F306188

General Info

Members Datasets Scaffolds Average Seq Length
199 133 199 104

Family's Representative Sequence

Representative Sequence 3300046476|Ga0495662_0231071|Ga0495662_0231071_225_629
Length 119
Sequence MELLNRQTVEPSLKKMKRYEGLFILETSGKEEGIKEAIDKISAEITSAGGKVETVQKMDKRNFARVANKKHSSGQYVNVIFESEPSVLDQLKHRFAMNADVFRVMFTTAPAPKEIASKP

Samples

Sample ID Description Type Environment
1 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
40 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
54 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
59 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
76 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
79 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
84 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
91 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
92 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
93 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
94 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
95 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
96 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
97 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
103 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
106 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
109 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
110 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
111 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
112 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
113 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
114 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
115 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
116 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
117 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
118 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
119 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
129 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
130 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 2.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.51
Rhizosphere 96.48
Stem 0
Stem Tuber 0
Unclassified 2.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006759J45824_1142531 3300003163 Bacteria 848
2 Ga0058859_10126229 3300004798 Bacteria 1247
3 Ga0058859_11236774 3300004798 Bacteria 592
4 Ga0058860_10896556 3300004801 Unclassified 898
5 Ga0058860_12111173 3300004801 Bacteria 1154
6 Ga0070690_100246582 3300005330 Bacteria 1262
7 Ga0070690_100249996 3300005330 Bacteria 1254
8 Ga0070690_100451959 3300005330 Unclassified 953
9 Ga0068869_100238722 3300005334 Unclassified 1447
10 Ga0068868_100255790 3300005338 Bacteria 1475
11 Ga0070689_100027640 3300005340 Bacteria 4278
12 Ga0070689_100045673 3300005340 Bacteria 3373
13 Ga0070689_100171922 3300005340 Unclassified 1756
14 Ga0070689_100261292 3300005340 Bacteria 1431
15 Ga0070689_101804144 3300005340 Bacteria 558
16 Ga0070675_100830721 3300005354 Bacteria 845
17 Ga0070688_100209947 3300005365 Unclassified 1366
18 Ga0070688_101776436 3300005365 Unclassified 506
19 Ga0070714_100119185 3300005435 Unclassified 2346
20 Ga0070701_10440175 3300005438 Bacteria 834
21 Ga0070705_100749515 3300005440 Unclassified 772
22 Ga0070705_101263289 3300005440 Unclassified 611
23 Ga0070694_101726432 3300005444 Bacteria 533
24 Ga0070708_100004509 3300005445 Bacteria 10958
25 Ga0070681_10531629 3300005458 Bacteria 1089
26 Ga0068867_102166306 3300005459 Unclassified 527
27 Ga0070685_10396262 3300005466 Unclassified 955
28 Ga0070698_100687050 3300005471 Unclassified 965
29 Ga0070679_100387856 3300005530 Bacteria 1343
30 Ga0070684_101218211 3300005535 Bacteria 708
31 Ga0070684_101543479 3300005535 Bacteria 626
32 Ga0070686_100132987 3300005544 Unclassified 1722
33 Ga0070686_101489243 3300005544 Bacteria 570
34 Ga0070695_101290320 3300005545 Unclassified 603
35 Ga0070693_100715490 3300005547 Unclassified 734
36 Ga0070693_101676964 3300005547 Unclassified 501
