F304708

General Info

Members Datasets Scaffolds Average Seq Length
198 106 198 363

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0096089|Ga0316584_0096089_756_1967
Length 403
Sequence MNNFAFIIHPIEPKRDVARKFPLFGKLPAGVIDYFSRFFPPVYLSHIVGPCSQATGEEIEGWLLACPMTPKRMSEVKAPIAYNKIVQTGRLAEQLGAQILGLGAFTSVVGDAGITVSKRLSVPVTTGNSYTIALAVEAALDAARHMELDPAECTAAVVGAYGSVGGACAQLIARSVPQVALIGRRLEPLQDVRDKVNSVGAKAILSTDLADIRQADIVLTVTSSVEPIIEPEHLKPGAVVCDVARPRNVSRRVVQVRDDVLVIEGGMVDVPGNVDFGFNFGFPPGKAYACMAETMILALEGRYECYTLGKEISLERVDEMAQLASRHGFRLSGFRSFERPVTDAEIAKIKEKVHQSRRRHLTGLASVVGLGRRQREALLWDWPSIDRTSVSERDIPCGGGKAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
8 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
13 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
16 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
17 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
22 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
23 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
24 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
29 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
30 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
32 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
36 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
39 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
56 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
57 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
58 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
59 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
60 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
69 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
74 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
75 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
76 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
77 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
78 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
79 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
80 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
81 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
82 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
83 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
84 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
87 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
90 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
93 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
94 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
95 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
96 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
97 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
98 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
103 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
104 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 0
Rhizosphere 92.42
Stem 0
Stem Tuber 0
Unclassified 7.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1662820 2162886007 Bacteria 13559
2 Ga0065704_10089781 3300005289 Bacteria 2822
3 Ga0065707_10083192 3300005295 Bacteria 10070
4 Ga0070658_10000324 3300005327 Bacteria 40861
5 Ga0070658_10002397 3300005327 Bacteria 15711
6 Ga0070666_10000578 3300005335 Bacteria 22146
7 Ga0070660_100004586 3300005339 Bacteria 9551
