F303645

General Info

Members Datasets Scaffolds Average Seq Length
197 153 394 270

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_012550|Ga0500643_012550_1629_2537
Length 302
Sequence MDPRLRGDDGKELTRNPTKSFKIKGTIMSKLNGKVAIISGSGRGIGRALALKLAGEGAAVVVNDLDEGPAAETVAAIEAAGGRAVACVGNVTAEDFGERFVQTAIDTFGGLDIIVNNAGYTRDGVIQKQTDEQFQAMLDVHVLAPFRILRAAAEPIRTMAKVEAAEGREVIRKVVNISSMAGTHGNAGQVNYSSAKAALVGMTKTLAKEWGRHKVCVNCVAFGFIETRLTKANDNPETRIEIEGKQIQAGVPGAVLGQLKTMVPLGRAGTPEEAAGGVYLFCAPESDYISGEVLIVGGGLSL

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
31 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
43 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
44 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
82 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
86 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
87 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
92 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
93 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
96 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
99 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
100 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
101 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
102 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
103 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
104 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
105 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
106 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
107 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
108 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
109 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
110 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
113 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
114 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
115 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
116 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
117 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
120 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
121 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
122 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
123 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
124 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
127 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
128 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
129 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
130 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
131 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
134 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
137 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
139 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
140 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
141 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
142 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
143 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
144 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
145 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
146 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
147 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
148 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
