Sequence

Representative Sequence 3300006237|Ga0097621_100145165|Ga0097621_1001451652
Length 164
Sequence MRRLQKTIEEIGWTKAVPRLGQDERVARAFDLMSREAHDCVLVVESKTSDKLVGIFTSRDFLNRVAAVRGDPASLALGHVMTAGPRTLHPRDGVAFAINWMAVEGFRNVPIVDDVGRVLGVLTIWDVMRALGNVFDEIDATPRTTPLPEEDSGVISMVDIGGGS

Samples

Sample ID Description Type Environment
1 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
85 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
86 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
87 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
90 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
96 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
97 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
102 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
105 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
106 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
107 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
108 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
109 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
110 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
111 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
112 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
113 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
114 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
115 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
116 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
117 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
118 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
119 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
120 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
121 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
122 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
123 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
124 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
125 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
126 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
127 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
128 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
129 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
130 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
131 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
132 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
133 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
134 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
135 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
136 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
137 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
138 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
139 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
140 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
141 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
142 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
143 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
144 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
145 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.5
Nodule 0
Rhizoplane 1
Rhizosphere 77.5
Stem 0
Stem Tuber 0
Unclassified 15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0097621_100145165 3300006237 Bacteria 2031
2 rootL2_10278225 3300003322 Bacteria 1592
3 Ga0070683_100210714 3300005329 Bacteria 1846
4 Ga0070683_100232920 3300005329 Bacteria 1751
5 Ga0070683_100876631 3300005329 Bacteria 861
6 Ga0070690_100002781 3300005330 Bacteria 9446
7 Ga0070690_100277289 3300005330 Bacteria 1195
8 Ga0070670_101220781 3300005331 Unclassified 687
9 Ga0068869_100006857 3300005334 Bacteria 7245
10 Ga0068869_100310677 3300005334 Bacteria 1276
11 Ga0068869_100581457 3300005334 Bacteria 944
12 Ga0068869_100758944 3300005334 Bacteria 831
13 Ga0070680_100673053 3300005336 Bacteria 890
14 Ga0068868_100934815 3300005338 Bacteria 790
15 Ga0070689_100021499 3300005340 Bacteria 4805
16 Ga0070689_100070204 3300005340 Bacteria 2734
17 Ga0070689_100110877 3300005340 Bacteria 2182
18 Ga0070689_100480905 3300005340 Bacteria 1061
19 Ga0070687_100104846 3300005343 Bacteria 1590
20 Ga0070687_100207381 3300005343 Bacteria 1192
21 Ga0070688_100259280 3300005365 Bacteria 1241
22 Ga0070688_100768511 3300005365 Bacteria 751
23 Ga0070710_11072879 3300005437 Bacteria 590