37 Ga0068855_100385728 3300005563 Bacteria 1538
38 Ga0068857_100001576 3300005577 Bacteria 18267
39 Ga0070702_100138510 3300005615 Bacteria 1547
40 Ga0070702_100231280 3300005615 Bacteria 1242
41 Ga0068859_101577141 3300005617 Bacteria 725
42 Ga0068859_102270186 3300005617 Unclassified 598
43 Ga0068864_100013050 3300005618 Bacteria 6881
44 Ga0068870_11381122 3300005840 Unclassified 515
45 Ga0068863_100024113 3300005841 Bacteria 5804
46 Ga0081539_10221816 3300005985 Unclassified 859
47 Ga0070717_11224450 3300006028 Unclassified 683
48 Ga0070712_100471669 3300006175 Bacteria 1048
49 Ga0097621_100008410 3300006237 Bacteria 7430
50 Ga0097621_101732720 3300006237 Unclassified 595
51 Ga0068871_100277149 3300006358 Bacteria 1466
52 Ga0068871_101673140 3300006358 Bacteria 603
53 Ga0068871_102297860 3300006358 Bacteria 514
54 Ga0075428_100134726 3300006844 Unclassified 2686
55 Ga0075430_100449428 3300006846 Unclassified 1063
56 Ga0075431_100405146 3300006847 Unclassified 1365
57 Ga0075431_102104300 3300006847 Unclassified 519
58 Ga0075433_10107994 3300006852 Unclassified 2468
59 Ga0075429_101421561 3300006880 Bacteria 604
60 Ga0075429_101490375 3300006880 Bacteria 589
61 Ga0075436_101154759 3300006914 Bacteria 584
62 Ga0097620_101576868 3300006931 Bacteria 725
63 Ga0097620_102270189 3300006931 Unclassified 598
64 Ga0099795_10036127 3300007788 Bacteria 1732
65 Ga0105240_10042437 3300009093 Bacteria 5796
66 Ga0105240_10119169 3300009093 Bacteria 3180
67 Ga0105240_10326039 3300009093 Bacteria 1749
68 Ga0111539_10098970 3300009094 Unclassified 3425
69 Ga0111539_10639009 3300009094 Bacteria 1239
70 Ga0111539_10984242 3300009094 Bacteria 981
71 Ga0105245_10051536 3300009098 Unclassified 3689
72 Ga0105245_11511010 3300009098 Unclassified 723
73 Ga0105245_13133063 3300009098 Bacteria 512
74 Ga0105241_10636517 3300009174 Bacteria 967
75 Ga0105242_10796295 3300009176 Unclassified 935
76 Ga0105237_11372475 3300009545 Bacteria 713
77 Ga0099796_10140447 3300010159 Unclassified 944
78 Ga0105239_12561074 3300010375 Unclassified 595
79 Ga0157373_10724823 3300013100 Unclassified 730
80 Ga0157371_10738465 3300013102 Unclassified 739
81 Ga0157370_10020139 3300013104 Bacteria 6668
82 Ga0157374_10834059 3300013296 Unclassified 938
83 Ga0157374_10905329 3300013296 Bacteria 900
84 Ga0157374_11917835 3300013296 Bacteria 618
85 Ga0157378_12788666 3300013297 Bacteria 541
86 Ga0157378_13302180 3300013297 Bacteria 501
87 Ga0163162_13189386 3300013306 Unclassified 526
88 Ga0163163_10635905 3300014325 Unclassified 1130
89 Ga0157380_10406103 3300014326 Bacteria 1294
90 Ga0157377_11605336 3300014745 Bacteria 521
91 Ga0157376_10257788 3300014969 Bacteria 1632
92 Ga0157376_10704118 3300014969 Bacteria 1015
93 Ga0157376_13075281 3300014969 Unclassified 505
94 Ga0207684_10462781 3300025910 Bacteria 1088
95 Ga0207695_10137333 3300025913 Bacteria 2397
96 Ga0207660_10897209 3300025917 Bacteria 723
97 Ga0207662_10204212 3300025918 Bacteria 1280
98 Ga0207681_11113380 3300025923 Bacteria 663
99 Ga0207664_10037743 3300025929 Bacteria 3742
100 Ga0207664_11900918 3300025929 Bacteria 518
101 Ga0207686_10626760 3300025934 Bacteria 849
102 Ga0207686_11037642 3300025934 Unclassified 666
103 Ga0207670_10017648 3300025936 Bacteria 4317
104 Ga0207670_10137662 3300025936 Bacteria 1797
105 Ga0207670_10529170 3300025936 Unclassified 961
106 Ga0207639_10338862 3300026041 Unclassified 1340
107 Ga0207708_11006717 3300026075 Bacteria 724
108 Ga0207708_11289756 3300026075 Unclassified 640
109 Ga0207708_11741928 3300026075 Unclassified 547
110 Ga0207702_11642891 3300026078 Unclassified 636
111 Ga0207676_10169383 3300026095 Bacteria 1901
112 Ga0207674_10012192 3300026116 Bacteria 9616
113 Ga0207674_11899079 3300026116 Unclassified 562
114 Ga0207428_10697288 3300027907 Bacteria 726
115 Ga0265323_10114694 3300028653 Viruses 882
116 Ga0265338_10024378 3300028800 Bacteria 6181
117 Ga0265340_10029467 3300031247 Unclassified 2756
118 Ga0373926_0191560 3300035083 Bacteria 786
