F304940

General Info

Members Datasets Scaffolds Average Seq Length
198 167 396 125

Family's Representative Sequence

Representative Sequence 3300048090|Ga0495615_0031963|Ga0495615_0031963_388_771
Length 127
Sequence MATVEISKDNFKETVGKEGSIVILDWWAEWCGPCRAFAPTFEAASTKHPDIVFGKIDTDAQPELSGAFEIRSIPTLMVFRDGILLFEQAGALPAAALEDLIKQVRALDMEKVREEVAKQRAANTPQA

Samples

Sample ID Description Type Environment
1 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
23 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
24 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
38 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
40 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
57 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
58 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
59 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
60 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
66 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
67 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
68 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
69 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
70 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
71 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
72 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
73 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
74 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
75 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
76 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
77 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
78 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
79 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
80 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
81 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
82 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
83 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
84 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
85 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
86 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
87 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
88 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
89 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
93 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
96 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
97 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
98 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
99 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
106 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
107 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
110 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
111 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
118 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
119 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
120 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
121 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
125 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
126 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
127 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
128 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
129 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
130 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
134 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
138 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
139 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
140 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
141 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
144 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
145 2547132424 Nocardia nova SH22a Isolate Unclassified
146 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
147 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
148 2643221692 Nocardia sp. Root136 Isolate Unclassified
149 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
150 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
151 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
152 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
153 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
154 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
155 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
156 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
157 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
158 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
159 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
160 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
161 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