24 Ga0070701_10011372 3300005438 Bacteria 3977
25 Ga0070700_100047499 3300005441 Bacteria 2657
26 Ga0070708_100113353 3300005445 Bacteria 2494
27 Ga0070681_10226155 3300005458 Bacteria 1786
28 Ga0070681_10333223 3300005458 Bacteria 1427
29 Ga0068867_100084733 3300005459 Bacteria 2395
30 Ga0070685_10164185 3300005466 Bacteria 1418
31 Ga0070706_100080833 3300005467 Bacteria 3010
32 Ga0070707_101516166 3300005468 Unclassified 637
33 Ga0070698_100005300 3300005471 Bacteria 14108
34 Ga0070698_100658978 3300005471 Bacteria 988
35 Ga0070679_100171873 3300005530 Bacteria 2140
36 Ga0070684_101224044 3300005535 Unclassified 706
37 Ga0070697_100216371 3300005536 Bacteria 1632
38 Ga0070697_100833372 3300005536 Bacteria 817
39 Ga0070686_101143830 3300005544 Bacteria 644
40 Ga0070695_100215161 3300005545 Bacteria 1381
41 Ga0070696_100480674 3300005546 Bacteria 985
42 Ga0070704_100781297 3300005549 Bacteria 852
43 Ga0068855_100913631 3300005563 Bacteria 927
44 Ga0068857_100376308 3300005577 Bacteria 1318
45 Ga0068856_100013637 3300005614 Bacteria 7863
46 Ga0068856_100595032 3300005614 Unclassified 1127
47 Ga0070702_101016969 3300005615 Bacteria 657
48 Ga0068859_100834883 3300005617 Bacteria 1008
49 Ga0068866_10058169 3300005718 Bacteria 1995
50 Ga0068870_10383195 3300005840 Bacteria 911
51 Ga0068870_11047934 3300005840 Unclassified 584
52 Ga0068863_100044465 3300005841 Bacteria 4216
53 Ga0068863_100054640 3300005841 Bacteria 3783
54 Ga0068862_100962800 3300005844 Bacteria 842
55 Ga0068862_101100217 3300005844 Bacteria 790
56 Ga0081455_10033288 3300005937 Bacteria 4634
57 Ga0070717_10052615 3300006028 Bacteria 3355
58 Ga0070717_10077735 3300006028 Bacteria 2779
59 Ga0070716_101523844 3300006173 Bacteria 547
60 Ga0097621_100355208 3300006237 Bacteria 1304
61 Ga0068871_100637675 3300006358 Unclassified 972
62 Ga0068871_100645392 3300006358 Bacteria 966
63 Ga0075430_100050860 3300006846 Bacteria 3493
64 Ga0075434_101472527 3300006871 Bacteria 690
65 Ga0075429_100028516 3300006880 Bacteria 4847
66 Ga0075429_100069039 3300006880 Bacteria 3076
67 Ga0068865_100052480 3300006881 Bacteria 2826
68 Ga0097620_100834878 3300006931 Bacteria 1008
69 Ga0075435_100403334 3300007076 Bacteria 1176
70 Ga0075435_100742210 3300007076 Bacteria 854
71 Ga0099795_10030271 3300007788 Bacteria 1857
72 Ga0105245_10000008 3300009098 Bacteria 279925
73 Ga0105243_10132989 3300009148 Bacteria 2113
74 Ga0105243_10771208 3300009148 Bacteria 945
75 Ga0105248_11310121 3300009177 Bacteria 819
76 Ga0105237_10558471 3300009545 Unclassified 1151
77 Ga0105249_10058438 3300009553 Bacteria 3535
78 Ga0105239_10096205 3300010375 Bacteria 3271
79 Ga0157374_10838650 3300013296 Unclassified 936
80 Ga0157378_10032584 3300013297 Bacteria 4605
81 Ga0157378_10309375 3300013297 Bacteria 1532
82 Ga0157378_10443345 3300013297 Unclassified 1287
83 Ga0163163_10875830 3300014325 Bacteria 961
84 Ga0163163_11726967 3300014325 Unclassified 686
85 Ga0213874_10192223 3300021377 Bacteria 731
86 Ga0207643_10604123 3300025908 Bacteria 706
87 Ga0207684_10222260 3300025910 Bacteria 1630
88 Ga0207707_10357483 3300025912 Bacteria 1258
89 Ga0207660_11289926 3300025917 Unclassified 593
90 Ga0207662_10092335 3300025918 Bacteria 1864
91 Ga0207662_10270441 3300025918 Bacteria 1121
92 Ga0207662_10358045 3300025918 Bacteria 981
93 Ga0207652_10094778 3300025921 Bacteria 2629
94 Ga0207646_10061607 3300025922 Bacteria 3348
95 Ga0207646_10467895 3300025922 Bacteria 1137
96 Ga0207650_10664530 3300025925 Bacteria 879
97 Ga0207687_10000160 3300025927 Bacteria 45423
98 Ga0207687_10037587 3300025927 Bacteria 3304
99 Ga0207670_10013283 3300025936 Bacteria 4848
100 Ga0207670_10102733 3300025936 Bacteria 2044
101 Ga0207670_10800598 3300025936 Bacteria 785
102 Ga0207704_10043742 3300025938 Bacteria 2647
103 Ga0207711_11021610 3300025941 Unclassified 767
104 Ga0207689_10082784 3300025942 Bacteria 2638
105 Ga0207689_10114815 3300025942 Bacteria 2213
106 Ga0207689_10316709 3300025942 Bacteria 1294
107 Ga0207661_10348864 3300025944 Bacteria 1335
108 Ga0207661_10662943 3300025944 Unclassified 959
109 Ga0207712_10038066 3300025961 Bacteria 3287
110 Ga0207677_10482849 3300026023 Bacteria 1068
111 Ga0207703_10366409 3300026035 Bacteria 1330
112 Ga0207708_10619236 3300026075 Bacteria 919
113 Ga0207702_10050976 3300026078 Bacteria 3496
114 Ga0207702_10440844 3300026078 Bacteria 1262