8 Ga0070660_100012412 3300005339 Bacteria 6083
9 Ga0070700_100034923 3300005441 Bacteria 3039
10 Ga0070694_100240698 3300005444 Bacteria 1365
11 Ga0070706_100029636 3300005467 Bacteria 5042
12 Ga0070707_100076523 3300005468 Bacteria 3228
13 Ga0070698_100087063 3300005471 Bacteria 3110
14 Ga0070698_100091005 3300005471 Bacteria 3033
15 Ga0070697_100039784 3300005536 Bacteria 3803
16 Ga0068853_100179160 3300005539 Unclassified 1921
17 Ga0068855_100007805 3300005563 Bacteria 12923
18 Ga0068855_100091064 3300005563 Bacteria 3518
19 Ga0068859_100017279 3300005617 Bacteria 7245
20 Ga0068859_100024664 3300005617 Bacteria 6035
21 Ga0068851_10128921 3300005834 Unclassified 1366
22 Ga0068862_100097998 3300005844 Bacteria 2560
23 Ga0068862_100098516 3300005844 Bacteria 2554
24 Ga0081539_10006506 3300005985 Bacteria 11168
25 Ga0075428_100006139 3300006844 Bacteria 13370
26 Ga0075428_100012871 3300006844 Bacteria 9310
27 Ga0075428_100047180 3300006844 Bacteria 4732
28 Ga0075431_100031277 3300006847 Bacteria 5482
29 Ga0075431_100166542 3300006847 Bacteria 2265
30 Ga0075431_100517750 3300006847 Bacteria 1182
31 Ga0075433_10028887 3300006852 Bacteria 4718
32 Ga0075434_100138583 3300006871 Bacteria 2452
33 Ga0075429_100055496 3300006880 Bacteria 3446
34 Ga0068865_100219286 3300006881 Unclassified 1486
35 Ga0097620_100017279 3300006931 Bacteria 7245
36 Ga0097620_100024663 3300006931 Bacteria 6035
37 Ga0099794_10000527 3300007265 Bacteria 12799
38 Ga0105240_10000009 3300009093 Bacteria 591332
39 Ga0105245_10065408 3300009098 Unclassified 3288
40 Ga0105247_10080390 3300009101 Bacteria 2053
41 Ga0114129_10001409 3300009147 Bacteria 32415
42 Ga0114129_10003228 3300009147 Bacteria 22877
43 Ga0114129_10006964 3300009147 Bacteria 16086
44 Ga0114129_10011686 3300009147 Bacteria 12495
45 Ga0114129_10014119 3300009147 Bacteria 11377
46 Ga0114129_10041274 3300009147 Bacteria 6503
47 Ga0114129_10145029 3300009147 Bacteria 3253
48 Ga0105243_10045116 3300009148 Bacteria 3462
49 Ga0105243_10136037 3300009148 Unclassified 2091
50 Ga0105243_10315532 3300009148 Bacteria 1422
51 Ga0105237_10000013 3300009545 Bacteria 297699
52 Ga0105237_10000092 3300009545 Bacteria 122239
53 Ga0105237_10468198 3300009545 Unclassified 1266
54 Ga0105238_10061700 3300009551 Bacteria 3751
55 Ga0105249_10052492 3300009553 Bacteria 3723
56 Ga0105249_10179495 3300009553 Bacteria 2059
57 Ga0105239_10008363 3300010375 Bacteria 11787
58 Ga0105239_10026113 3300010375 Bacteria 6429
59 Ga0157369_10161873 3300013105 Unclassified 2362
60 Ga0157374_10096035 3300013296 Bacteria 2835
61 Ga0213875_10000139 3300021388 Bacteria 79384
62 Ga0207680_10008460 3300025903 Bacteria 5053
63 Ga0207705_10000821 3300025909 Bacteria 25407
64 Ga0207705_10002307 3300025909 Bacteria 14764
65 Ga0207684_10005186 3300025910 Bacteria 12125
66 Ga0207695_10000038 3300025913 Bacteria 475092
67 Ga0207671_10000004 3300025914 Bacteria 1022356
68 Ga0207671_10000024 3300025914 Bacteria 274628
69 Ga0207657_10007221 3300025919 Bacteria 11408
70 Ga0207646_10065834 3300025922 Bacteria 3235
71 Ga0207646_10133949 3300025922 Unclassified 2231
72 Ga0207646_10148755 3300025922 Bacteria 2111
73 Ga0207694_10067922 3300025924 Bacteria 2783
74 Ga0207694_10073440 3300025924 Bacteria 2676
75 Ga0207687_10039658 3300025927 Unclassified 3225
76 Ga0207709_10104621 3300025935 Bacteria 1879