162 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
163 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
164 2922554459 Rhodococcus sp. 66b Isolate Unclassified
165 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
166 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
167 3001119090 Lolliginicoccus lacisalsi G463 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.83
Metatranscriptomes 5.56
Isolates 11.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.57
Nodule 0
Rhizoplane 1.52
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495615_0031963 3300048090 Bacteria 1266
2 JGI24739J22299_10031335 3300001989 Bacteria 1838
3 JGI24737J22298_10006074 3300001990 Bacteria 4140
4 JGI24735J21928_10060495 3300002067 Bacteria 1088
5 Ga0007409J51694_1012935 3300003575 Bacteria 641
6 Ga0007416J51690_1013140 3300003577 Bacteria 616
7 Ga0007429J51699_1006926 3300003579 Bacteria 544
8 Ga0032354_1002335 3300003693 Bacteria 504
9 Ga0070667_100183192 3300005367 Bacteria 1853
10 Ga0070714_101135495 3300005435 Bacteria 762
11 Ga0070708_100441761 3300005445 Bacteria 1227
12 Ga0070681_10073331 3300005458 Bacteria 3385
13 Ga0070684_100284177 3300005535 Bacteria 1516
14 Ga0068853_100009412 3300005539 Bacteria 7876
15 Ga0068853_100123597 3300005539 Bacteria 2311
16 Ga0068853_101322578 3300005539 Bacteria 697
17 Ga0070704_101768128 3300005549 Bacteria 572
18 Ga0068855_100243609 3300005563 Bacteria 2008
19 Ga0068855_101172098 3300005563 Bacteria 800
20 Ga0068857_100588486 3300005577 Bacteria 1051
21 Ga0068854_100524573 3300005578 Bacteria 1001
22 Ga0068856_100384911 3300005614 Bacteria 1422
23 Ga0068852_100555057 3300005616 Bacteria 1149
24 Ga0068852_100577701 3300005616 Bacteria 1126
25 Ga0081455_10045081 3300005937 Bacteria 3839
26 Ga0081455_10092083 3300005937 Bacteria 2454
27 Ga0075363_100022268 3300006048 Bacteria 3202
28 Ga0075363_100278882 3300006048 Bacteria 967
29 Ga0075363_100474196 3300006048 Bacteria 741
30 Ga0075362_10539390 3300006177 Bacteria 599
31 Ga0075370_10045528 3300006353 Bacteria 2481
32 Ga0075370_10329210 3300006353 Bacteria 911
33 Ga0075428_100536041 3300006844 Bacteria 1252
34 Ga0075428_101869505 3300006844 Bacteria 624
35 Ga0075430_100520329 3300006846 Bacteria 982
36 Ga0075431_100196108 3300006847 Bacteria 2067
37 Ga0075436_100506815 3300006914 Bacteria 883
38 Ga0111539_10014197 3300009094 Bacteria 9948
39 Ga0105245_10732841 3300009098 Bacteria 1023
40 Ga0114129_10714472 3300009147 Bacteria 1286
41 Ga0114129_11560525 3300009147 Bacteria 809
42 Ga0105243_10094367 3300009148 Bacteria 2470
43 Ga0105243_11665992 3300009148 Bacteria 666
44 Ga0105238_10368385 3300009551 Bacteria 1427
45 Ga0105249_10793497 3300009553 Bacteria 1011
46 Ga0105239_10138065 3300010375 Bacteria 2714
47 Ga0105239_11537485 3300010375 Bacteria 769
48 Ga0157372_10247258 3300013307 Bacteria 2070
49 Ga0157372_10459973 3300013307 Bacteria 1483
50 Ga0157377_11231717 3300014745 Bacteria 581
51 Ga0206349_1590191 3300020075 Bacteria 802
52 Ga0206355_1598488 3300020076 Bacteria 830
53 Ga0224712_10124656 3300022467 Bacteria 1119
54 Ga0207647_10005673 3300025904 Bacteria 9116
55 Ga0207707_10100344 3300025912 Bacteria 2530
56 Ga0207646_11893042 3300025922 Bacteria 508
57 Ga0207694_10244725 3300025924 Bacteria 1466
58 Ga0207664_10046490 3300025929 Bacteria 3407
59 Ga0207709_10005792 3300025935 Bacteria 6983
60 Ga0207670_11672445 3300025936 Bacteria 541
61 Ga0207661_10226785 3300025944 Bacteria 1653
62 Ga0207712_10201567 3300025961 Bacteria 1578
63 Ga0207640_10451387 3300025981 Bacteria 1060
64 Ga0207639_10005386 3300026041 Bacteria 8652
65 Ga0207639_10126444 3300026041 Bacteria 2109
66 Ga0207639_10335145 3300026041 Bacteria 1347
67 Ga0207702_10488901 3300026078 Bacteria 1198
68 Ga0207674_10039551 3300026116 Bacteria 4888
69 Ga0207683_10301504 3300026121 Bacteria 1466
70 Ga0207698_10326159 3300026142 Bacteria 1440
71 Ga0307517_10578902 3300028786 Bacteria 556
72 Ga0307511_10000191 3300030521 Bacteria 60992
73 Ga0265330_10000809 3300031235 Bacteria 19744
74 Ga0265331_10294093 3300031250 Bacteria 728
75 Ga0265316_10093090 3300031344 Bacteria 2297
76 Ga0307408_100214881 3300031548 Bacteria 1565
77 Ga0307408_100835754 3300031548 Bacteria 838
78 Ga0307405_11546556 3300031731 Bacteria 584
79 Ga0307413_10886786 3300031824 Bacteria 757
80 Ga0307410_10403563 3300031852 Bacteria 1105
81 Ga0307406_10015186 3300031901 Bacteria 4451
82 Ga0307409_101810187 3300031995 Bacteria 640
83 Ga0307416_100120730 3300032002 Bacteria 2335
84 Ga0307416_100147554 3300032002 Bacteria 2151
85 Ga0307414_10859461 3300032004 Bacteria 830
86 Ga0373925_0058869 3300037068 Bacteria 2881
87 Ga0439436_0133093 3300041404 Bacteria 697
88 Ga0439436_0188724 3300041404 Bacteria 588
89 Ga0439447_115822 3300041407 Bacteria 615
