F304002

General Info

Members Datasets Scaffolds Average Seq Length
198 119 396 147

Family's Representative Sequence

Representative Sequence 3300005366|Ga0070659_100860362|Ga0070659_1008603622
Length 166
Sequence MLYIESYLEELENQSNWRNYQMTSILKFSPFADVDDMPGIRHFQDAVNRFLSEPGARPWTPPVDILETENELLLKMDVPEISLKDVEIKLENQTLTIKGDRRFEQAEGKGYHRIERSYGTFARSFSLPGTVDTEQVRADYRNGVLTVILPKKEVAKPRTIRVEVSE

Samples

Sample ID Description Type Environment
1 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
18 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
21 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
23 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
24 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
29 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
30 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
33 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
34 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
38 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
40 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
41 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
42 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
43 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
44 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
45 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
46 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
47 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
48 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
49 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
71 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
72 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
73 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
74 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
75 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
76 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
77 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
78 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
79 3300031664 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
80 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
83 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
84 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
85 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
86 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
87 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
88 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
89 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
97 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
98 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
99 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
100 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
101 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
105 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
108 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
109 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
110 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
113 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
114 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.81
Metatranscriptomes 19.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.51
Nodule 0
Rhizoplane 0.51
Rhizosphere 79.29
Stem 0
Stem Tuber 0
Unclassified 38.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070659_100860362 3300005366 Unclassified 791
2 Ga0058863_10699826 3300004799 Unclassified 588
3 Ga0058860_12195705 3300004801 Unclassified 542
4 Ga0058862_12485417 3300004803 Bacteria 1784
5 Ga0068868_100721573 3300005338 Bacteria 893
6 Ga0070660_100284131 3300005339 Unclassified 1354
7 Ga0070660_100294242 3300005339 Unclassified 1330
