F305692

General Info

Members Datasets Scaffolds Average Seq Length
199 145 398 92

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10269911|Ga0099794_102699111
Length 103
Sequence LSHALLHSISVIKSFRHAGLKRLYERGDRRRLVAEHVPKIARVLAQLDIATDANDMDLPGFHLHPLTGNLAGFWSVTIRANWRIIFRFDAHGDATDVDYVDYH

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
5 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
6 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
7 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
8 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
9 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
17 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
22 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
23 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
28 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
29 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
33 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
41 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
42 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
47 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
66 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
67 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
68 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
69 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
70 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
81 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
82 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
83 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
89 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
90 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
91 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
92 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
93 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
94 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
95 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
96 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
97 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
107 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
108 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
109 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
110 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
111 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
112 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
113 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
114 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
117 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
118 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
119 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
137 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
138 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
139 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
140 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
141 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
142 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
143 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
144 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
145 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.49
Metatranscriptomes 2.01
Isolates 0.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 0
Rhizosphere 85.93
Stem 0
Stem Tuber 0
Unclassified 19.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10269911 3300007265 Bacteria 879
2 rootH1_10169374 3300003323 Bacteria 1288
3 Ga0065707_10325163 3300005295 Bacteria 959
4 Ga0070713_100170661 3300005436 Bacteria 1949
5 Ga0070713_101598064 3300005436 Bacteria 633
6 Ga0070681_11757543 3300005458 Unclassified 547
7 Ga0070706_100149422 3300005467 Bacteria 2181
8 Ga0070707_100000371 3300005468 Bacteria 44319
9 Ga0070698_100298800 3300005471 Bacteria 1541
10 Ga0070699_100819089 3300005518 Bacteria 852
11 Ga0070679_100295870 3300005530 Bacteria 1570
12 Ga0068853_100171947 3300005539 Bacteria 1961
13 Ga0068853_100476052 3300005539 Unclassified 1177
14 Ga0068855_100637100 3300005563 Bacteria 1146
15 Ga0068855_101013683 3300005563 Bacteria 872
16 Ga0068855_101467695 3300005563 Unclassified 701
17 Ga0068854_100210862 3300005578 Bacteria 1532
18 Ga0068856_100639022 3300005614 Bacteria 1085
19 Ga0068856_102138389 3300005614 Bacteria 569
20 Ga0068852_101550869 3300005616 Bacteria 685