90 Ga0439461_0043046 3300041410 Bacteria 981
91 Ga0439465_0232889 3300041413 Bacteria 678
92 Ga0451853_3154874 3300041512 Bacteria 1688
93 Ga0439432_249962 3300042006 Bacteria 508
94 Ga0439452_011020 3300042010 Bacteria 2609
95 Ga0439457_179434 3300042014 Bacteria 517
96 Ga0450906_046759 3300042145 Bacteria 763
97 Ga0439434_0094282 3300042435 Bacteria 960
98 Ga0439434_0156357 3300042435 Bacteria 756
99 Ga0451577_0881169 3300042876 Bacteria 806
100 Ga0466969_0074441 3300044656 Bacteria 1629
101 Ga0466972_0041996 3300044658 Bacteria 2225
102 Ga0466966_0012025 3300044684 Bacteria 5736
103 Ga0466966_0151951 3300044684 Bacteria 1412
104 Ga0466961_0004452 3300044693 Bacteria 8776
105 Ga0466961_0259949 3300044693 Bacteria 1065
106 Ga0466963_0138360 3300044694 Bacteria 1686
107 Ga0466968_0010402 3300044735 Bacteria 3605
108 Ga0466968_0034354 3300044735 Bacteria 2116
109 Ga0466970_0003858 3300044765 Bacteria 7337
110 Ga0466957_0254227 3300044842 Bacteria 1169
111 Ga0466957_0500411 3300044842 Bacteria 842
112 Ga0466960_0232240 3300044901 Bacteria 1018
113 Ga0466959_0012371 3300045049 Bacteria 6164
114 Ga0466959_0117551 3300045049 Bacteria 1893
115 Ga0466958_0001503 3300045836 Bacteria 11150
116 Ga0466958_0003168 3300045836 Bacteria 8474
117 Ga0466958_0286760 3300045836 Bacteria 1056
118 Ga0495580_0222137 3300046472 Bacteria 1298
119 Ga0495607_0022887 3300046501 Bacteria 3919
120 Ga0495665_0000768 3300046531 Bacteria 16710
121 Ga0495656_0267484 3300046615 Bacteria 868
122 Ga0495656_0331851 3300046615 Bacteria 785
123 Ga0495625_0052918 3300046660 Bacteria 2906
124 Ga0495659_0424106 3300046664 Bacteria 576
125 Ga0495588_0055397 3300046674 Bacteria 2046
126 Ga0495581_0008222 3300047315 Bacteria 6048
127 Ga0495680_0843805 3300047322 Bacteria 596
128 Ga0495683_0000899 3300047323 Bacteria 20988
129 Ga0496102_1157920 3300048905 Bacteria 693
130 Ga0496110_1540527 3300048913 Bacteria 575
131 Ga0496113_1119230 3300048916 Bacteria 617
132 Ga0496123_0338001 3300048926 Bacteria 705
133 Ga0501311_062005 3300049527 Bacteria 606
134 Ga0501311_081358 3300049527 Bacteria 551
135 Ga0501317_073776 3300049533 Bacteria 580
136 Ga0501321_047927 3300049537 Bacteria 618
137 Ga0501032_0060651 3300049569 Bacteria 2537
138 Ga0501033_0284749 3300049570 Bacteria 1166
139 Ga0501034_1174627 3300049571 Bacteria 647
140 Ga0501036_0023600 3300049572 Bacteria 5183
141 Ga0501038_0134676 3300049574 Bacteria 2025
142 Ga0501040_0024907 3300049576 Bacteria 4020
143 Ga0501041_0129750 3300049577 Bacteria 1570
144 Ga0501042_0046227 3300049578 Bacteria 3103
145 Ga0501046_0030608 3300049580 Bacteria 4367
146 Ga0501047_0690226 3300049581 Bacteria 839
147 Ga0501048_0019917 3300049582 Bacteria 4919
148 Ga0501068_0014799 3300049584 Bacteria 4465
149 Ga0501068_0366720 3300049584 Bacteria 926
150 Ga0501069_0495441 3300049585 Bacteria 729
151 Ga0501071_0048075 3300049587 Bacteria 3066
152 Ga0501072_0451833 3300049588 Bacteria 1017
153 Ga0501075_0089780 3300049591 Bacteria 2330
154 Ga0501076_0020519 3300049592 Bacteria 5058
155 Ga0501077_0127228 3300049593 Bacteria 1615
156 Ga0501079_0030715 3300049741 Bacteria 4129
157 Ga0501080_0218484 3300049742 Bacteria 1745
158 Ga0501081_0012823 3300049743 Bacteria 5512
159 Ga0501035_0000370 3300049822 Bacteria 51745
160 Ga0501044_0083344 3300049823 Bacteria 3234
161 Ga0501045_0009894 3300049824 Bacteria 6670
162 nmdc:mga03683_24735_c1 3300050489 Bacteria 2352
163 nmdc:mga03n38_123675_c1 3300050490 Bacteria 1274
164 nmdc:mga03n38_277983_c1 3300050490 Bacteria 893
165 nmdc:mga03n38_838345_c1 3300050490 Bacteria 537
166 nmdc:mga00v17_4071_c1 3300050491 Bacteria 7557
167 nmdc:mga06z11_963288_c1 3300050494 Bacteria 520
168 nmdc:mga07m45_263795_c1 3300050496 Bacteria 1002
169 nmdc:mga06r32_545589_c1 3300050510 Bacteria 1134
170 nmdc:mga08x19_1036870_c1 3300050514 Bacteria 582
171 Ga0495655_0012943 3300053083 Bacteria 1712
172 Ga0501084_0045114 3300054114 Bacteria 3691
173 Ga0501082_0038983 3300060353 Bacteria 4098
174 Ga0466962_0308191 3300061719 Bacteria 784
175 Ga0530510_0037758 3300061734 Bacteria 3485
176 2548694743 2547132424 Bacteria 8348532
177 2552107316 2551306166 Bacteria 9731570
178 2566992785 2565956761 Bacteria 6601618
179 2644518239 2643221692 Bacteria 7282860
180 2738668161 2738541264 Bacteria 5935393
181 2738886754 2738541308 Bacteria 7020677
182 2739147231 2738541356 Bacteria 5935017
183 2739366816 2738543034 Bacteria 6084756
184 2744953694 2744054611 Bacteria 5611514
185 2891329190 2891326441 Bacteria 6439512
186 2902813629 2902810491 Bacteria 6794147
187 2902840652 2902837492 Bacteria 6697721
188 2904540301 2904535858 Bacteria 6308016
189 2904769254 2904765812 Bacteria 5369154
190 2904776298 2904770941 Bacteria 5580202
191 2908814384 2908811453 Bacteria 5478616