77 Ga0207667_10071756 3300025949 Bacteria 3600
78 Ga0207712_10087563 3300025961 Bacteria 2284
79 Ga0207708_10054124 3300026075 Bacteria 3059
80 Ga0207674_10303085 3300026116 Unclassified 1547
81 Ga0209588_1022838 3300027671 Bacteria 1969
82 Ga0268265_10067488 3300028380 Bacteria 2769
83 Ga0265334_10008853 3300028573 Bacteria 4275
84 Ga0265318_10002292 3300028577 Bacteria 10289
85 Ga0307515_10000004 3300028794 Bacteria 846506
86 Ga0307515_10083180 3300028794 Bacteria 4129
87 Ga0265338_10000671 3300028800 Bacteria 59218
88 Ga0265338_10059787 3300028800 Unclassified 3355
89 Ga0265330_10092367 3300031235 Bacteria 1299
90 Ga0265320_10022372 3300031240 Bacteria 3383
91 Ga0265340_10000742 3300031247 Bacteria 18517
92 Ga0265331_10010734 3300031250 Bacteria 5048
93 Ga0265316_10026609 3300031344 Bacteria 4807
94 Ga0316575_10012066 3300031665 Bacteria 3207
95 Ga0316579_10094953 3300031691 Bacteria 1425
96 Ga0265342_10098373 3300031712 Bacteria 1670
97 Ga0316576_10114088 3300031727 Unclassified 2027
98 Ga0316576_10116496 3300031727 Bacteria 2005
99 Ga0316578_10073093 3300031728 Bacteria 2032
100 Ga0316578_10110346 3300031728 Bacteria 1652
101 Ga0316578_10143384 3300031728 Unclassified 1439
102 Ga0307405_10205479 3300031731 Unclassified 1434
103 Ga0316577_10009819 3300031733 Bacteria 5158
104 Ga0316577_10010020 3300031733 Bacteria 5110
105 Ga0316577_10041583 3300031733 Bacteria 2572
106 Ga0316577_10084754 3300031733 Bacteria 1773
107 Ga0307413_10061999 3300031824 Bacteria 2311
108 Ga0316593_10004670 3300032168 Unclassified 3537
109 Ga0316582_0007392 3300036647 Bacteria 5842
110 Ga0316582_0084322 3300036647 Bacteria 2080
111 Ga0316582_0126580 3300036647 Unclassified 1713
112 Ga0316582_0240243 3300036647 Unclassified 1241
113 Ga0316584_0004221 3300036712 Bacteria 9487
114 Ga0316584_0096089 3300036712 Bacteria 2218
115 Ga0395900_0038195 3300037418 Bacteria 4950
116 Ga0395898_0013100 3300037466 Bacteria 8551
117 Ga0395905_0001769 3300037471 Bacteria 25100
118 Ga0316581_0026278 3300037588 Bacteria 1736
119 Ga0436364_0070103 3300037853 Bacteria 509097
120 Ga0436364_0672532 3300037853 Bacteria 9366
121 Ga0400484_05524 3300038725 Bacteria 14702
122 Ga0400490_35240 3300038726 Bacteria 4731
123 Ga0400490_50110 3300038726 Bacteria 2077
124 Ga0400488_61644 3300038741 Bacteria 2331
125 Ga0400483_182554 3300039062 Bacteria 2823
126 Ga0400489_40532 3300039093 Bacteria 61632
127 Ga0400489_91836 3300039093 Bacteria 1984
128 Ga0451577_0003866 3300042876 Bacteria 16255
129 Ga0451577_0056779 3300042876 Bacteria 3492
130 Ga0451577_0078164 3300042876 Unclassified 2950
131 Ga0451577_0117576 3300042876 Bacteria 2381
132 Ga0451577_0184066 3300042876 Bacteria 1884
133 Ga0451577_0326589 3300042876 Bacteria 1391
134 Ga0453683_0006309 3300044673 Bacteria 8142
135 Ga0453683_0018334 3300044673 Bacteria 4493
136 Ga0453683_0020571 3300044673 Bacteria 4216
137 Ga0453683_0068689 3300044673 Bacteria 2215
138 Ga0453683_0090661 3300044673 Unclassified 1916
139 Ga0453683_0140784 3300044673 Bacteria 1522
140 Ga0453684_0000012 3300044712 Bacteria 1062512
141 Ga0453684_0000023 3300044712 Bacteria 857153
142 Ga0453684_0000627 3300044712 Bacteria 128570
143 Ga0453684_0001037 3300044712 Bacteria 88904
144 Ga0453684_0001219 3300044712 Bacteria 78962
145 Ga0453684_0002391 3300044712 Bacteria 45742