8 Ga0070661_101204430 3300005344 Bacteria 633
9 Ga0070659_100095468 3300005366 Unclassified 2388
10 Ga0070714_100001522 3300005435 Bacteria 16919
11 Ga0070713_100237131 3300005436 Bacteria 1660
12 Ga0070710_10156150 3300005437 Bacteria 1411
13 Ga0070711_100018683 3300005439 Bacteria 4431
14 Ga0070711_101811942 3300005439 Unclassified 536
15 Ga0070681_10066182 3300005458 Bacteria 3582
16 Ga0070679_101832153 3300005530 Unclassified 555
17 Ga0068853_100006537 3300005539 Bacteria 9279
18 Ga0070665_100138323 3300005548 Bacteria 2439
19 Ga0068855_100372540 3300005563 Unclassified 1569
20 Ga0070664_100046306 3300005564 Bacteria 3673
21 Ga0068856_100018026 3300005614 Bacteria 6846
22 Ga0068856_100052560 3300005614 Bacteria 4018
23 Ga0070717_10056127 3300006028 Bacteria 3253
24 Ga0070717_10088213 3300006028 Bacteria 2614
25 Ga0070717_10161126 3300006028 Bacteria 1946
26 Ga0070717_10779738 3300006028 Unclassified 869
27 Ga0070712_100193538 3300006175 Bacteria 1593
28 Ga0097621_100325612 3300006237 Bacteria 1362
29 Ga0068871_100324785 3300006358 Bacteria 1356
30 Ga0105240_10000499 3300009093 Bacteria 72315
31 Ga0105240_10046162 3300009093 Bacteria 5522
32 Ga0105237_10008304 3300009545 Bacteria 11267
33 Ga0105238_10803925 3300009551 Bacteria 956
34 Ga0105238_12081214 3300009551 Unclassified 602
35 Ga0105249_10180788 3300009553 Bacteria 2052
36 Ga0105249_13311253 3300009553 Unclassified 518
37 Ga0157373_10414359 3300013100 Unclassified 967
38 Ga0157373_10433110 3300013100 Bacteria 945
39 Ga0157371_10944139 3300013102 Bacteria 656
40 Ga0157369_10000849 3300013105 Bacteria 39030
41 Ga0157369_10063738 3300013105 Bacteria 3970
42 Ga0157374_10284181 3300013296 Unclassified 1634
43 Ga0157374_10874978 3300013296 Bacteria 916
44 Ga0157372_10421270 3300013307 Bacteria 1556
45 Ga0157372_11864368 3300013307 Bacteria 691
46 Ga0157380_10944006 3300014326 Bacteria 892
47 Ga0157376_10148476 3300014969 Bacteria 2111
48 Ga0157376_10722058 3300014969 Bacteria 1003
49 Ga0157376_10787211 3300014969 Unclassified 963
50 Ga0197907_10798945 3300020069 Bacteria 669
51 Ga0206356_11014061 3300020070 Bacteria 931
52 Ga0206356_11774801 3300020070 Unclassified 503
53 Ga0206349_1252138 3300020075 Bacteria 607
54 Ga0206349_1905958 3300020075 Bacteria 666
55 Ga0206355_1160183 3300020076 Unclassified 571
56 Ga0206355_1326114 3300020076 Unclassified 651
57 Ga0206351_10161033 3300020077 Unclassified 537
58 Ga0206351_10855444 3300020077 Unclassified 519
59 Ga0206351_10882586 3300020077 Unclassified 568
60 Ga0206352_10003009 3300020078 Bacteria 679
61 Ga0206350_10037743 3300020080 Unclassified 559
62 Ga0206350_11135664 3300020080 Unclassified 514
63 Ga0206350_11564252 3300020080 Unclassified 503
64 Ga0206350_11659721 3300020080 Unclassified 545
65 Ga0206354_11081263 3300020081 Bacteria 645
66 Ga0206354_11651044 3300020081 Unclassified 535
67 Ga0206353_11147392 3300020082 Unclassified 611
68 Ga0154015_1453496 3300020610 Unclassified 566
69 Ga0213873_10011889 3300021358 Bacteria 1876
70 Ga0213873_10099008 3300021358 Unclassified 836
71 Ga0213872_10002052 3300021361 Bacteria 12226
72 Ga0213874_10019113 3300021377 Bacteria 1861
73 Ga0213874_10048332 3300021377 Unclassified 1297
74 Ga0213874_10213792 3300021377 Unclassified 698
75 Ga0213876_10004731 3300021384 Bacteria 7568
76 Ga0213876_10006067 3300021384 Bacteria 6603
77 Ga0213876_10420357 3300021384 Unclassified 711
78 Ga0213875_10000192 3300021388 Bacteria 62634
79 Ga0213875_10003270 3300021388 Bacteria 9283
80 Ga0213875_10006708 3300021388 Bacteria 6014
81 Ga0213875_10015213 3300021388 Unclassified 3747
82 Ga0213875_10068903 3300021388 Bacteria 1652
83 Ga0213875_10197558 3300021388 Unclassified 946
84 Ga0213875_10210023 3300021388 Unclassified 916
85 Ga0213875_10294504 3300021388 Bacteria 767