119 Ga0373954_0074919 3300035118 Unclassified 1611
120 Ga0373956_0075754 3300035119 Unclassified 1539
121 Ga0373931_0808474 3300035691 Bacteria 625
122 Ga0373935_0265799 3300035692 Bacteria 1204
123 Ga0373947_0056289 3300035725 Bacteria 2377
124 Ga0373947_0079143 3300035725 Unclassified 2031
125 Ga0373937_0137806 3300036401 Bacteria 2282
126 Ga0373925_1246388 3300037068 Bacteria 611
127 Ga0453684_0798742 3300044712 Bacteria 1018
128 Ga0451576_0198747 3300045051 Bacteria 2094
129 Ga0451576_0319722 3300045051 Bacteria 1624
130 Ga0451576_0631031 3300045051 Bacteria 1126
131 Ga0451576_1770000 3300045051 Unclassified 639
132 Ga0495592_0043302 3300046454 Bacteria 3368
133 Ga0495592_0230910 3300046454 Bacteria 1232
134 Ga0495603_0111467 3300046455 Bacteria 1596
135 Ga0495629_0673437 3300046459 Bacteria 688
136 Ga0495641_0016162 3300046461 Unclassified 3941
137 Ga0495651_0494406 3300046462 Unclassified 784
138 Ga0495651_0621451 3300046462 Bacteria 680
139 Ga0495582_0016761 3300046473 Unclassified 4013
140 Ga0495582_0092493 3300046473 Bacteria 1687
141 Ga0495639_0092167 3300046475 Bacteria 1423
142 Ga0495662_0025426 3300046476 Unclassified 2859
143 Ga0495662_0231071 3300046476 Unclassified 912
144 Ga0495664_0784801 3300046477 Unclassified 560
145 Ga0495618_0456358 3300046514 Unclassified 775
146 Ga0495628_0074173 3300046516 Bacteria 2651
147 Ga0495628_0554003 3300046516 Unclassified 825
148 Ga0495630_0000210 3300046517 Bacteria 46241
149 Ga0495666_0026986 3300046526 Unclassified 2827
150 Ga0495640_0060462 3300046533 Bacteria 2577
151 Ga0495640_0314394 3300046533 Bacteria 971
152 Ga0495586_0000094 3300046535 Bacteria 54446
153 Ga0495586_0006642 3300046535 Bacteria 6177
154 Ga0495586_0093790 3300046535 Bacteria 1660
155 Ga0495587_0411140 3300046536 Unclassified 751
156 Ga0495645_0341213 3300046543 Unclassified 967
157 Ga0495645_0563835 3300046543 Unclassified 704
158 Ga0495622_0030795 3300046557 Bacteria 2508
159 Ga0495634_0047568 3300046642 Bacteria 2890
160 Ga0495634_0056022 3300046642 Unclassified 2635
161 Ga0495634_0311637 3300046642 Unclassified 949
162 Ga0495634_0821404 3300046642 Bacteria 529
163 Ga0495635_0560123 3300046663 Unclassified 749
164 Ga0495599_0043817 3300046678 Unclassified 2808
165 Ga0495599_0087617 3300046678 Bacteria 1943
166 Ga0495647_0009441 3300046681 Bacteria 3306
167 Ga0495647_0023701 3300046681 Bacteria 2228
168 Ga0495658_0173176 3300046683 Bacteria 1336
169 Ga0495658_0183021 3300046683 Bacteria 1300
170 Ga0495613_0032003 3300046689 Unclassified 3907
171 Ga0495624_0052061 3300046690 Unclassified 2589
172 Ga0495624_0149682 3300046690 Bacteria 1428
173 Ga0495604_0622908 3300047317 Unclassified 690
174 Ga0495674_0002905 3300047319 Bacteria 16677
175 Ga0495674_0137086 3300047319 Bacteria 2058
176 Ga0495676_0539442 3300047321 Unclassified 763
177 Ga0495676_0659809 3300047321 Bacteria 678
178 Ga0495675_0433581 3300047444 Bacteria 762
179 Ga0495684_0141756 3300047471 Bacteria 1802
180 Ga0495684_0390758 3300047471 Unclassified 979
181 Ga0495684_0439091 3300047471 Unclassified 909
182 Ga0495614_0074722 3300048089 Bacteria 1464
183 Ga0496112_0376096 3300048915 Bacteria 1362
184 Ga0496115_0018964 3300048918 Bacteria 5291
185 Ga0496115_1363988 3300048918 Unclassified 525
186 Ga0501032_0872830 3300049569 Viruses 567
187 Ga0501043_0655376 3300049579 Bacteria 771
188 Ga0501047_0263179 3300049581 Viruses 1572
189 Ga0501035_0060999 3300049822 Bacteria 3357
190 Ga0501044_1158642 3300049823 Viruses 641
191 nmdc:mga09592_1614695_c1 3300050508 Unclassified 525
192 nmdc:mga0qj67_462134_c1 3300050509 Unclassified 1022
193 nmdc:mga06r32_424727_c1 3300050510 Bacteria 1310
194 nmdc:mga08y16_1088757_c1 3300050511 Bacteria 775
195 nmdc:mga08y16_82519_c1 3300050511 Unclassified 3351
196 nmdc:mga0rr50_238993_c1 3300050513 Bacteria 1505
197 nmdc:mga0rr50_714421_c1 3300050513 Bacteria 855
198 nmdc:mga0a205_429797_c1 3300050515 Bacteria 1182
199 Ga0495601_0772959 3300053077 Unclassified 610