192 2919422825 2919420072 Bacteria 5390363
193 2919434922 2919432681 Bacteria 5390474
194 2919718846 2919713450 Bacteria 7431245
195 2922556331 2922554459 Bacteria 6683962
196 2928147306 2928142448 Bacteria 5288925
197 2956941242 2956939328 Bacteria 3474458
198 3001120322 3001119090 Bacteria 3449530
199 Ga0495615_0031963
200 JGI24739J22299_10031335
201 JGI24737J22298_10006074
202 JGI24735J21928_10060495
203 Ga0007409J51694_1012935
204 Ga0007416J51690_1013140
205 Ga0007429J51699_1006926
206 Ga0032354_1002335
207 Ga0070667_100183192
208 Ga0070714_101135495
209 Ga0070708_100441761
210 Ga0070681_10073331
211 Ga0070684_100284177
212 Ga0068853_100009412
213 Ga0068853_100123597
214 Ga0068853_101322578
215 Ga0070704_101768128
216 Ga0068855_100243609
217 Ga0068855_101172098
218 Ga0068857_100588486
219 Ga0068854_100524573
220 Ga0068856_100384911
221 Ga0068852_100555057
222 Ga0068852_100577701
223 Ga0081455_10045081
224 Ga0081455_10092083
225 Ga0075363_100022268
226 Ga0075363_100278882
227 Ga0075363_100474196
228 Ga0075362_10539390
229 Ga0075370_10045528
230 Ga0075370_10329210
231 Ga0075428_100536041
232 Ga0075428_101869505
233 Ga0075430_100520329
234 Ga0075431_100196108
235 Ga0075436_100506815
236 Ga0111539_10014197
237 Ga0105245_10732841
238 Ga0114129_10714472
239 Ga0114129_11560525
240 Ga0105243_10094367
241 Ga0105243_11665992
242 Ga0105238_10368385
243 Ga0105249_10793497
244 Ga0105239_10138065
245 Ga0105239_11537485
246 Ga0157372_10247258
247 Ga0157372_10459973
248 Ga0157377_11231717
249 Ga0206349_1590191
250 Ga0206355_1598488
251 Ga0224712_10124656
252 Ga0207647_10005673
253 Ga0207707_10100344
254 Ga0207646_11893042
255 Ga0207694_10244725
256 Ga0207664_10046490
257 Ga0207709_10005792
258 Ga0207670_11672445
259 Ga0207661_10226785
260 Ga0207712_10201567
261 Ga0207640_10451387
262 Ga0207639_10005386
263 Ga0207639_10126444
264 Ga0207639_10335145
265 Ga0207702_10488901
266 Ga0207674_10039551
267 Ga0207683_10301504
268 Ga0207698_10326159
269 Ga0307517_10578902
270 Ga0307511_10000191
271 Ga0265330_10000809
272 Ga0265331_10294093
273 Ga0265316_10093090
274 Ga0307408_100214881
275 Ga0307408_100835754
276 Ga0307405_11546556
277 Ga0307413_10886786
278 Ga0307410_10403563
279 Ga0307406_10015186
280 Ga0307409_101810187
281 Ga0307416_100120730
282 Ga0307416_100147554
283 Ga0307414_10859461
284 Ga0373925_0058869
285 Ga0439436_0133093
286 Ga0439436_0188724
287 Ga0439447_115822
288 Ga0439461_0043046
289 Ga0439465_0232889
290 Ga0451853_3154874
291 Ga0439432_249962
292 Ga0439452_011020
293 Ga0439457_179434
294 Ga0450906_046759
295 Ga0439434_0094282
296 Ga0439434_0156357
297 Ga0451577_0881169
298 Ga0466969_0074441
299 Ga0466972_0041996
300 Ga0466966_0012025
301 Ga0466966_0151951
302 Ga0466961_0004452
303 Ga0466961_0259949
304 Ga0466963_0138360
305 Ga0466968_0010402
306 Ga0466968_0034354
307 Ga0466970_0003858
308 Ga0466957_0254227
309 Ga0466957_0500411
310 Ga0466960_0232240
311 Ga0466959_0012371
312 Ga0466959_0117551
313 Ga0466958_0001503
314 Ga0466958_0003168
315 Ga0466958_0286760
316 Ga0495580_0222137
317 Ga0495607_0022887
318 Ga0495665_0000768
319 Ga0495656_0267484
320 Ga0495656_0331851
321 Ga0495625_0052918
322 Ga0495659_0424106
323 Ga0495588_0055397
324 Ga0495581_0008222
325 Ga0495680_0843805
326 Ga0495683_0000899
327 Ga0496102_1157920
328 Ga0496110_1540527
329 Ga0496113_1119230
330 Ga0496123_0338001
331 Ga0501311_062005
332 Ga0501311_081358
333 Ga0501317_073776
334 Ga0501321_047927
335 Ga0501032_0060651
336 Ga0501033_0284749
337 Ga0501034_1174627
338 Ga0501036_0023600
339 Ga0501038_0134676
340 Ga0501040_0024907
341 Ga0501041_0129750
342 Ga0501042_0046227
343 Ga0501046_0030608
344 Ga0501047_0690226
345 Ga0501048_0019917
346 Ga0501068_0014799
347 Ga0501068_0366720
348 Ga0501069_0495441
349 Ga0501071_0048075
350 Ga0501072_0451833
351 Ga0501075_0089780
352 Ga0501076_0020519
353 Ga0501077_0127228
354 Ga0501079_0030715
355 Ga0501080_0218484
356 Ga0501081_0012823
357 Ga0501035_0000370
358 Ga0501044_0083344
359 Ga0501045_0009894
360 nmdc:mga03683_24735_c1
361 nmdc:mga03n38_123675_c1
362 nmdc:mga03n38_277983_c1
363 nmdc:mga03n38_838345_c1
364 nmdc:mga00v17_4071_c1
365 nmdc:mga06z11_963288_c1
366 nmdc:mga07m45_263795_c1
367 nmdc:mga06r32_545589_c1
368 nmdc:mga08x19_1036870_c1
369 Ga0495655_0012943
370 Ga0501084_0045114
371 Ga0501082_0038983
372 Ga0466962_0308191
373 Ga0530510_0037758
374 2548694743
375 2552107316
376 2566992785
377 2644518239
378 2738668161
379 2738886754
380 2739147231
381 2739366816
382 2744953694
383 2891329190
384 2902813629
385 2902840652
386 2904540301
387 2904769254
388 2904776298
389 2908814384
390 2919422825
391 2919434922
392 2919718846
393 2922556331
394 2928147306
395 2956941242
396 3001120322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