86 Ga0224712_10088124 3300022467 Bacteria 1295
87 Ga0224712_10371429 3300022467 Unclassified 678
88 Ga0224712_10371669 3300022467 Unclassified 678
89 Ga0224712_10625042 3300022467 Unclassified 527
90 Ga0224712_10671292 3300022467 Unclassified 509
91 Ga0224712_10692800 3300022467 Unclassified 501
92 Ga0207699_10066367 3300025906 Bacteria 2190
93 Ga0207699_10082545 3300025906 Bacteria 1997
94 Ga0207695_10039979 3300025913 Bacteria 5036
95 Ga0207671_10022779 3300025914 Bacteria 4731
96 Ga0207693_10411696 3300025915 Unclassified 1057
97 Ga0207693_10426414 3300025915 Unclassified 1037
98 Ga0207663_10029383 3300025916 Bacteria 3228
99 Ga0207657_10262079 3300025919 Unclassified 1375
100 Ga0207657_10372709 3300025919 Bacteria 1125
101 Ga0207652_10521894 3300025921 Bacteria 1069
102 Ga0207700_10010716 3300025928 Bacteria 5804
103 Ga0207700_10187601 3300025928 Bacteria 1736
104 Ga0207664_10008763 3300025929 Bacteria 7075
105 Ga0207665_10371870 3300025939 Bacteria 1083
106 Ga0207667_10308786 3300025949 Unclassified 1616
107 Ga0207712_10690500 3300025961 Unclassified 890
108 Ga0207658_10196515 3300025986 Bacteria 1681
109 Ga0207639_10068483 3300026041 Bacteria 2766
110 Ga0207678_10017577 3300026067 Bacteria 6280
111 Ga0207702_10646289 3300026078 Bacteria 1040
112 Ga0207702_11091208 3300026078 Unclassified 792
113 Ga0207641_10018994 3300026088 Bacteria 5639
114 Ga0207676_11414677 3300026095 Unclassified 692
115 Ga0209966_1118210 3300027695 Bacteria 607
116 Ga0268266_10085380 3300028379 Bacteria 2758
117 Ga0265336_10118995 3300028666 Unclassified 787
118 Ga0265338_10055419 3300028800 Bacteria 3526
119 Ga0265338_10906866 3300028800 Unclassified 600
120 Ga0265330_10202381 3300031235 Bacteria 839
121 Ga0265330_10202883 3300031235 Bacteria 838
122 Ga0265320_10048113 3300031240 Bacteria 2082
123 Ga0265325_10084881 3300031241 Bacteria 1569
124 Ga0265340_10007303 3300031247 Bacteria 6006
125 Ga0265339_10113058 3300031249 Bacteria 1403
126 Ga0265331_10010643 3300031250 Bacteria 5077
127 Ga0265316_10024681 3300031344 Bacteria 5029
128 Ga0265316_10039934 3300031344 Bacteria 3765
129 Ga0310118_118481 3300031664 Unclassified 569
130 Ga0265314_10114114 3300031711 Unclassified 1712
131 Ga0265342_10174280 3300031712 Bacteria 1181
132 Ga0373934_0423957 3300035086 Unclassified 557
133 Ga0373954_0032111 3300035118 Bacteria 2426
134 Ga0373956_0299797 3300035119 Unclassified 765
135 Ga0373943_0293782 3300035170 Unclassified 921
136 Ga0373946_0715227 3300035171 Unclassified 524
137 Ga0373955_0186509 3300035172 Bacteria 1232
138 Ga0373935_0208930 3300035692 Unclassified 1352
139 Ga0373935_0347030 3300035692 Bacteria 1057
140 Ga0373927_0008353 3300035695 Bacteria 6969
141 Ga0373927_1029634 3300035695 Bacteria 543
142 Ga0373933_0300993 3300035724 Unclassified 1038
143 Ga0373933_0508857 3300035724 Unclassified 789
144 Ga0373947_0154691 3300035725 Bacteria 1479
145 Ga0373937_0059096 3300036401 Bacteria 3523
146 Ga0373937_0242606 3300036401 Bacteria 1698
147 Ga0373937_1973289 3300036401 Unclassified 530
148 Ga0265778_009875 3300036457 Unclassified 1080
149 Ga0265778_066707 3300036457 Unclassified 507
150 Ga0373925_0016220 3300037068 Bacteria 5393
151 Ga0373925_1703351 3300037068 Bacteria 515
152 Ga0395900_0807225 3300037418 Bacteria 866
153 Ga0436364_0124058 3300037853 Bacteria 5130
154 Ga0436364_0429070 3300037853 Unclassified 3717
155 Ga0436364_0431728 3300037853 Bacteria 222864
156 Ga0436364_0434557 3300037853 Unclassified 3381
157 Ga0436364_0494684 3300037853 Bacteria 912
158 Ga0436364_0627296 3300037853 Unclassified 639
159 Ga0436364_0938897 3300037853 Bacteria 7955
160 Ga0436364_0959022 3300037853 Bacteria 7024
161 Ga0436364_1110018 3300037853 Unclassified 753
162 Ga0436364_1139480 3300037853 Bacteria 2857