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300004798 Ga0058859_11236774 Ga0058859_112367741 95
2 3300005330 Ga0070690_100451959 Ga0070690_1004519591 95
3 3300046533 Ga0495640_0314394 Ga0495640_0314394_17_313 95
4 3300050513 nmdc:mga0rr50_714421_c1 nmdc:mga0rr50_714421_c1_462_755 95
5 3300003163 Ga0006759J45824_1142531 Ga0006759J45824_11425311 101
6 3300004798 Ga0058859_10126229 Ga0058859_101262292 101
7 3300004801 Ga0058860_10896556 Ga0058860_108965562 101
8 3300004801 Ga0058860_12111173 Ga0058860_121111732 101
9 3300005330 Ga0070690_100246582 Ga0070690_1002465822 101
10 3300005330 Ga0070690_100249996 Ga0070690_1002499962 101
11 3300005334 Ga0068869_100238722 Ga0068869_1002387223 101
12 3300005338 Ga0068868_100255790 Ga0068868_1002557902 101
13 3300005340 Ga0070689_100027640 Ga0070689_1000276406 101
14 3300005340 Ga0070689_100045673 Ga0070689_1000456733 101
15 3300005340 Ga0070689_100171922 Ga0070689_1001719222 101
16 3300005340 Ga0070689_100261292 Ga0070689_1002612923 101
17 3300005340 Ga0070689_101804144 Ga0070689_1018041442 101
18 3300005354 Ga0070675_100830721 Ga0070675_1008307211 101
19 3300005365 Ga0070688_100209947 Ga0070688_1002099473 101
20 3300005365 Ga0070688_101776436 Ga0070688_1017764361 101
21 3300005435 Ga0070714_100119185 Ga0070714_1001191853 101
22 3300005438 Ga0070701_10440175 Ga0070701_104401752 101
23 3300005440 Ga0070705_100749515 Ga0070705_1007495152 101
24 3300005440 Ga0070705_101263289 Ga0070705_1012632892 101
25 3300005444 Ga0070694_101726432 Ga0070694_1017264322 101
26 3300005445 Ga0070708_100004509 Ga0070708_1000045099 101
27 3300005458 Ga0070681_10531629 Ga0070681_105316292 101
28 3300005459 Ga0068867_102166306 Ga0068867_1021663061 101
29 3300005466 Ga0070685_10396262 Ga0070685_103962622 101
30 3300005471 Ga0070698_100687050 Ga0070698_1006870502 101
31 3300005530 Ga0070679_100387856 Ga0070679_1003878562 101
32 3300005535 Ga0070684_101218211 Ga0070684_1012182112 101
33 3300005535 Ga0070684_101543479 Ga0070684_1015434791 101
34 3300005544 Ga0070686_100132987 Ga0070686_1001329873 101
35 3300005544 Ga0070686_101489243 Ga0070686_1014892431 101
36 3300005545 Ga0070695_101290320 Ga0070695_1012903202 101
37 3300005547 Ga0070693_100715490 Ga0070693_1007154902 101
38 3300005547 Ga0070693_101676964 Ga0070693_1016769641 101
39 3300005563 Ga0068855_100385728 Ga0068855_1003857283 101
40 3300005577 Ga0068857_100001576 Ga0068857_10000157616 101
41 3300005615 Ga0070702_100138510 Ga0070702_1001385103 101
42 3300005615 Ga0070702_100231280 Ga0070702_1002312802 101
43 3300005617 Ga0068859_101577141 Ga0068859_1015771412 101
44 3300005617 Ga0068859_102270186 Ga0068859_1022701862 101
45 3300005618 Ga0068864_100013050 Ga0068864_1000130504 101
46 3300005840 Ga0068870_11381122 Ga0068870_113811222 101
47 3300005841 Ga0068863_100024113 Ga0068863_1000241135 101
48 3300005985 Ga0081539_10221816 Ga0081539_102218162 101
49 3300006028 Ga0070717_11224450 Ga0070717_112244502 101
50 3300006175 Ga0070712_100471669 Ga0070712_1004716692 101
51 3300006237 Ga0097621_100008410 Ga0097621_1000084106 101