146 Ga0453684_0005654 3300044712 Bacteria 24568
147 Ga0453684_0013135 3300044712 Bacteria 13506
148 Ga0453684_0014283 3300044712 Bacteria 12734
149 Ga0453684_0014626 3300044712 Bacteria 12526
150 Ga0453684_0035394 3300044712 Bacteria 6902
151 Ga0453684_0037663 3300044712 Bacteria 6634
152 Ga0453684_0050655 3300044712 Bacteria 5458
153 Ga0453684_0082709 3300044712 Unclassified 3998
154 Ga0453684_0085418 3300044712 Bacteria 3921
155 Ga0453684_0151002 3300044712 Bacteria 2761
156 Ga0453684_0187240 3300044712 Bacteria 2424
157 Ga0453684_0203838 3300044712 Bacteria 2304
158 Ga0453684_0256286 3300044712 Bacteria 2006
159 Ga0453684_0263994 3300044712 Bacteria 1971
160 Ga0453684_0304869 3300044712 Bacteria 1809
161 Ga0453684_0316515 3300044712 Unclassified 1769
162 Ga0453684_0318463 3300044712 Unclassified 1762
163 Ga0453684_0391110 3300044712 Bacteria 1559
164 Ga0451576_0000676 3300045051 Bacteria 69445
165 Ga0451576_0010374 3300045051 Bacteria 10696
166 Ga0451576_0011005 3300045051 Bacteria 10331
167 Ga0451576_0053407 3300045051 Bacteria 4233
168 Ga0451576_0297972 3300045051 Bacteria 1686
169 Ga0496125_0008868 3300048928 Bacteria 10447
170 Ga0496125_0043515 3300048928 Bacteria 3809
171 Ga0501040_0081134 3300049576 Bacteria 2248
172 Ga0501041_0114705 3300049577 Bacteria 1673
173 Ga0501046_0180079 3300049580 Bacteria 1581
174 Ga0501068_0171396 3300049584 Bacteria 1370
175 Ga0501068_0273760 3300049584 Unclassified 1078
176 Ga0501075_0014746 3300049591 Bacteria 5601
177 Ga0501079_0321186 3300049741 Bacteria 1212
178 Ga0501080_0200208 3300049742 Bacteria 1834
179 Ga0501044_0190469 3300049823 Unclassified 2014
180 nmdc:mga05p37_11211_c1 3300050507 Bacteria 10656
181 nmdc:mga05p37_155790_c1 3300050507 Bacteria 2792
182 nmdc:mga05p37_23695_c1 3300050507 Bacteria 7453
183 nmdc:mga05p37_27604_c1 3300050507 Bacteria 6913
184 nmdc:mga05p37_311084_c1 3300050507 Bacteria 1867
185 nmdc:mga05p37_82422_c1 3300050507 Unclassified 3963
186 nmdc:mga09592_2553_c1 3300050508 Bacteria 14736
187 nmdc:mga09592_274917_c1 3300050508 Bacteria 1461
188 nmdc:mga09592_43277_c1 3300050508 Unclassified 3790
189 nmdc:mga09592_71735_c1 3300050508 Bacteria 2940
190 nmdc:mga09592_85315_c1 3300050508 Bacteria 2694
191 nmdc:mga0qj67_172550_c1 3300050509 Unclassified 1756
192 nmdc:mga06r32_70111_c1 3300050510 Bacteria 3389
193 nmdc:mga0n895_228741_c1 3300050512 Bacteria 1888
194 nmdc:mga0n895_344033_c1 3300050512 Bacteria 1510
195 nmdc:mga0a205_25716_c1 3300050515 Bacteria 5610
196 Ga0500616_0000077 3300053153 Bacteria 208506
197 Ga0501084_0116306 3300054114 Bacteria 2248
198 Ga0530510_0099439 3300061734 Bacteria 2127

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038726 Ga0400490_35240 Ga0400490_35240_57_977 287
2 3300049577 Ga0501041_0114705 Ga0501041_0114705_761_1642 293
3 3300049584 Ga0501068_0273760 Ga0501068_0273760_37_918 293
4 3300025903 Ga0207680_10008460 Ga0207680_100084602 323
5 3300031728 Ga0316578_10143384 Ga0316578_101433841 333
6 3300010375 Ga0105239_10008363 Ga0105239_1000836311 336
7 3300009545 Ga0105237_10468198 Ga0105237_104681981 337
8 3300039093 Ga0400489_40532 Ga0400489_40532_43026_44123 339
9 3300050512 nmdc:mga0n895_228741_c1 nmdc:mga0n895_228741_c1_849_1871 340
10 3300005563 Ga0068855_100007805 Ga0068855_1000078057 342
11 3300025949 Ga0207667_10071756 Ga0207667_100717564 342