163 Ga0436364_1447310 3300037853 Unclassified 2232
164 Ga0436364_1550308 3300037853 Unclassified 707
165 Ga0395901_0429962 3300038443 Bacteria 1353
166 Ga0436365_0088952 3300039437 Bacteria 4628
167 Ga0436365_0802244 3300039437 Bacteria 1468
168 Ga0436365_1081933 3300039437 Bacteria 1088
169 Ga0436365_1333821 3300039437 Bacteria 828
170 Ga0436365_1377515 3300039437 Bacteria 627
171 Ga0436365_1716537 3300039437 Unclassified 1293
172 Ga0436361_0419405 3300039447 Bacteria 103155
173 Ga0436363_0032395 3300039450 Unclassified 1672
174 Ga0436363_0587577 3300039450 Bacteria 1169
175 Ga0436363_0629862 3300039450 Unclassified 1038
176 Ga0436363_1014699 3300039450 Unclassified 639
177 Ga0436363_1580854 3300039450 Bacteria 7832
178 Ga0436362_0726592 3300039453 Bacteria 1583
179 Ga0436362_0887540 3300039453 Bacteria 3649
180 Ga0466960_0237020 3300044901 Bacteria 1009
181 Ga0466958_0355884 3300045836 Unclassified 943
182 Ga0495580_0029673 3300046472 Bacteria 3968
183 Ga0495580_0037755 3300046472 Bacteria 3464
184 Ga0495666_0549437 3300046526 Unclassified 515
185 Ga0495635_0470187 3300046663 Bacteria 830
186 Ga0495646_0367278 3300046680 Unclassified 752
187 Ga0495684_0220475 3300047471 Bacteria 1391
188 Ga0496115_0002379 3300048918 Bacteria 13490
189 Ga0501308_086562 3300049128 Bacteria 505
190 Ga0501305_119356 3300049161 Archaea 505
191 Ga0501233_062599 3300049668 Bacteria 927
192 Ga0500604_0029636 3300053151 Bacteria 1597
193 Ga0587073_0030190 3300059492 Bacteria 1113
194 Ga0587082_083183 3300059504 Bacteria 671
195 Ga0587083_0015613 3300059505 Bacteria 1329
196 Ga0587075_123023 3300059644 Unclassified 539
197 Ga0587111_0012924 3300060346 Bacteria 1483
198 Ga0466962_0208888 3300061719 Unclassified 955
199 Ga0070659_100860362
200 Ga0058863_10699826
201 Ga0058860_12195705
202 Ga0058862_12485417
203 Ga0068868_100721573
204 Ga0070660_100284131
205 Ga0070660_100294242
206 Ga0070661_101204430
207 Ga0070659_100095468
208 Ga0070714_100001522
209 Ga0070713_100237131
210 Ga0070710_10156150
211 Ga0070711_100018683
212 Ga0070711_101811942
213 Ga0070681_10066182
214 Ga0070679_101832153
215 Ga0068853_100006537
216 Ga0070665_100138323
217 Ga0068855_100372540
218 Ga0070664_100046306
219 Ga0068856_100018026
220 Ga0068856_100052560
221 Ga0070717_10056127
222 Ga0070717_10088213
223 Ga0070717_10161126
224 Ga0070717_10779738
225 Ga0070712_100193538
226 Ga0097621_100325612
227 Ga0068871_100324785
228 Ga0105240_10000499
229 Ga0105240_10046162
230 Ga0105237_10008304
231 Ga0105238_10803925
232 Ga0105238_12081214
233 Ga0105249_10180788
234 Ga0105249_13311253
235 Ga0157373_10414359
236 Ga0157373_10433110
237 Ga0157371_10944139
238 Ga0157369_10000849
239 Ga0157369_10063738
240 Ga0157374_10284181
241 Ga0157374_10874978
242 Ga0157372_10421270
243 Ga0157372_11864368
244 Ga0157380_10944006
245 Ga0157376_10148476
246 Ga0157376_10722058
247 Ga0157376_10787211
248 Ga0197907_10798945
249 Ga0206356_11014061
250 Ga0206356_11774801
251 Ga0206349_1252138
252 Ga0206349_1905958
253 Ga0206355_1160183
254 Ga0206355_1326114
255 Ga0206351_10161033
256 Ga0206351_10855444
257 Ga0206351_10882586
258 Ga0206352_10003009
259 Ga0206350_10037743
260 Ga0206350_11135664
261 Ga0206350_11564252
262 Ga0206350_11659721
263 Ga0206354_11081263
264 Ga0206354_11651044
265 Ga0206353_11147392
266 Ga0154015_1453496
267 Ga0213873_10011889
268 Ga0213873_10099008
269 Ga0213872_10002052
270 Ga0213874_10019113
271 Ga0213874_10048332
272 Ga0213874_10213792
273 Ga0213876_10004731
274 Ga0213876_10006067
275 Ga0213876_10420357
276 Ga0213875_10000192
277 Ga0213875_10003270
278 Ga0213875_10006708
279 Ga0213875_10015213
280 Ga0213875_10068903
281 Ga0213875_10197558
282 Ga0213875_10210023
283 Ga0213875_10294504
284 Ga0224712_10088124
285 Ga0224712_10371429
286 Ga0224712_10371669