52 3300006237 Ga0097621_101732720 Ga0097621_1017327201 101
53 3300006358 Ga0068871_100277149 Ga0068871_1002771492 101
54 3300006358 Ga0068871_101673140 Ga0068871_1016731402 101
55 3300006358 Ga0068871_102297860 Ga0068871_1022978602 101
56 3300006844 Ga0075428_100134726 Ga0075428_1001347264 101
57 3300006846 Ga0075430_100449428 Ga0075430_1004494282 101
58 3300006847 Ga0075431_100405146 Ga0075431_1004051463 101
59 3300006847 Ga0075431_102104300 Ga0075431_1021043001 101
60 3300006852 Ga0075433_10107994 Ga0075433_101079942 101
61 3300006880 Ga0075429_101421561 Ga0075429_1014215612 101
62 3300006880 Ga0075429_101490375 Ga0075429_1014903752 101
63 3300006914 Ga0075436_101154759 Ga0075436_1011547592 101
64 3300006931 Ga0097620_101576868 Ga0097620_1015768682 101
65 3300006931 Ga0097620_102270189 Ga0097620_1022701892 101
66 3300007788 Ga0099795_10036127 Ga0099795_100361273 101
67 3300009093 Ga0105240_10042437 Ga0105240_100424372 101
68 3300009093 Ga0105240_10119169 Ga0105240_101191694 101
69 3300009093 Ga0105240_10326039 Ga0105240_103260391 101
70 3300009094 Ga0111539_10098970 Ga0111539_100989702 101
71 3300009094 Ga0111539_10639009 Ga0111539_106390092 101
72 3300009094 Ga0111539_10984242 Ga0111539_109842422 101
73 3300009098 Ga0105245_10051536 Ga0105245_100515363 101
74 3300009098 Ga0105245_11511010 Ga0105245_115110102 101
75 3300009098 Ga0105245_13133063 Ga0105245_131330631 101
76 3300009174 Ga0105241_10636517 Ga0105241_106365172 101
77 3300009176 Ga0105242_10796295 Ga0105242_107962951 101
78 3300009545 Ga0105237_11372475 Ga0105237_113724752 101
79 3300010159 Ga0099796_10140447 Ga0099796_101404472 101
80 3300010375 Ga0105239_12561074 Ga0105239_125610742 101
81 3300013100 Ga0157373_10724823 Ga0157373_107248232 101
82 3300013102 Ga0157371_10738465 Ga0157371_107384652 101
83 3300013104 Ga0157370_10020139 Ga0157370_100201396 101
84 3300013296 Ga0157374_10834059 Ga0157374_108340592 101
85 3300013296 Ga0157374_10905329 Ga0157374_109053292 101
86 3300013296 Ga0157374_11917835 Ga0157374_119178352 101
87 3300013297 Ga0157378_12788666 Ga0157378_127886661 101
88 3300013297 Ga0157378_13302180 Ga0157378_133021801 101
89 3300013306 Ga0163162_13189386 Ga0163162_131893862 101
90 3300014325 Ga0163163_10635905 Ga0163163_106359052 101
91 3300014326 Ga0157380_10406103 Ga0157380_104061033 101
92 3300014745 Ga0157377_11605336 Ga0157377_116053362 101
93 3300014969 Ga0157376_10257788 Ga0157376_102577882 101
94 3300014969 Ga0157376_10704118 Ga0157376_107041182 101
95 3300014969 Ga0157376_13075281 Ga0157376_130752811 101
96 3300025910 Ga0207684_10462781 Ga0207684_104627813 101
97 3300025913 Ga0207695_10137333 Ga0207695_101373334 101
98 3300025917 Ga0207660_10897209 Ga0207660_108972092 101
99 3300025918 Ga0207662_10204212 Ga0207662_102042122 101
100 3300025923 Ga0207681_11113380 Ga0207681_111133802 101
101 3300025929 Ga0207664_10037743 Ga0207664_100377436 101
102 3300025929 Ga0207664_11900918 Ga0207664_119009181 101
103 3300025934 Ga0207686_10626760 Ga0207686_106267601 101