21 Ga0068858_100017356 3300005842 Bacteria 6751
22 Ga0081540_1325525 3300005983 Unclassified 527
23 Ga0075428_100122198 3300006844 Bacteria 2835
24 Ga0075428_100768933 3300006844 Bacteria 1024
25 Ga0075430_100329794 3300006846 Bacteria 1261
26 Ga0075430_100335391 3300006846 Bacteria 1249
27 Ga0075431_100530061 3300006847 Bacteria 1166
28 Ga0075434_101105533 3300006871 Bacteria 806
29 Ga0075434_101536384 3300006871 Unclassified 675
30 Ga0075429_100209168 3300006880 Bacteria 1709
31 Ga0075435_101192600 3300007076 Bacteria 666
32 Ga0099794_10357236 3300007265 Bacteria 761
33 Ga0105240_10536317 3300009093 Bacteria 1297
34 Ga0111539_10309037 3300009094 Bacteria 1840
35 Ga0111539_10522348 3300009094 Bacteria 1383
36 Ga0105245_10159785 3300009098 Unclassified 2137
37 Ga0105247_10048087 3300009101 Bacteria 2620
38 Ga0105247_11115514 3300009101 Unclassified 623
39 Ga0114129_10086610 3300009147 Bacteria 4345
40 Ga0114129_10149198 3300009147 Bacteria 3200
41 Ga0114129_10781303 3300009147 Bacteria 1220
42 Ga0105242_10344850 3300009176 Bacteria 1374
43 Ga0105242_12241929 3300009176 Unclassified 592
44 Ga0105248_10499699 3300009177 Bacteria 1371
45 Ga0105237_10347495 3300009545 Bacteria 1487
46 Ga0105238_12908255 3300009551 Unclassified 515
47 Ga0105249_10078244 3300009553 Bacteria 3068
48 Ga0099796_10003876 3300010159 Bacteria 3538
49 Ga0105239_10982212 3300010375 Bacteria 970
50 Ga0157373_10260375 3300013100 Bacteria 1227
51 Ga0157371_10671627 3300013102 Bacteria 774
52 Ga0157370_10083010 3300013104 Bacteria 3013
53 Ga0157369_10041985 3300013105 Bacteria 4991
54 Ga0157369_11346340 3300013105 Unclassified 727
55 Ga0157374_10254517 3300013296 Bacteria 1728
56 Ga0157378_10336108 3300013297 Bacteria 1471
57 Ga0163162_10168173 3300013306 Bacteria 2316
58 Ga0157372_10406062 3300013307 Bacteria 1587
59 Ga0157372_10994448 3300013307 Bacteria 972
60 Ga0157380_10312289 3300014326 Bacteria 1453
61 Ga0157380_12313986 3300014326 Unclassified 602
62 Ga0157379_10121466 3300014968 Bacteria 2350
63 Ga0206355_1599561 3300020076 Bacteria 811
64 Ga0206350_11112683 3300020080 Unclassified 670
65 Ga0213872_10136865 3300021361 Bacteria 1076
66 Ga0213874_10003119 3300021377 Bacteria 3647
67 Ga0213876_10000663 3300021384 Bacteria 24637
68 Ga0213876_10027875 3300021384 Unclassified 2978
69 Ga0213876_10124150 3300021384 Bacteria 1371
70 Ga0213871_10040980 3300021441 Bacteria 1243
71 Ga0213871_10100863 3300021441 Bacteria 845
72 Ga0224712_10053252 3300022467 Bacteria 1584
73 Ga0207710_10033243 3300025900 Bacteria 2262
74 Ga0207647_10112739 3300025904 Bacteria 1607
75 Ga0207663_10915389 3300025916 Unclassified 702
76 Ga0207662_10868467 3300025918 Bacteria 638
77 Ga0207646_10000245 3300025922 Bacteria 74245
78 Ga0207687_10186736 3300025927 Bacteria 1610
79 Ga0207711_10482183 3300025941 Bacteria 1155
80 Ga0207667_10567992 3300025949 Bacteria 1146
81 Ga0207667_10891649 3300025949 Bacteria 882
82 Ga0207667_11250189 3300025949 Unclassified 720
83 Ga0207703_10001058 3300026035 Bacteria 26245
84 Ga0207639_10080224 3300026041 Bacteria 2581
85 Ga0207698_10997377 3300026142 Bacteria 848
86 Ga0209588_1202433 3300027671 Bacteria 618
87 Ga0207428_10352310 3300027907 Bacteria 1083
88 Ga0207428_10520361 3300027907 Unclassified 862
89 Ga0265322_10140060 3300028654 Unclassified 691
90 Ga0265338_10005938 3300028800 Bacteria 15728
91 Ga0265338_10108324 3300028800 Bacteria 2244
92 Ga0265762_1025302 3300030760 Unclassified 1107
93 Ga0265330_10015838 3300031235 Bacteria 3483
94 Ga0265330_10067467 3300031235 Unclassified 1550
95 Ga0265332_10000355 3300031238 Bacteria 34319
96 Ga0265328_10012889 3300031239 Bacteria 3321
97 Ga0265328_10018661 3300031239 Bacteria 2671
98 Ga0265328_10038321 3300031239 Bacteria 1769
99 Ga0265328_10361587 3300031239 Unclassified 566
100 Ga0265320_10029569 3300031240 Bacteria 2834
101 Ga0265340_10150500 3300031247 Unclassified 1061
102 Ga0265340_10153672 3300031247 Unclassified 1048
103 Ga0265339_10000434 3300031249 Bacteria 32807
104 Ga0265339_10021357 3300031249 Bacteria 3768
105 Ga0265339_10050921 3300031249 Bacteria 2262
106 Ga0265339_10133341 3300031249 Unclassified 1268
107 Ga0265331_10006570 3300031250 Bacteria 6855
108 Ga0265331_10008053 3300031250 Bacteria 6023
109 Ga0265327_10068442 3300031251 Bacteria 1785
110 Ga0265327_10482728 3300031251 Unclassified 534
111 Ga0265316_10010065 3300031344 Bacteria 8647