12 3300028794 Ga0307515_10000004 Ga0307515_10000004766 342
13 3300005844 Ga0068862_100097998 Ga0068862_1000979982 347
14 3300009553 Ga0105249_10179495 Ga0105249_101794952 347
15 3300025961 Ga0207712_10087563 Ga0207712_100875632 347
16 3300009093 Ga0105240_10000009 Ga0105240_10000009219 349
17 3300010375 Ga0105239_10026113 Ga0105239_100261134 349
18 3300025913 Ga0207695_10000038 Ga0207695_10000038121 349
19 3300025924 Ga0207694_10073440 Ga0207694_100734402 349
20 3300037471 Ga0395905_0001769 Ga0395905_0001769_6624_7715 349
21 3300042876 Ga0451577_0003866 Ga0451577_0003866_12284_13381 351
22 3300053153 Ga0500616_0000077 Ga0500616_0000077_111578_112639 353
23 3300005339 Ga0070660_100004586 Ga0070660_1000045862 354
24 3300013296 Ga0157374_10096035 Ga0157374_100960352 354
25 3300025919 Ga0207657_10007221 Ga0207657_100072214 354
26 3300028800 Ga0265338_10000671 Ga0265338_1000067122 354
27 3300049576 Ga0501040_0081134 Ga0501040_0081134_444_1577 354
28 3300049741 Ga0501079_0321186 Ga0501079_0321186_29_1162 354
29 3300042876 Ga0451577_0184066 Ga0451577_0184066_654_1739 355
30 3300044712 Ga0453684_0050655 Ga0453684_0050655_1624_2730 355
31 3300044712 Ga0453684_0151002 Ga0453684_0151002_1356_2441 355
32 3300009148 Ga0105243_10045116 Ga0105243_100451163 356
33 3300036647 Ga0316582_0240243 Ga0316582_0240243_74_1144 356
34 3300037418 Ga0395900_0038195 Ga0395900_0038195_2578_3663 356
35 3300037466 Ga0395898_0013100 Ga0395898_0013100_2008_3093 356
36 3300042876 Ga0451577_0078164 Ga0451577_0078164_222_1310 356
37 3300044673 Ga0453683_0090661 Ga0453683_0090661_809_1897 356
38 3300044712 Ga0453684_0037663 Ga0453684_0037663_29_1117 356
39 3300005327 Ga0070658_10000324 Ga0070658_1000032425 357
40 3300005327 Ga0070658_10002397 Ga0070658_1000239718 357
41 3300005339 Ga0070660_100012412 Ga0070660_1000124126 357
42 3300005539 Ga0068853_100179160 Ga0068853_1001791602 357
43 3300005834 Ga0068851_10128921 Ga0068851_101289211 357
44 3300021388 Ga0213875_10000139 Ga0213875_1000013929 357
45 3300025909 Ga0207705_10000821 Ga0207705_1000082114 357
46 3300025909 Ga0207705_10002307 Ga0207705_1000230717 357
47 3300031665 Ga0316575_10012066 Ga0316575_100120663 357
48 3300037853 Ga0436364_0070103 Ga0436364_0070103_108281_109483 357
49 3300005335 Ga0070666_10000578 Ga0070666_100005788 358
50 3300006881 Ga0068865_100219286 Ga0068865_1002192862 358
51 3300009148 Ga0105243_10315532 Ga0105243_103155322 358
52 3300009545 Ga0105237_10000092 Ga0105237_1000009246 358
53 3300025914 Ga0207671_10000004 Ga0207671_10000004656 358
54 3300028794 Ga0307515_10083180 Ga0307515_100831802 358
55 3300031733 Ga0316577_10009819 Ga0316577_100098193 358
56 3300031733 Ga0316577_10084754 Ga0316577_100847542 358
57 3300044712 Ga0453684_0001037 Ga0453684_0001037_44636_45712 358
58 3300031691 Ga0316579_10094953 Ga0316579_100949532 359
59 3300031727 Ga0316576_10114088 Ga0316576_101140882 359
60 3300031728 Ga0316578_10073093 Ga0316578_100730932 359
61 3300036647 Ga0316582_0084322 Ga0316582_0084322_832_1959 359
62 3300036712 Ga0316584_0004221 Ga0316584_0004221_5567_6694 359
63 3300037588 Ga0316581_0026278 Ga0316581_0026278_533_1660 359
64 3300038725 Ga0400484_05524 Ga0400484_05524_6301_7443 359
65 3300038726 Ga0400490_50110 Ga0400490_50110_923_2002 359
66 3300038741 Ga0400488_61644 Ga0400488_61644_683_1762 359