104 3300025934 Ga0207686_11037642 Ga0207686_110376422 101
105 3300025936 Ga0207670_10017648 Ga0207670_100176485 101
106 3300025936 Ga0207670_10137662 Ga0207670_101376622 101
107 3300025936 Ga0207670_10529170 Ga0207670_105291702 101
108 3300026041 Ga0207639_10338862 Ga0207639_103388622 101
109 3300026075 Ga0207708_11006717 Ga0207708_110067172 101
110 3300026075 Ga0207708_11289756 Ga0207708_112897561 101
111 3300026075 Ga0207708_11741928 Ga0207708_117419282 101
112 3300026078 Ga0207702_11642891 Ga0207702_116428912 101
113 3300026095 Ga0207676_10169383 Ga0207676_101693833 101
114 3300026116 Ga0207674_10012192 Ga0207674_100121926 101
115 3300026116 Ga0207674_11899079 Ga0207674_118990792 101
116 3300027907 Ga0207428_10697288 Ga0207428_106972882 101
117 3300028653 Ga0265323_10114694 Ga0265323_101146942 101
118 3300028800 Ga0265338_10024378 Ga0265338_100243787 101
119 3300031247 Ga0265340_10029467 Ga0265340_100294674 101
120 3300035083 Ga0373926_0191560 Ga0373926_0191560_226_537 101
121 3300035118 Ga0373954_0074919 Ga0373954_0074919_331_642 101
122 3300035119 Ga0373956_0075754 Ga0373956_0075754_662_973 101
123 3300035691 Ga0373931_0808474 Ga0373931_0808474_98_406 101
124 3300035692 Ga0373935_0265799 Ga0373935_0265799_205_534 101
125 3300035725 Ga0373947_0056289 Ga0373947_0056289_1142_1453 101
126 3300035725 Ga0373947_0079143 Ga0373947_0079143_707_1036 101
127 3300036401 Ga0373937_0137806 Ga0373937_0137806_1754_2065 101
128 3300037068 Ga0373925_1246388 Ga0373925_1246388_87_392 101
129 3300044712 Ga0453684_0798742 Ga0453684_0798742_633_938 101
130 3300045051 Ga0451576_0198747 Ga0451576_0198747_1101_1409 101
131 3300045051 Ga0451576_0319722 Ga0451576_0319722_995_1309 101
132 3300045051 Ga0451576_0631031 Ga0451576_0631031_694_1008 101
133 3300045051 Ga0451576_1770000 Ga0451576_1770000_38_349 101
134 3300046454 Ga0495592_0043302 Ga0495592_0043302_2834_3145 101
135 3300046454 Ga0495592_0230910 Ga0495592_0230910_379_690 101
136 3300046455 Ga0495603_0111467 Ga0495603_0111467_437_751 101
137 3300046459 Ga0495629_0673437 Ga0495629_0673437_321_650 101
138 3300046461 Ga0495641_0016162 Ga0495641_0016162_674_988 101
139 3300046462 Ga0495651_0494406 Ga0495651_0494406_348_659 101
140 3300046462 Ga0495651_0621451 Ga0495651_0621451_143_454 101
141 3300046473 Ga0495582_0016761 Ga0495582_0016761_1475_1804 101
142 3300046473 Ga0495582_0092493 Ga0495582_0092493_287_601 101
143 3300046475 Ga0495639_0092167 Ga0495639_0092167_1076_1390 101
144 3300046476 Ga0495662_0025426 Ga0495662_0025426_495_824 101
145 3300046476 Ga0495662_0231071 Ga0495662_0231071_225_629 101
146 3300046477 Ga0495664_0784801 Ga0495664_0784801_70_471 101
147 3300046514 Ga0495618_0456358 Ga0495618_0456358_426_740 101
148 3300046516 Ga0495628_0074173 Ga0495628_0074173_1790_2101 101
149 3300046516 Ga0495628_0554003 Ga0495628_0554003_306_617 101
150 3300046517 Ga0495630_0000210 Ga0495630_0000210_14576_14905 101
151 3300046526 Ga0495666_0026986 Ga0495666_0026986_1297_1626 101
152 3300046533 Ga0495640_0060462 Ga0495640_0060462_2085_2414 101
153 3300046535 Ga0495586_0000094 Ga0495586_0000094_14576_14905 101