2

103

0.97

PF13098

Thioredoxin_2

Thioredoxin-like domain

15

101

0.92

PF14595

Thioredoxin_9

Thioredoxin

1

106

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ynx-assembly2.cif.gz_B crystal structure of ancestral thioredoxin relative to last archaea common ancestor (laca) from the precambrian period 0.9756 2 102
3hhv-assembly1.cif.gz_A-2 the crystal structure of the thioredoxin a2 from sulfolobus solfataricus 0.9698 3 103
3p2a-assembly2.cif.gz_B crystal structure of thioredoxin 2 from yersinia pestis 0.969 2 107
3ziv-assembly3.cif.gz_C crystal structure of ancestral thioredoxin relative to last archaea- eukaryotes common ancestor (aeca) from the precambrian period 0.9662 2 102
4xhm-assembly2.cif.gz_B archaeoglobus fulgidus thioredoxin 3 m60h 0.9657 2 102
ID Description Score Start End Superfamily
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9865 3 107 3.40.30.10
3tcoC00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9656 2 102 3.40.30.10
af_A0A1D8PNX4_16_154_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9647 3 79 3.40.30.10
af_O53161_2_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9594 3 107 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.959 20 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A329QVP9-F1-model_v4 Thioredoxin 0.9997 1 117 GO:0005829
GO:0015035
AF-D6Y8N8-F1-model_v4 Thioredoxin 0.9991 3 117 GO:0005829
GO:0015035
AF-A0A4Q7L8W5-F1-model_v4 Thioredoxin 0.9983 1 123 GO:0005829
GO:0015035
AF-I1D1L6-F1-model_v4 Thioredoxin 0.9969 1 117 GO:0005829
GO:0015035
AF-A0A5D3F672-F1-model_v4 Thioredoxin 0.9964 1 116 GO:0005829
GO:0015035

Map