149 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
150 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
151 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
152 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
153 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.48
Metatranscriptomes 0
Isolates 1.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.14
Nodule 0
Rhizoplane 2.03
Rhizosphere 83.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_012550 3300053087 Bacteria 3029
2 Ga0055536_1001268 3300003781 Bacteria 15563
3 Ga0065707_10082595 3300005295 Bacteria 13504
4 Ga0070690_100037898 3300005330 Bacteria 3040
5 Ga0070670_100107587 3300005331 Bacteria 2403
6 Ga0068869_100317539 3300005334 Bacteria 1262
7 Ga0070666_10012032 3300005335 Bacteria 5447
8 Ga0070687_100052214 3300005343 Bacteria 2121
9 Ga0070669_100338545 3300005353 Bacteria 1218
10 Ga0070675_100137848 3300005354 Bacteria 2083
11 Ga0070671_100000510 3300005355 Bacteria 27158
12 Ga0070659_100155955 3300005366 Bacteria 1865
13 Ga0070713_100042415 3300005436 Bacteria 3713
14 Ga0070713_100214808 3300005436 Bacteria 1743
15 Ga0070708_100000010 3300005445 Bacteria 137980
16 Ga0070663_100214761 3300005455 Bacteria 1508
17 Ga0070685_10110499 3300005466 Bacteria 1692
18 Ga0070706_100104379 3300005467 Bacteria 2636
19 Ga0070672_100134542 3300005543 Bacteria 2035
20 Ga0070672_100170929 3300005543 Bacteria 1807
21 Ga0070665_100126161 3300005548 Bacteria 2562
22 Ga0068855_100001932 3300005563 Bacteria 25739
23 Ga0068855_100003469 3300005563 Bacteria 19302
24 Ga0070664_100170834 3300005564 Bacteria 1928
25 Ga0070664_100408668 3300005564 Bacteria 1242
26 Ga0068856_100208433 3300005614 Bacteria 1969
27 Ga0070702_100215817 3300005615 Bacteria 1280
28 Ga0068859_100000676 3300005617 Bacteria 34199
29 Ga0068859_100025795 3300005617 Bacteria 5896
30 Ga0068859_100080926 3300005617 Bacteria 3289
31 Ga0068864_100059915 3300005618 Bacteria 3295
32 Ga0068864_100962241 3300005618 Bacteria 845
33 Ga0068863_100013762 3300005841 Bacteria 7798
34 Ga0068858_100001175 3300005842 Bacteria 27134
35 Ga0068860_100022485 3300005843 Bacteria 6097
36 Ga0068860_100027785 3300005843 Bacteria 5448
37 Ga0097621_100137561 3300006237 Bacteria 2085
38 Ga0075429_100185262 3300006880 Bacteria 1824
39 Ga0075436_100264128 3300006914 Bacteria 1228
40 Ga0097620_100000676 3300006931 Bacteria 34199
41 Ga0097620_100025799 3300006931 Bacteria 5896
42 Ga0097620_100080925 3300006931 Bacteria 3289
43 Ga0075435_100401854 3300007076 Bacteria 1178
44 Ga0105250_10009416 3300009092 Bacteria 4114
45 Ga0105240_10000227 3300009093 Bacteria 112637
46 Ga0105240_10000305 3300009093 Bacteria 94979
47 Ga0105240_10030085 3300009093 Bacteria 7062
48 Ga0105240_10087428 3300009093 Bacteria 3817
49 Ga0105245_10450514 3300009098 Bacteria 1295
50 Ga0105247_10000055 3300009101 Bacteria 134197
51 Ga0105247_10022753 3300009101 Bacteria 3774
52 Ga0105242_10062566 3300009176 Bacteria 3063
53 Ga0105242_10124493 3300009176 Bacteria 2217
54 Ga0105248_10010294 3300009177 Bacteria 10295
55 Ga0105237_10007068 3300009545 Bacteria 12342
56 Ga0105237_10243909 3300009545 Bacteria 1798
57 Ga0105238_10009923 3300009551 Bacteria 9546
58 Ga0105249_10070512 3300009553 Bacteria 3226
59 Ga0105249_10075643 3300009553 Bacteria 3119
60 Ga0105239_10000037 3300010375 Bacteria 206779
61 Ga0157370_10010381 3300013104 Bacteria 9820