154 3300046535 Ga0495586_0006642 Ga0495586_0006642_2951_3265 101
155 3300046535 Ga0495586_0093790 Ga0495586_0093790_566_877 101
156 3300046536 Ga0495587_0411140 Ga0495587_0411140_198_509 101
157 3300046543 Ga0495645_0341213 Ga0495645_0341213_134_445 101
158 3300046543 Ga0495645_0563835 Ga0495645_0563835_267_578 101
159 3300046557 Ga0495622_0030795 Ga0495622_0030795_2107_2421 101
160 3300046642 Ga0495634_0047568 Ga0495634_0047568_2399_2710 101
161 3300046642 Ga0495634_0056022 Ga0495634_0056022_523_852 101
162 3300046642 Ga0495634_0311637 Ga0495634_0311637_458_772 101
163 3300046642 Ga0495634_0821404 Ga0495634_0821404_107_418 101
164 3300046663 Ga0495635_0560123 Ga0495635_0560123_270_671 101
165 3300046678 Ga0495599_0043817 Ga0495599_0043817_2035_2349 101
166 3300046678 Ga0495599_0087617 Ga0495599_0087617_225_536 101
167 3300046681 Ga0495647_0009441 Ga0495647_0009441_2426_2755 101
168 3300046681 Ga0495647_0023701 Ga0495647_0023701_1363_1677 101
169 3300046683 Ga0495658_0173176 Ga0495658_0173176_208_522 101
170 3300046683 Ga0495658_0183021 Ga0495658_0183021_220_549 101
171 3300046689 Ga0495613_0032003 Ga0495613_0032003_388_702 101
172 3300046690 Ga0495624_0052061 Ga0495624_0052061_705_1019 101
173 3300046690 Ga0495624_0149682 Ga0495624_0149682_273_584 101
174 3300047317 Ga0495604_0622908 Ga0495604_0622908_186_497 101
175 3300047319 Ga0495674_0002905 Ga0495674_0002905_2698_3027 101
176 3300047319 Ga0495674_0137086 Ga0495674_0137086_1338_1649 101
177 3300047321 Ga0495676_0539442 Ga0495676_0539442_394_708 101
178 3300047321 Ga0495676_0659809 Ga0495676_0659809_271_600 101
179 3300047444 Ga0495675_0433581 Ga0495675_0433581_133_444 101
180 3300047471 Ga0495684_0141756 Ga0495684_0141756_45_353 101
181 3300047471 Ga0495684_0390758 Ga0495684_0390758_493_804 101
182 3300047471 Ga0495684_0439091 Ga0495684_0439091_311_622 101
183 3300048089 Ga0495614_0074722 Ga0495614_0074722_567_896 101
184 3300048915 Ga0496112_0376096 Ga0496112_0376096_493_804 101
185 3300048918 Ga0496115_0018964 Ga0496115_0018964_1060_1365 101
186 3300048918 Ga0496115_1363988 Ga0496115_1363988_17_328 101
187 3300049569 Ga0501032_0872830 Ga0501032_0872830_111_416 101
188 3300049579 Ga0501043_0655376 Ga0501043_0655376_100_405 101
189 3300049581 Ga0501047_0263179 Ga0501047_0263179_273_578 101
190 3300049822 Ga0501035_0060999 Ga0501035_0060999_787_1092 101
191 3300049823 Ga0501044_1158642 Ga0501044_1158642_101_406 101
192 3300050508 nmdc:mga09592_1614695_c1 nmdc:mga09592_1614695_c1_110_436 101
193 3300050509 nmdc:mga0qj67_462134_c1 nmdc:mga0qj67_462134_c1_93_419 101
194 3300050510 nmdc:mga06r32_424727_c1 nmdc:mga06r32_424727_c1_868_1194 101
195 3300050511 nmdc:mga08y16_1088757_c1 nmdc:mga08y16_1088757_c1_127_453 101
196 3300050511 nmdc:mga08y16_82519_c1 nmdc:mga08y16_82519_c1_2392_2709 101
197 3300050513 nmdc:mga0rr50_238993_c1 nmdc:mga0rr50_238993_c1_503_817 101
198 3300050515 nmdc:mga0a205_429797_c1 nmdc:mga0a205_429797_c1_124_450 101
199 3300053077 Ga0495601_0772959 Ga0495601_0772959_26_337 101