67 3300044712 Ga0453684_0000627 Ga0453684_0000627_75139_76221 359
68 3300044712 Ga0453684_0005654 Ga0453684_0005654_14032_15114 359
69 3300007265 Ga0099794_10000527 Ga0099794_1000052714 360
70 3300027671 Ga0209588_1022838 Ga0209588_10228381 360
71 3300044673 Ga0453683_0020571 Ga0453683_0020571_1343_2425 360
72 3300044673 Ga0453683_0068689 Ga0453683_0068689_368_1501 360
73 3300044712 Ga0453684_0000023 Ga0453684_0000023_329507_330622 360
74 3300044712 Ga0453684_0318463 Ga0453684_0318463_499_1581 360
75 3300045051 Ga0451576_0053407 Ga0451576_0053407_3006_4088 360
76 3300049584 Ga0501068_0171396 Ga0501068_0171396_231_1340 360
77 3300009545 Ga0105237_10000013 Ga0105237_10000013102 361
78 3300009551 Ga0105238_10061700 Ga0105238_100617003 361
79 3300025914 Ga0207671_10000024 Ga0207671_10000024135 361
80 3300025924 Ga0207694_10067922 Ga0207694_100679223 361
81 3300032168 Ga0316593_10004670 Ga0316593_100046703 361
82 3300036647 Ga0316582_0126580 Ga0316582_0126580_577_1662 361
83 3300037853 Ga0436364_0672532 Ga0436364_0672532_2779_3903 361
84 3300042876 Ga0451577_0117576 Ga0451577_0117576_773_1858 361
85 3300044712 Ga0453684_0000012 Ga0453684_0000012_601806_602891 361
86 3300049580 Ga0501046_0180079 Ga0501046_0180079_76_1209 361
87 3300031727 Ga0316576_10116496 Ga0316576_101164961 362
88 3300031728 Ga0316578_10110346 Ga0316578_101103461 362
89 3300031733 Ga0316577_10010020 Ga0316577_100100203 362
90 3300036647 Ga0316582_0007392 Ga0316582_0007392_2387_3475 362
91 3300044673 Ga0453683_0006309 Ga0453683_0006309_3680_4768 362
92 3300044673 Ga0453683_0018334 Ga0453683_0018334_1889_2977 362
93 3300044712 Ga0453684_0002391 Ga0453684_0002391_29097_30185 362
94 3300044712 Ga0453684_0013135 Ga0453684_0013135_7653_8741 362
95 3300044712 Ga0453684_0014283 Ga0453684_0014283_2872_3960 362
96 3300044712 Ga0453684_0203838 Ga0453684_0203838_866_1954 362
97 3300044712 Ga0453684_0256286 Ga0453684_0256286_421_1509 362
98 3300044712 Ga0453684_0304869 Ga0453684_0304869_39_1127 362
99 3300045051 Ga0451576_0000676 Ga0451576_0000676_37220_38308 362
100 3300045051 Ga0451576_0010374 Ga0451576_0010374_407_1495 362
101 3300045051 Ga0451576_0011005 Ga0451576_0011005_6600_7688 362
102 3300048928 Ga0496125_0008868 Ga0496125_0008868_2689_3783 362
103 3300048928 Ga0496125_0043515 Ga0496125_0043515_881_1975 362
104 3300005468 Ga0070707_100076523 Ga0070707_1000765232 363
105 3300005471 Ga0070698_100087063 Ga0070698_1000870632 363
106 3300005536 Ga0070697_100039784 Ga0070697_1000397843 363
107 3300025910 Ga0207684_10005186 Ga0207684_100051863 363
108 3300025922 Ga0207646_10065834 Ga0207646_100658343 363
109 3300025922 Ga0207646_10133949 Ga0207646_101339492 363
110 3300039062 Ga0400483_182554 Ga0400483_182554_1185_2276 363
111 3300049823 Ga0501044_0190469 Ga0501044_0190469_840_1937 363
112 3300005563 Ga0068855_100091064 Ga0068855_1000910641 364
113 3300009098 Ga0105245_10065408 Ga0105245_100654083 364
114 3300013105 Ga0157369_10161873 Ga0157369_101618732 364
115 3300025927 Ga0207687_10039658 Ga0207687_100396583 364
116 3300028573 Ga0265334_10008853 Ga0265334_100088532 364
117 3300028577 Ga0265318_10002292 Ga0265318_100022922 364
118 3300028800 Ga0265338_10059787 Ga0265338_100597874 364
119 3300031235 Ga0265330_10092367 Ga0265330_100923671 364
120 3300031240 Ga0265320_10022372 Ga0265320_100223722 364