62 Ga0163162_10007868 3300013306 Bacteria 10385
63 Ga0163162_10043108 3300013306 Bacteria 4517
64 Ga0163162_10638851 3300013306 Bacteria 1189
65 Ga0163162_10985570 3300013306 Bacteria 953
66 Ga0157372_10209088 3300013307 Bacteria 2261
67 Ga0157375_10189043 3300013308 Bacteria 2214
68 Ga0157375_10527857 3300013308 Bacteria 1343
69 Ga0163163_10020434 3300014325 Bacteria 6234
70 Ga0157380_10000493 3300014326 Bacteria 24065
71 Ga0157379_10010055 3300014968 Bacteria 8245
72 Ga0157379_10279484 3300014968 Bacteria 1519
73 Ga0209676_1000296 3300025292 Bacteria 100635
74 Ga0209758_1003965 3300025297 Bacteria 12835
75 Ga0209050_1036093 3300025298 Bacteria 1450
76 Ga0207710_10000398 3300025900 Bacteria 29022
77 Ga0207645_10018094 3300025907 Bacteria 4644
78 Ga0207684_10239644 3300025910 Bacteria 1565
79 Ga0207695_10000594 3300025913 Bacteria 72855
80 Ga0207695_10000657 3300025913 Bacteria 68406
81 Ga0207695_10023802 3300025913 Bacteria 6912
82 Ga0207695_10075844 3300025913 Bacteria 3420
83 Ga0207671_10234352 3300025914 Bacteria 1441
84 Ga0207662_10048418 3300025918 Bacteria 2518
85 Ga0207657_10077289 3300025919 Bacteria 2806
86 Ga0207646_10104605 3300025922 Bacteria 2539
87 Ga0207681_10136043 3300025923 Bacteria 1824
88 Ga0207694_10110088 3300025924 Bacteria 2190
89 Ga0207650_10074492 3300025925 Bacteria 2559
90 Ga0207650_10572348 3300025925 Bacteria 948
91 Ga0207700_10077688 3300025928 Bacteria 2580
92 Ga0207686_10158483 3300025934 Bacteria 1584
93 Ga0207709_10028819 3300025935 Bacteria 3213
94 Ga0207670_10559680 3300025936 Bacteria 935
95 Ga0207691_10016527 3300025940 Bacteria 7007
96 Ga0207691_10268522 3300025940 Bacteria 1469
97 Ga0207691_10347424 3300025940 Bacteria 1269
98 Ga0207711_10292718 3300025941 Bacteria 1501
99 Ga0207689_10125112 3300025942 Bacteria 2115
100 Ga0207661_10009837 3300025944 Bacteria 6869
101 Ga0207667_10022445 3300025949 Bacteria 6971
102 Ga0207667_10040083 3300025949 Bacteria 4987
103 Ga0207712_10031379 3300025961 Bacteria 3578
104 Ga0207712_10300565 3300025961 Bacteria 1317
105 Ga0207658_10319810 3300025986 Bacteria 1343
106 Ga0207703_10321256 3300026035 Bacteria 1418
107 Ga0207708_10452213 3300026075 Bacteria 1070
108 Ga0207641_10003886 3300026088 Bacteria 13071
109 Ga0207648_10165477 3300026089 Bacteria 1954
110 Ga0268266_10712410 3300028379 Bacteria 968
111 Ga0265338_10007789 3300028800 Bacteria 13174
112 Ga0265327_10011342 3300031251 Bacteria 6146
113 Ga0307408_100425025 3300031548 Bacteria 1147
114 Ga0307406_10531563 3300031901 Bacteria 959
115 Ga0373956_0004101 3300035119 Bacteria 5845
116 Ga0373955_0026139 3300035172 Bacteria 3004
117 Ga0373933_0004779 3300035724 Bacteria 7403
118 Ga0373937_0001481 3300036401 Bacteria 19687
119 Ga0373937_0469775 3300036401 Bacteria 1195
120 Ga0395899_0203740 3300037312 Bacteria 1378
121 Ga0395899_0260470 3300037312 Bacteria 1186
122 Ga0395900_0001580 3300037418 Bacteria 26952
123 Ga0395898_0258254 3300037466 Bacteria 1662
124 Ga0395905_0002376 3300037471 Bacteria 20965
125 Ga0395901_0001664 3300038443 Bacteria 22942
126 Ga0436361_0399993 3300039447 Bacteria 1686
127 Ga0450920_024667 3300042122 Bacteria 1169
128 Ga0495590_0059856 3300046457 Bacteria 1333
129 Ga0495629_0001600 3300046459 Bacteria 17805
130 Ga0495639_0142690 3300046475 Bacteria 1152
131 Ga0495639_0197946 3300046475 Bacteria 983
132 Ga0495584_0012319 3300046491 Bacteria 4365