112 Ga0265316_10026834 3300031344 Bacteria 4782
113 Ga0265314_10001166 3300031711 Bacteria 30241
114 Ga0265314_10002339 3300031711 Bacteria 19579
115 Ga0265314_10016948 3300031711 Bacteria 5734
116 Ga0265314_10041913 3300031711 Bacteria 3271
117 Ga0265314_10055539 3300031711 Unclassified 2732
118 Ga0265314_10204789 3300031711 Unclassified 1163
119 Ga0265342_10001928 3300031712 Bacteria 18614
120 Ga0265342_10008350 3300031712 Bacteria 7437
121 Ga0265342_10129535 3300031712 Unclassified 1415
122 Ga0265342_10625418 3300031712 Unclassified 542
123 Ga0307516_10099116 3300031730 Bacteria 2732
124 Ga0307412_11685182 3300031911 Unclassified 581
125 Ga0316583_10345236 3300032133 Unclassified 515
126 Ga0307510_10000100 3300033180 Bacteria 66675
127 Ga0373927_0024171 3300035695 Bacteria 3975
128 Ga0373933_0000074 3300035724 Bacteria 61625
129 Ga0373937_1169064 3300036401 Bacteria 718
130 Ga0373925_0338383 3300037068 Bacteria 1220
131 Ga0436364_1389349 3300037853 Bacteria 2177
132 Ga0400485_12723 3300038735 Unclassified 1047
133 Ga0436365_0038117 3300039437 Bacteria 61158
134 Ga0436365_1259465 3300039437 Bacteria 4176
135 Ga0436365_1906591 3300039437 Bacteria 89846
136 Ga0436360_0292340 3300039438 Unclassified 576
137 Ga0436360_0399197 3300039438 Bacteria 4629
138 Ga0436361_0438144 3300039447 Bacteria 1078
139 Ga0436363_0187029 3300039450 Bacteria 900
140 Ga0436363_0790180 3300039450 Bacteria 3442
141 Ga0439465_0306115 3300041413 Bacteria 595
142 Ga0451841_1142526 3300041498 Bacteria 645
143 Ga0451853_0621423 3300041512 Unclassified 520
144 Ga0495592_0145436 3300046454 Bacteria 1644
145 Ga0495638_0009553 3300046460 Bacteria 6796
146 Ga0495651_0802869 3300046462 Bacteria 580
147 Ga0495580_0220911 3300046472 Unclassified 1302
148 Ga0495618_0195097 3300046514 Bacteria 1283
149 Ga0495628_0013406 3300046516 Bacteria 6897
150 Ga0495632_0069548 3300046519 Bacteria 1695
151 Ga0495652_0107775 3300046529 Bacteria 2247
152 Ga0495640_0310225 3300046533 Bacteria 978
153 Ga0495657_0182639 3300046675 Bacteria 1286
154 Ga0495599_0095652 3300046678 Bacteria 1853
155 Ga0495670_0660260 3300046691 Bacteria 570
156 Ga0495600_0318566 3300046809 Bacteria 978
157 Ga0495674_0169968 3300047319 Bacteria 1820
158 Ga0495680_0041955 3300047322 Bacteria 3634
159 Ga0495675_0002077 3300047444 Bacteria 11951
160 Ga0496119_0000151 3300048922 Bacteria 96860
161 Ga0496120_0001963 3300048923 Bacteria 22482
162 Ga0496121_0797733 3300048924 Unclassified 555
163 Ga0496124_0517434 3300048927 Bacteria 796
164 Ga0496125_0003169 3300048928 Bacteria 20390
165 Ga0496126_0041298 3300048929 Bacteria 4270
166 Ga0501033_0019570 3300049570 Bacteria 5118
167 Ga0501034_0188904 3300049571 Bacteria 2023
168 Ga0501034_0267931 3300049571 Bacteria 1650
169 Ga0501034_0337918 3300049571 Bacteria 1436
170 Ga0501037_0108909 3300049573 Bacteria 1996
171 Ga0501038_0520010 3300049574 Bacteria 908
172 Ga0501043_0071276 3300049579 Bacteria 2730
173 Ga0501043_0085209 3300049579 Bacteria 2483
174 Ga0501047_0054185 3300049581 Bacteria 3879
175 Ga0501069_0129901 3300049585 Bacteria 1442
176 Ga0501070_0005135 3300049586 Bacteria 11158
177 Ga0501074_0244210 3300049590 Bacteria 1277
178 Ga0501074_1295706 3300049590 Unclassified 511
179 Ga0501080_0000284 3300049742 Bacteria 38307
180 Ga0501081_0462606 3300049743 Unclassified 943
181 Ga0501083_0930222 3300049744 Unclassified 566
182 Ga0501035_0002043 3300049822 Bacteria 20109
183 Ga0501044_0029541 3300049823 Bacteria 5779
184 Ga0501044_0353756 3300049823 Bacteria 1388
185 nmdc:mga05p37_122032_c1 3300050507 Bacteria 3200
186 nmdc:mga05p37_40805_c1 3300050507 Bacteria 5699
187 nmdc:mga05p37_797982_c1 3300050507 Bacteria 1033
188 nmdc:mga09592_413833_c1 3300050508 Bacteria 1165
189 nmdc:mga0qj67_287579_c1 3300050509 Bacteria 1332
190 nmdc:mga08y16_235418_c1 3300050511 Bacteria 1894
191 nmdc:mga0n895_930718_c1 3300050512 Bacteria 853
192 Ga0495595_0098991 3300053084 Bacteria 1406
193 Ga0495619_0193963 3300053085 Bacteria 1406
194 Ga0500644_0293784 3300053088 Bacteria 694
195 Ga0500642_0309484 3300053130 Bacteria 711
196 Ga0500568_0004325 3300053139 Bacteria 7617
197 Ga0500588_0052026 3300053146 Bacteria 1280
198 Ga0500627_0184616 3300053158 Bacteria 938
199 2643837103 2643221564 Bacteria 4193379
200 Ga0099794_10269911
201 rootH1_10169374
202 Ga0065707_10325163
203 Ga0070713_100170661
204 Ga0070713_101598064
205 Ga0070681_11757543
206 Ga0070706_100149422