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01250

Ribosomal_S6

Ribosomal protein S6

18

108

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bxj-assembly2.cif.gz_B double mutant of the ribosomal protein s6 0.916 1 96
2bvz-assembly1.cif.gz_A mutant of the ribosomal protein s6 0.9159 1 95
1lou-assembly1.cif.gz_A ribosomal protein s6 0.9127 1 95
7nql-assembly1.cif.gz_AF 55s mammalian mitochondrial ribosome with ict1 and p site trnamet 0.909 3 95
8csr-assembly1.cif.gz_E human mitochondrial small subunit assembly intermediate (state c) 0.9069 3 95
ID Description Score Start End Superfamily
af_F1M6D0_1_124_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9139 1 95 3.30.70.60
af_Q8I2J0_124_224_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.9008 1 94 3.30.70.60
2j5aA00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8945 2 98 3.30.70.60
af_I1MGC0_138_240_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8939 2 94 3.30.70.60
af_Q9VZD5_1_134_3.30.70.60 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Ribosomal protein S6/Translation elongation factor EF1B 0.8936 1 99 3.30.70.60
ID Description Score Start End GO Terms
AF-A0A2V6FEL0-F1-model_v4 Small ribosomal subunit protein bS6 0.9643 2 100 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A7C3DYE0-F1-model_v4 Small ribosomal subunit protein bS6 0.9631 2 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A2T6DLJ6-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9625 3 99 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A2V5MUS9-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9576 2 101 GO:0003735
GO:0005840
GO:0006412
GO:0019843
AF-A0A353E0T8-F1-model_v4 Small ribosomal subunit protein bS6 (30S ribosomal protein S6) 0.9505 1 94 GO:0003735
GO:0005840
GO:0006412
GO:0019843

Feature Viewer

pLDDT pTM Quality
84.32 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map