287 Ga0224712_10625042
288 Ga0224712_10671292
289 Ga0224712_10692800
290 Ga0207699_10066367
291 Ga0207699_10082545
292 Ga0207695_10039979
293 Ga0207671_10022779
294 Ga0207693_10411696
295 Ga0207693_10426414
296 Ga0207663_10029383
297 Ga0207657_10262079
298 Ga0207657_10372709
299 Ga0207652_10521894
300 Ga0207700_10010716
301 Ga0207700_10187601
302 Ga0207664_10008763
303 Ga0207665_10371870
304 Ga0207667_10308786
305 Ga0207712_10690500
306 Ga0207658_10196515
307 Ga0207639_10068483
308 Ga0207678_10017577
309 Ga0207702_10646289
310 Ga0207702_11091208
311 Ga0207641_10018994
312 Ga0207676_11414677
313 Ga0209966_1118210
314 Ga0268266_10085380
315 Ga0265336_10118995
316 Ga0265338_10055419
317 Ga0265338_10906866
318 Ga0265330_10202381
319 Ga0265330_10202883
320 Ga0265320_10048113
321 Ga0265325_10084881
322 Ga0265340_10007303
323 Ga0265339_10113058
324 Ga0265331_10010643
325 Ga0265316_10024681
326 Ga0265316_10039934
327 Ga0310118_118481
328 Ga0265314_10114114
329 Ga0265342_10174280
330 Ga0373934_0423957
331 Ga0373954_0032111
332 Ga0373956_0299797
333 Ga0373943_0293782
334 Ga0373946_0715227
335 Ga0373955_0186509
336 Ga0373935_0208930
337 Ga0373935_0347030
338 Ga0373927_0008353
339 Ga0373927_1029634
340 Ga0373933_0300993
341 Ga0373933_0508857
342 Ga0373947_0154691
343 Ga0373937_0059096
344 Ga0373937_0242606
345 Ga0373937_1973289
346 Ga0265778_009875
347 Ga0265778_066707
348 Ga0373925_0016220
349 Ga0373925_1703351
350 Ga0395900_0807225
351 Ga0436364_0124058
352 Ga0436364_0429070
353 Ga0436364_0431728
354 Ga0436364_0434557
355 Ga0436364_0494684
356 Ga0436364_0627296
357 Ga0436364_0938897
358 Ga0436364_0959022
359 Ga0436364_1110018
360 Ga0436364_1139480
361 Ga0436364_1447310
362 Ga0436364_1550308
363 Ga0395901_0429962
364 Ga0436365_0088952
365 Ga0436365_0802244
366 Ga0436365_1081933
367 Ga0436365_1333821
368 Ga0436365_1377515
369 Ga0436365_1716537
370 Ga0436361_0419405
371 Ga0436363_0032395
372 Ga0436363_0587577
373 Ga0436363_0629862
374 Ga0436363_1014699
375 Ga0436363_1580854
376 Ga0436362_0726592
377 Ga0436362_0887540
378 Ga0466960_0237020
379 Ga0466958_0355884
380 Ga0495580_0029673
381 Ga0495580_0037755
382 Ga0495666_0549437
383 Ga0495635_0470187
384 Ga0495646_0367278
385 Ga0495684_0220475
386 Ga0496115_0002379
387 Ga0501308_086562
388 Ga0501305_119356
389 Ga0501233_062599
390 Ga0500604_0029636
391 Ga0587073_0030190
392 Ga0587082_083183
393 Ga0587083_0015613
394 Ga0587075_123023
395 Ga0587111_0012924
396 Ga0466962_0208888

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

64

165

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.9233 38 130
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.9175 40 130
5ds2-assembly2.cif.gz_D core domain of the class i small heat-shock protein hsp 18.1 from pisum sativum 0.9049 38 130
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.8898 40 130
5zul-assembly1.cif.gz_C-2 small heat shock protein from mycobacterium marinum m : form-3 0.8699 33 130
ID Description Score Start End Superfamily
af_Q8S1F2_1_96_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.935 36 134 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9233 38 130 2.60.40.790
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.9049 38 130 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8931 35 130 2.60.40.790
af_I1MKZ4_1_104_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8905 35 131 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A7J8L7X3-F1-model_v4 SHSP domain-containing protein 0.901 30 132
AF-I4S4I6-F1-model_v4 deleted 0.8882 33 117
AF-A0A7J8L7X3-F1-model_v4 SHSP domain-containing protein 0.8847 30 132
AF-A0A0F3RD98-F1-model_v4 Hsp20/alpha crystallin family protein 0.8815 38 142 GO:0009408
AF-A0A2D8YXE9-F1-model_v4 SHSP domain-containing protein 0.8802 35 145

Map