115 Ga0207641_10053051 3300026088 Bacteria 3435
116 Ga0207641_10096779 3300026088 Bacteria 2593
117 Ga0207648_10382403 3300026089 Bacteria 1273
118 Ga0207674_10245908 3300026116 Bacteria 1736
119 Ga0268266_11543320 3300028379 Bacteria 640
120 Ga0268264_10550812 3300028381 Bacteria 1131
121 Ga0307515_10242292 3300028794 Bacteria 1571
122 Ga0307515_10666959 3300028794 Bacteria 653
123 Ga0307511_10177779 3300030521 Bacteria 1154
124 Ga0265332_10021340 3300031238 Bacteria 2862
125 Ga0307513_10001156 3300031456 Bacteria 38244
126 Ga0307509_10002612 3300031507 Bacteria 28847
127 Ga0307509_10055771 3300031507 Bacteria 4197
128 Ga0307508_10024754 3300031616 Bacteria 5447
129 Ga0307508_10299236 3300031616 Bacteria 1202
130 Ga0307508_10435108 3300031616 Bacteria 904
131 Ga0265314_10107135 3300031711 Unclassified 1784
132 Ga0307516_10038811 3300031730 Bacteria 4749
133 Ga0307516_10110386 3300031730 Bacteria 2554
134 Ga0307413_10770423 3300031824 Unclassified 806
135 Ga0307413_10996862 3300031824 Bacteria 718
136 Ga0307507_10036679 3300033179 Bacteria 5007
137 Ga0373944_0101650 3300035089 Bacteria 972
138 Ga0373949_0000471 3300035090 Bacteria 13794
139 Ga0373936_0000005 3300035113 Bacteria 325848
140 Ga0373941_0302391 3300035115 Bacteria 639
141 Ga0373954_0645642 3300035118 Bacteria 525
142 Ga0373955_0777653 3300035172 Unclassified 588
143 Ga0373961_0000111 3300035241 Bacteria 42397
144 Ga0373937_1250138 3300036401 Unclassified 691
145 Ga0395905_0536572 3300037471 Bacteria 1071
146 Ga0436365_0440341 3300039437 Bacteria 1125
147 Ga0436363_1382989 3300039450 Bacteria 1507
148 Ga0451793_1513123 3300041452 Bacteria 1302
149 Ga0495603_0285367 3300046455 Unclassified 949
150 Ga0495650_0052568 3300046471 Bacteria 1672
151 Ga0495632_0474696 3300046519 Unclassified 541
152 Ga0495658_0231384 3300046683 Unclassified 1159
153 Ga0496114_0638357 3300048917 Bacteria 937
154 Ga0501299_018753 3300049522 Bacteria 1246
155 Ga0501069_0248915 3300049585 Bacteria 1036
156 Ga0501070_0258161 3300049586 Unclassified 1424
157 Ga0501070_0537612 3300049586 Bacteria 936
158 Ga0501207_081838 3300049654 Unclassified 622
159 Ga0501217_340237 3300049661 Unclassified 503
160 Ga0501230_003222 3300049667 Bacteria 2149
161 Ga0501233_011822 3300049668 Bacteria 1742
162 Ga0501236_125265 3300049670 Unclassified 525
163 Ga0501080_0211351 3300049742 Bacteria 1778
164 Ga0501083_0358933 3300049744 Unclassified 947
165 Ga0501267_010951 3300049764 Bacteria 919
166 nmdc:mga09592_14206_c1 3300050508 Bacteria 6498
167 nmdc:mga09592_250862_c1 3300050508 Bacteria 1534
168 nmdc:mga09592_52065_c1 3300050508 Bacteria 3455
169 nmdc:mga0n895_1231715_c1 3300050512 Unclassified 721
170 nmdc:mga0n895_1438836_c1 3300050512 Bacteria 657
171 nmdc:mga0rr50_342215_c1 3300050513 Bacteria 1257
172 nmdc:mga0rr50_489897_c1 3300050513 Bacteria 1044
173 Ga0500578_0194998 3300053086 Bacteria 1242
174 Ga0500647_0079487 3300053091 Bacteria 1573
175 Ga0500583_0070115 3300053092 Bacteria 1675
176 Ga0500651_0140784 3300053093 Bacteria 1454
177 Ga0500566_0002733 3300053094 Bacteria 10515
178 Ga0500566_0018403 3300053094 Bacteria 4102
179 Ga0500566_0069345 3300053094 Bacteria 1981
180 Ga0500566_0103864 3300053094 Bacteria 1554
181 Ga0500640_007023 3300053095 Bacteria 4347
182 Ga0500650_0411638 3300053098 Unclassified 584
183 Ga0500654_051823 3300053099 Bacteria 2200
184 Ga0500554_000189 3300053102 Bacteria 12908
185 Ga0500562_168485 3300053108 Unclassified 595
186 Ga0500572_002972 3300053111 Bacteria 3971
187 Ga0500595_000073 3300053119 Bacteria 70983
188 Ga0500597_006902 3300053120 Bacteria 3809
189 Ga0500614_000338 3300053123 Bacteria 12160
190 Ga0500614_004734 3300053123 Bacteria 2862
191 Ga0500642_0009998 3300053130 Bacteria 3325
192 Ga0500559_0001716 3300053136 Bacteria 12031
193 Ga0500559_0189673 3300053136 Bacteria 969
194 Ga0500564_123096 3300053138 Unclassified 1128
195 Ga0500568_0018218 3300053139 Bacteria 3079
196 Ga0500585_107947 3300053144 Unclassified 1000
197 Ga0500603_001200 3300053150 Bacteria 6019
198 Ga0500622_0096180 3300053156 Bacteria 1464
199 Ga0500630_173729 3300053159 Bacteria 879
200 Ga0501082_0208947 3300060353 Bacteria 1698
201 Ga0097621_100145165
202 rootL2_10278225
203 Ga0070683_100210714
204 Ga0070683_100232920
205 Ga0070683_100876631
206 Ga0070690_100002781
207 Ga0070690_100277289
208 Ga0070670_101220781
209 Ga0068869_100006857
210 Ga0068869_100310677