133 Ga0495594_0090968 3300046499 Bacteria 1710
134 Ga0495606_0119273 3300046507 Bacteria 1581
135 Ga0495628_0149584 3300046516 Bacteria 1779
136 Ga0495652_0275548 3300046529 Bacteria 1234
137 Ga0495654_0024041 3300046530 Bacteria 3151
138 Ga0495665_0125750 3300046531 Bacteria 1343
139 Ga0495587_0003709 3300046536 Bacteria 10150
140 Ga0495597_0013765 3300046542 Bacteria 3868
141 Ga0495645_0000260 3300046543 Bacteria 38847
142 Ga0495668_0005258 3300046616 Bacteria 8862
143 Ga0495625_0001493 3300046660 Bacteria 28141
144 Ga0495661_0002439 3300046665 Bacteria 14321
145 Ga0495599_0036888 3300046678 Bacteria 3071
146 Ga0495623_0003130 3300046679 Bacteria 10906
147 Ga0495613_0123441 3300046689 Bacteria 1858
148 Ga0495671_0130742 3300046692 Bacteria 1224
149 Ga0495649_0000039 3300046694 Bacteria 126399
150 Ga0495600_0038723 3300046809 Bacteria 3103
151 Ga0495581_0015693 3300047315 Bacteria 4397
152 Ga0495672_0001287 3300047320 Bacteria 25003
153 Ga0495687_095575 3300047443 Bacteria 1126
154 Ga0495675_0145913 3300047444 Bacteria 1464
155 Ga0495684_0052266 3300047471 Bacteria 3118
156 Ga0495684_0056200 3300047471 Bacteria 3001
157 Ga0496108_0121505 3300048911 Bacteria 2241
158 Ga0496109_0020262 3300048912 Bacteria 5874
159 Ga0496112_0069274 3300048915 Bacteria 3485
160 Ga0496115_0004224 3300048918 Bacteria 10384
161 Ga0496121_0000066 3300048924 Bacteria 267065
162 Ga0496121_0000572 3300048924 Bacteria 69364
163 Ga0496121_0002260 3300048924 Bacteria 30007
164 Ga0496124_0414834 3300048927 Bacteria 930
165 Ga0496125_0035449 3300048928 Bacteria 4375
166 Ga0496126_0144561 3300048929 Bacteria 2044
167 Ga0496126_0334536 3300048929 Bacteria 1242
168 Ga0501034_0116918 3300049571 Bacteria 2654
169 Ga0501047_0107953 3300049581 Bacteria 2665
170 Ga0501069_0045531 3300049585 Bacteria 2431
171 Ga0501070_0089567 3300049586 Bacteria 2546
172 Ga0501070_0218952 3300049586 Bacteria 1561
173 Ga0501071_0001866 3300049587 Bacteria 12495
174 Ga0501074_0133028 3300049590 Bacteria 1779
175 Ga0501035_0574287 3300049822 Bacteria 921
176 Ga0501044_0001294 3300049823 Bacteria 29569
177 Ga0501044_0356751 3300049823 Bacteria 1381
178 nmdc:mga09592_196805_c1 3300050508 Bacteria 1745
179 nmdc:mga0n895_126525_c1 3300050512 Bacteria 2579
180 nmdc:mga0rr50_377466_c1 3300050513 Bacteria 1195
181 Ga0500643_004387 3300053087 Bacteria 6401
182 Ga0500643_005945 3300053087 Bacteria 5175
183 Ga0500643_009433 3300053087 Bacteria 3731
184 Ga0500562_013388 3300053108 Bacteria 2094
185 Ga0500592_000455 3300053116 Bacteria 6808
186 Ga0500559_0019747 3300053136 Bacteria 2848
187 Ga0500568_0000330 3300053139 Bacteria 37262
188 Ga0500568_0002627 3300053139 Bacteria 10441
189 Ga0500624_000903 3300053157 Bacteria 6303
190 Ga0500627_0000002 3300053158 Bacteria 235747
191 Ga0500627_0000047 3300053158 Bacteria 59191
192 Ga0500636_0006379 3300053177 Bacteria 6766
193 Ga0500596_001401 3300053735 Bacteria 4876
194 Ga0501082_0117099 3300060353 Bacteria 2308
195 2643832261 2643221563 Bacteria 4726935
196 2644053944 2643221608 Bacteria 4724829
197 2915359907 2915358134 Bacteria 6050864
198 Ga0500643_012550
199 Ga0055536_1001268
200 Ga0065707_10082595
201 Ga0070690_100037898
202 Ga0070670_100107587
203 Ga0068869_100317539
204 Ga0070666_10012032
205 Ga0070687_100052214
206 Ga0070669_100338545
207 Ga0070675_100137848
208 Ga0070671_100000510