207 Ga0070707_100000371
208 Ga0070698_100298800
209 Ga0070699_100819089
210 Ga0070679_100295870
211 Ga0068853_100171947
212 Ga0068853_100476052
213 Ga0068855_100637100
214 Ga0068855_101013683
215 Ga0068855_101467695
216 Ga0068854_100210862
217 Ga0068856_100639022
218 Ga0068856_102138389
219 Ga0068852_101550869
220 Ga0068858_100017356
221 Ga0081540_1325525
222 Ga0075428_100122198
223 Ga0075428_100768933
224 Ga0075430_100329794
225 Ga0075430_100335391
226 Ga0075431_100530061
227 Ga0075434_101105533
228 Ga0075434_101536384
229 Ga0075429_100209168
230 Ga0075435_101192600
231 Ga0099794_10357236
232 Ga0105240_10536317
233 Ga0111539_10309037
234 Ga0111539_10522348
235 Ga0105245_10159785
236 Ga0105247_10048087
237 Ga0105247_11115514
238 Ga0114129_10086610
239 Ga0114129_10149198
240 Ga0114129_10781303
241 Ga0105242_10344850
242 Ga0105242_12241929
243 Ga0105248_10499699
244 Ga0105237_10347495
245 Ga0105238_12908255
246 Ga0105249_10078244
247 Ga0099796_10003876
248 Ga0105239_10982212
249 Ga0157373_10260375
250 Ga0157371_10671627
251 Ga0157370_10083010
252 Ga0157369_10041985
253 Ga0157369_11346340
254 Ga0157374_10254517
255 Ga0157378_10336108
256 Ga0163162_10168173
257 Ga0157372_10406062
258 Ga0157372_10994448
259 Ga0157380_10312289
260 Ga0157380_12313986
261 Ga0157379_10121466
262 Ga0206355_1599561
263 Ga0206350_11112683
264 Ga0213872_10136865
265 Ga0213874_10003119
266 Ga0213876_10000663
267 Ga0213876_10027875
268 Ga0213876_10124150
269 Ga0213871_10040980
270 Ga0213871_10100863
271 Ga0224712_10053252
272 Ga0207710_10033243
273 Ga0207647_10112739
274 Ga0207663_10915389
275 Ga0207662_10868467
276 Ga0207646_10000245
277 Ga0207687_10186736
278 Ga0207711_10482183
279 Ga0207667_10567992
280 Ga0207667_10891649
281 Ga0207667_11250189
282 Ga0207703_10001058
283 Ga0207639_10080224
284 Ga0207698_10997377
285 Ga0209588_1202433
286 Ga0207428_10352310
287 Ga0207428_10520361
288 Ga0265322_10140060
289 Ga0265338_10005938
290 Ga0265338_10108324
291 Ga0265762_1025302
292 Ga0265330_10015838
293 Ga0265330_10067467
294 Ga0265332_10000355
295 Ga0265328_10012889
296 Ga0265328_10018661
297 Ga0265328_10038321
298 Ga0265328_10361587
299 Ga0265320_10029569
300 Ga0265340_10150500
301 Ga0265340_10153672
302 Ga0265339_10000434
303 Ga0265339_10021357
304 Ga0265339_10050921
305 Ga0265339_10133341
306 Ga0265331_10006570
307 Ga0265331_10008053
308 Ga0265327_10068442
309 Ga0265327_10482728
310 Ga0265316_10010065
311 Ga0265316_10026834
312 Ga0265314_10001166
313 Ga0265314_10002339
314 Ga0265314_10016948
315 Ga0265314_10041913
316 Ga0265314_10055539
317 Ga0265314_10204789
318 Ga0265342_10001928
319 Ga0265342_10008350
320 Ga0265342_10129535
321 Ga0265342_10625418
322 Ga0307516_10099116
323 Ga0307412_11685182
324 Ga0316583_10345236
325 Ga0307510_10000100
326 Ga0373927_0024171
327 Ga0373933_0000074
328 Ga0373937_1169064
329 Ga0373925_0338383
330 Ga0436364_1389349
331 Ga0400485_12723
332 Ga0436365_0038117
333 Ga0436365_1259465
334 Ga0436365_1906591
335 Ga0436360_0292340
336 Ga0436360_0399197
337 Ga0436361_0438144
338 Ga0436363_0187029
339 Ga0436363_0790180
340 Ga0439465_0306115
341 Ga0451841_1142526
342 Ga0451853_0621423
343 Ga0495592_0145436
344 Ga0495638_0009553
345 Ga0495651_0802869
346 Ga0495580_0220911
347 Ga0495618_0195097
348 Ga0495628_0013406
349 Ga0495632_0069548
350 Ga0495652_0107775
351 Ga0495640_0310225
352 Ga0495657_0182639
353 Ga0495599_0095652
354 Ga0495670_0660260
355 Ga0495600_0318566
356 Ga0495674_0169968
357 Ga0495680_0041955
358 Ga0495675_0002077
359 Ga0496119_0000151
360 Ga0496120_0001963
361 Ga0496121_0797733
362 Ga0496124_0517434
363 Ga0496125_0003169
364 Ga0496126_0041298
365 Ga0501033_0019570
366 Ga0501034_0188904
367 Ga0501034_0267931
368 Ga0501034_0337918
369 Ga0501037_0108909
370 Ga0501038_0520010
371 Ga0501043_0071276
372 Ga0501043_0085209
373 Ga0501047_0054185
374 Ga0501069_0129901
375 Ga0501070_0005135
376 Ga0501074_0244210
377 Ga0501074_1295706
378 Ga0501080_0000284
379 Ga0501081_0462606
380 Ga0501083_0930222
381 Ga0501035_0002043
382 Ga0501044_0029541
383 Ga0501044_0353756
384 nmdc:mga05p37_122032_c1
385 nmdc:mga05p37_40805_c1
386 nmdc:mga05p37_797982_c1
387 nmdc:mga09592_413833_c1
388 nmdc:mga0qj67_287579_c1
389 nmdc:mga08y16_235418_c1
390 nmdc:mga0n895_930718_c1
391 Ga0495595_0098991
392 Ga0495619_0193963
393 Ga0500644_0293784
394 Ga0500642_0309484
395 Ga0500568_0004325
396 Ga0500588_0052026
397 Ga0500627_0184616
398 2643837103