211 Ga0068869_100581457
212 Ga0068869_100758944
213 Ga0070680_100673053
214 Ga0068868_100934815
215 Ga0070689_100021499
216 Ga0070689_100070204
217 Ga0070689_100110877
218 Ga0070689_100480905
219 Ga0070687_100104846
220 Ga0070687_100207381
221 Ga0070688_100259280
222 Ga0070688_100768511
223 Ga0070710_11072879
224 Ga0070701_10011372
225 Ga0070700_100047499
226 Ga0070708_100113353
227 Ga0070681_10226155
228 Ga0070681_10333223
229 Ga0068867_100084733
230 Ga0070685_10164185
231 Ga0070706_100080833
232 Ga0070707_101516166
233 Ga0070698_100005300
234 Ga0070698_100658978
235 Ga0070679_100171873
236 Ga0070684_101224044
237 Ga0070697_100216371
238 Ga0070697_100833372
239 Ga0070686_101143830
240 Ga0070695_100215161
241 Ga0070696_100480674
242 Ga0070704_100781297
243 Ga0068855_100913631
244 Ga0068857_100376308
245 Ga0068856_100013637
246 Ga0068856_100595032
247 Ga0070702_101016969
248 Ga0068859_100834883
249 Ga0068866_10058169
250 Ga0068870_10383195
251 Ga0068870_11047934
252 Ga0068863_100044465
253 Ga0068863_100054640
254 Ga0068862_100962800
255 Ga0068862_101100217
256 Ga0081455_10033288
257 Ga0070717_10052615
258 Ga0070717_10077735
259 Ga0070716_101523844
260 Ga0097621_100355208
261 Ga0068871_100637675
262 Ga0068871_100645392
263 Ga0075430_100050860
264 Ga0075434_101472527
265 Ga0075429_100028516
266 Ga0075429_100069039
267 Ga0068865_100052480
268 Ga0097620_100834878
269 Ga0075435_100403334
270 Ga0075435_100742210
271 Ga0099795_10030271
272 Ga0105245_10000008
273 Ga0105243_10132989
274 Ga0105243_10771208
275 Ga0105248_11310121
276 Ga0105237_10558471
277 Ga0105249_10058438
278 Ga0105239_10096205
279 Ga0157374_10838650
280 Ga0157378_10032584
281 Ga0157378_10309375
282 Ga0157378_10443345
283 Ga0163163_10875830
284 Ga0163163_11726967
285 Ga0213874_10192223
286 Ga0207643_10604123
287 Ga0207684_10222260
288 Ga0207707_10357483
289 Ga0207660_11289926
290 Ga0207662_10092335
291 Ga0207662_10270441
292 Ga0207662_10358045
293 Ga0207652_10094778
294 Ga0207646_10061607
295 Ga0207646_10467895
296 Ga0207650_10664530
297 Ga0207687_10000160
298 Ga0207687_10037587
299 Ga0207670_10013283
300 Ga0207670_10102733
301 Ga0207670_10800598
302 Ga0207704_10043742
303 Ga0207711_11021610
304 Ga0207689_10082784
305 Ga0207689_10114815
306 Ga0207689_10316709
307 Ga0207661_10348864
308 Ga0207661_10662943
309 Ga0207712_10038066
310 Ga0207677_10482849
311 Ga0207703_10366409
312 Ga0207708_10619236
313 Ga0207702_10050976
314 Ga0207702_10440844
315 Ga0207641_10053051
316 Ga0207641_10096779
317 Ga0207648_10382403
318 Ga0207674_10245908
319 Ga0268266_11543320
320 Ga0268264_10550812
321 Ga0307515_10242292
322 Ga0307515_10666959
323 Ga0307511_10177779
324 Ga0265332_10021340
325 Ga0307513_10001156
326 Ga0307509_10002612
327 Ga0307509_10055771
328 Ga0307508_10024754
329 Ga0307508_10299236
330 Ga0307508_10435108
331 Ga0265314_10107135
332 Ga0307516_10038811
333 Ga0307516_10110386
334 Ga0307413_10770423
335 Ga0307413_10996862
336 Ga0307507_10036679
337 Ga0373944_0101650
338 Ga0373949_0000471
339 Ga0373936_0000005
340 Ga0373941_0302391
341 Ga0373954_0645642
342 Ga0373955_0777653
343 Ga0373961_0000111
344 Ga0373937_1250138
345 Ga0395905_0536572
346 Ga0436365_0440341
347 Ga0436363_1382989
348 Ga0451793_1513123
349 Ga0495603_0285367
350 Ga0495650_0052568
351 Ga0495632_0474696
352 Ga0495658_0231384
353 Ga0496114_0638357
354 Ga0501299_018753
355 Ga0501069_0248915
356 Ga0501070_0258161
357 Ga0501070_0537612
358 Ga0501207_081838
359 Ga0501217_340237
360 Ga0501230_003222
361 Ga0501233_011822
362 Ga0501236_125265
363 Ga0501080_0211351
364 Ga0501083_0358933
365 Ga0501267_010951
366 nmdc:mga09592_14206_c1
367 nmdc:mga09592_250862_c1
368 nmdc:mga09592_52065_c1
369 nmdc:mga0n895_1231715_c1
370 nmdc:mga0n895_1438836_c1
371 nmdc:mga0rr50_342215_c1
372 nmdc:mga0rr50_489897_c1
373 Ga0500578_0194998
374 Ga0500647_0079487
375 Ga0500583_0070115
376 Ga0500651_0140784
377 Ga0500566_0002733
378 Ga0500566_0018403
379 Ga0500566_0069345
380 Ga0500566_0103864
381 Ga0500640_007023
382 Ga0500650_0411638
383 Ga0500654_051823
384 Ga0500554_000189
385 Ga0500562_168485
386 Ga0500572_002972
387 Ga0500595_000073
388 Ga0500597_006902
389 Ga0500614_000338
390 Ga0500614_004734
391 Ga0500642_0009998
392 Ga0500559_0001716
393 Ga0500559_0189673
394 Ga0500564_123096
395 Ga0500568_0018218
396 Ga0500585_107947
397 Ga0500603_001200
398 Ga0500622_0096180
399 Ga0500630_173729
400 Ga0501082_0208947