121 3300031247 Ga0265340_10000742 Ga0265340_100007426 364
122 3300031250 Ga0265331_10010734 Ga0265331_100107346 364
123 3300031344 Ga0265316_10026609 Ga0265316_100266093 364
124 3300031712 Ga0265342_10098373 Ga0265342_100983731 364
125 3300036712 Ga0316584_0096089 Ga0316584_0096089_756_1967 364
126 3300039093 Ga0400489_91836 Ga0400489_91836_471_1577 365
127 2162886007 SwRhRL2b_contig_1662820 SwRhRL2b_0009.00002520 366
128 3300005289 Ga0065704_10089781 Ga0065704_100897812 366
129 3300005295 Ga0065707_10083192 Ga0065707_100831927 366
130 3300005441 Ga0070700_100034923 Ga0070700_1000349232 366
131 3300005444 Ga0070694_100240698 Ga0070694_1002406981 366
132 3300005467 Ga0070706_100029636 Ga0070706_1000296363 366
133 3300005471 Ga0070698_100091005 Ga0070698_1000910053 366
134 3300005617 Ga0068859_100017279 Ga0068859_1000172793 366
135 3300005617 Ga0068859_100024664 Ga0068859_1000246643 366
136 3300005844 Ga0068862_100098516 Ga0068862_1000985162 366
137 3300005985 Ga0081539_10006506 Ga0081539_100065068 366
138 3300006844 Ga0075428_100006139 Ga0075428_1000061392 366
139 3300006844 Ga0075428_100012871 Ga0075428_1000128713 366
140 3300006844 Ga0075428_100047180 Ga0075428_1000471802 366
141 3300006847 Ga0075431_100031277 Ga0075431_1000312772 366
142 3300006847 Ga0075431_100166542 Ga0075431_1001665422 366
143 3300006847 Ga0075431_100517750 Ga0075431_1005177501 366
144 3300006852 Ga0075433_10028887 Ga0075433_100288873 366
145 3300006871 Ga0075434_100138583 Ga0075434_1001385832 366
146 3300006880 Ga0075429_100055496 Ga0075429_1000554962 366
147 3300006931 Ga0097620_100017279 Ga0097620_1000172793 366
148 3300006931 Ga0097620_100024663 Ga0097620_1000246633 366
149 3300009101 Ga0105247_10080390 Ga0105247_100803902 366
150 3300009147 Ga0114129_10001409 Ga0114129_1000140911 366
151 3300009147 Ga0114129_10003228 Ga0114129_100032288 366
152 3300009147 Ga0114129_10006964 Ga0114129_100069648 366
153 3300009147 Ga0114129_10011686 Ga0114129_100116863 366
154 3300009147 Ga0114129_10014119 Ga0114129_100141198 366
155 3300009147 Ga0114129_10041274 Ga0114129_100412743 366
156 3300009147 Ga0114129_10145029 Ga0114129_101450292 366
157 3300009148 Ga0105243_10136037 Ga0105243_101360372 366
158 3300009553 Ga0105249_10052492 Ga0105249_100524923 366
159 3300025922 Ga0207646_10148755 Ga0207646_101487552 366
160 3300025935 Ga0207709_10104621 Ga0207709_101046212 366
161 3300026075 Ga0207708_10054124 Ga0207708_100541243 366
162 3300026116 Ga0207674_10303085 Ga0207674_103030852 366
163 3300028380 Ga0268265_10067488 Ga0268265_100674882 366
164 3300031731 Ga0307405_10205479 Ga0307405_102054792 366
165 3300031733 Ga0316577_10041583 Ga0316577_100415832 366
166 3300031824 Ga0307413_10061999 Ga0307413_100619992 366
167 3300042876 Ga0451577_0056779 Ga0451577_0056779_1531_2631 366
168 3300042876 Ga0451577_0326589 Ga0451577_0326589_183_1283 366
169 3300044673 Ga0453683_0140784 Ga0453683_0140784_376_1476 366
170 3300044712 Ga0453684_0001219 Ga0453684_0001219_56025_57128 366
171 3300044712 Ga0453684_0014626 Ga0453684_0014626_5746_6858 366
172 3300044712 Ga0453684_0035394 Ga0453684_0035394_5265_6365 366
173 3300044712 Ga0453684_0082709 Ga0453684_0082709_230_1330 366
174 3300044712 Ga0453684_0085418 Ga0453684_0085418_1698_2798 366
175 3300044712 Ga0453684_0187240 Ga0453684_0187240_267_1367 366