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05015

HigB-like_toxin

RelE-like toxin of type II toxin-antitoxin system HigB

13

103

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.8257 5 70
4px8-assembly1.cif.gz_A structure of p. vulgaris higb toxin 0.8132 5 67
5iwh-assembly1.cif.gz_A structure of p. vulgaris higb toxin delta h92 0.805 5 67
4yzv-assembly2.cif.gz_XY precleavage 70s structure of the p. vulgaris higb deltah92 toxin bound to the aca codon 0.8023 5 67
5ixl-assembly7.cif.gz_G structure of p. vulgaris higb toxin y91a variant 0.6799 5 70
ID Description Score Start End Superfamily
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8095 5 67 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.8045 5 70 3.30.2310.20
5ixlB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.6661 5 70 3.30.2310.20
4mctB00 Alpha Beta;2-Layer Sandwich;YaeB-like fold;RelE-like 0.6418 5 67 3.30.2310.20
4k4iA01 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;DNA polymerase beta, N-terminal domain-like 0.5578 12 45 1.10.150.110
ID Description Score Start End GO Terms
AF-A0A401JC71-F1-model_v4 HigB toxin protein 0.9564 5 50
AF-A0A2N9N9G1-F1-model_v4 Plasmid maintenance system killer 0.9508 5 45
AF-A0A840TMU0-F1-model_v4 Plasmid maintenance system killer protein 0.944 5 50
AF-A0A4V1T2U6-F1-model_v4 Addiction module antidote protein, HigA family 0.9141 5 53 GO:0003677
AF-A0A840TMU0-F1-model_v4 Plasmid maintenance system killer protein 0.9073 5 50

Map