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

77

133

0.95

PF00571

CBS

CBS domain

14

67

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghd-assembly1.cif.gz_A crystal structure of a cystathionine beta-synthase domain protein fused to a zn-ribbon-like domain 0.9294 16 82
4fry-assembly1.cif.gz_A the structure of a putative signal-transduction protein with cbs domains from burkholderia ambifaria mc40-6 0.9271 6 128
2yzi-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from pyrococcus horikoshii 0.9137 4 128
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9073 6 129
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.9069 6 129
ID Description Score Start End Superfamily
af_A0A1D6Q1S7_52_188_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.929 1 126 3.10.580.10
4fryA00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9271 6 128 3.10.580.10
af_C0PHI9_226_352_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9258 7 130 3.10.580.10
4dmgB01 Mainly Beta;Roll;Archaeosine Trna-guanine Transglycosylase; Chain: A, domain 4;PUA domain 0.9197 105 118 2.30.130.10
2rc3D00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9069 6 129 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A3R7K346-F1-model_v4 CBS domain-containing protein 0.949 6 130
AF-A0A845JRS1-F1-model_v4 CBS domain-containing protein 0.9459 6 128
AF-A0A1F4BDG7-F1-model_v4 CBS domain-containing protein 0.9458 17 133
AF-A0A4Y8I6D0-F1-model_v4 CBS domain-containing protein 0.9442 3 130
AF-A0A7G9NWQ9-F1-model_v4 CBS domain-containing protein 0.9378 6 133

Map