176 3300044712 Ga0453684_0263994 Ga0453684_0263994_54_1154 366
177 3300044712 Ga0453684_0316515 Ga0453684_0316515_613_1713 366
178 3300044712 Ga0453684_0391110 Ga0453684_0391110_354_1460 366
179 3300045051 Ga0451576_0297972 Ga0451576_0297972_420_1520 366
180 3300049591 Ga0501075_0014746 Ga0501075_0014746_3679_4779 366
181 3300049742 Ga0501080_0200208 Ga0501080_0200208_192_1292 366
182 3300050507 nmdc:mga05p37_11211_c1 nmdc:mga05p37_11211_c1_3102_4202 366
183 3300050507 nmdc:mga05p37_155790_c1 nmdc:mga05p37_155790_c1_246_1346 366
184 3300050507 nmdc:mga05p37_23695_c1 nmdc:mga05p37_23695_c1_4686_5786 366
185 3300050507 nmdc:mga05p37_27604_c1 nmdc:mga05p37_27604_c1_4525_5625 366
186 3300050507 nmdc:mga05p37_311084_c1 nmdc:mga05p37_311084_c1_351_1460 366
187 3300050507 nmdc:mga05p37_82422_c1 nmdc:mga05p37_82422_c1_49_1149 366
188 3300050508 nmdc:mga09592_2553_c1 nmdc:mga09592_2553_c1_4558_5658 366
189 3300050508 nmdc:mga09592_274917_c1 nmdc:mga09592_274917_c1_215_1315 366
190 3300050508 nmdc:mga09592_43277_c1 nmdc:mga09592_43277_c1_103_1203 366
191 3300050508 nmdc:mga09592_71735_c1 nmdc:mga09592_71735_c1_1424_2524 366
192 3300050508 nmdc:mga09592_85315_c1 nmdc:mga09592_85315_c1_404_1513 366
193 3300050509 nmdc:mga0qj67_172550_c1 nmdc:mga0qj67_172550_c1_539_1639 366
194 3300050510 nmdc:mga06r32_70111_c1 nmdc:mga06r32_70111_c1_1380_2480 366
195 3300050512 nmdc:mga0n895_344033_c1 nmdc:mga0n895_344033_c1_131_1231 366
196 3300050515 nmdc:mga0a205_25716_c1 nmdc:mga0a205_25716_c1_1249_2349 366
197 3300054114 Ga0501084_0116306 Ga0501084_0116306_35_1144 366
198 3300061734 Ga0530510_0099439 Ga0530510_0099439_665_1765 366

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01488

Shikimate_DH

Shikimate / quinate 5-dehydrogenase

141

264

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4plv-assembly1.cif.gz_C crystal structure of ancestral apicomplexan malate dehydrogenase with lactate. 0.8679 153 226
6jzz-assembly1.cif.gz_A the crystal structure of aar-c294s in complex with ado. 0.837 4 338
3ioy-assembly1.cif.gz_B structure of putative short-chain dehydrogenase (saro_0793) from novosphingobium aromaticivorans 0.8335 151 221
3pqe-assembly1.cif.gz_A crystal structure of l-lactate dehydrogenase from bacillus subtilis with h171c mutation 0.8298 153 229
6jzz-assembly1.cif.gz_A the crystal structure of aar-c294s in complex with ado. 0.8212 4 338
ID Description Score Start End Superfamily
4plhC01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8667 154 226 3.40.50.720
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8378 151 207 3.40.50.720
af_Q5SS80_29_314_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8364 151 225 3.40.50.720
4mpdA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8344 153 266 3.40.50.720
3ioyB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8335 151 221 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1W9WJ04-F1-model_v4 Shikimate dehydrogenase 0.9854 1 354
AF-A0A7C7E9E5-F1-model_v4 Shikimate dehydrogenase 0.9818 62 360
AF-A0A1W9WJ04-F1-model_v4 Shikimate dehydrogenase 0.9799 1 354
AF-A0A2M7KZG2-F1-model_v4 Shikimate dehydrogenase 0.9767 1 355
AF-A0A3N5SEC6-F1-model_v4 Shikimate dehydrogenase 0.976 1 98

Feature Viewer

pLDDT pTM Quality
91.98 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map