209 Ga0070659_100155955
210 Ga0070713_100042415
211 Ga0070713_100214808
212 Ga0070708_100000010
213 Ga0070663_100214761
214 Ga0070685_10110499
215 Ga0070706_100104379
216 Ga0070672_100134542
217 Ga0070672_100170929
218 Ga0070665_100126161
219 Ga0068855_100001932
220 Ga0068855_100003469
221 Ga0070664_100170834
222 Ga0070664_100408668
223 Ga0068856_100208433
224 Ga0070702_100215817
225 Ga0068859_100000676
226 Ga0068859_100025795
227 Ga0068859_100080926
228 Ga0068864_100059915
229 Ga0068864_100962241
230 Ga0068863_100013762
231 Ga0068858_100001175
232 Ga0068860_100022485
233 Ga0068860_100027785
234 Ga0097621_100137561
235 Ga0075429_100185262
236 Ga0075436_100264128
237 Ga0097620_100000676
238 Ga0097620_100025799
239 Ga0097620_100080925
240 Ga0075435_100401854
241 Ga0105250_10009416
242 Ga0105240_10000227
243 Ga0105240_10000305
244 Ga0105240_10030085
245 Ga0105240_10087428
246 Ga0105245_10450514
247 Ga0105247_10000055
248 Ga0105247_10022753
249 Ga0105242_10062566
250 Ga0105242_10124493
251 Ga0105248_10010294
252 Ga0105237_10007068
253 Ga0105237_10243909
254 Ga0105238_10009923
255 Ga0105249_10070512
256 Ga0105249_10075643
257 Ga0105239_10000037
258 Ga0157370_10010381
259 Ga0163162_10007868
260 Ga0163162_10043108
261 Ga0163162_10638851
262 Ga0163162_10985570
263 Ga0157372_10209088
264 Ga0157375_10189043
265 Ga0157375_10527857
266 Ga0163163_10020434
267 Ga0157380_10000493
268 Ga0157379_10010055
269 Ga0157379_10279484
270 Ga0209676_1000296
271 Ga0209758_1003965
272 Ga0209050_1036093
273 Ga0207710_10000398
274 Ga0207645_10018094
275 Ga0207684_10239644
276 Ga0207695_10000594
277 Ga0207695_10000657
278 Ga0207695_10023802
279 Ga0207695_10075844
280 Ga0207671_10234352
281 Ga0207662_10048418
282 Ga0207657_10077289
283 Ga0207646_10104605
284 Ga0207681_10136043
285 Ga0207694_10110088
286 Ga0207650_10074492
287 Ga0207650_10572348
288 Ga0207700_10077688
289 Ga0207686_10158483
290 Ga0207709_10028819
291 Ga0207670_10559680
292 Ga0207691_10016527
293 Ga0207691_10268522
294 Ga0207691_10347424
295 Ga0207711_10292718
296 Ga0207689_10125112
297 Ga0207661_10009837
298 Ga0207667_10022445
299 Ga0207667_10040083
300 Ga0207712_10031379
301 Ga0207712_10300565
302 Ga0207658_10319810
303 Ga0207703_10321256
304 Ga0207708_10452213
305 Ga0207641_10003886
306 Ga0207648_10165477
307 Ga0268266_10712410
308 Ga0265338_10007789
309 Ga0265327_10011342
310 Ga0307408_100425025
311 Ga0307406_10531563
312 Ga0373956_0004101
313 Ga0373955_0026139
314 Ga0373933_0004779
315 Ga0373937_0001481
316 Ga0373937_0469775
317 Ga0395899_0203740
318 Ga0395899_0260470
319 Ga0395900_0001580
320 Ga0395898_0258254
321 Ga0395905_0002376
322 Ga0395901_0001664
323 Ga0436361_0399993
324 Ga0450920_024667
325 Ga0495590_0059856
326 Ga0495629_0001600
327 Ga0495639_0142690
328 Ga0495639_0197946
329 Ga0495584_0012319
330 Ga0495594_0090968
331 Ga0495606_0119273
332 Ga0495628_0149584
333 Ga0495652_0275548
334 Ga0495654_0024041
335 Ga0495665_0125750
336 Ga0495587_0003709
337 Ga0495597_0013765
338 Ga0495645_0000260
339 Ga0495668_0005258
340 Ga0495625_0001493
341 Ga0495661_0002439
342 Ga0495599_0036888
343 Ga0495623_0003130
344 Ga0495613_0123441
345 Ga0495671_0130742
346 Ga0495649_0000039
347 Ga0495600_0038723
348 Ga0495581_0015693
349 Ga0495672_0001287
350 Ga0495687_095575
351 Ga0495675_0145913
352 Ga0495684_0052266
353 Ga0495684_0056200
354 Ga0496108_0121505
355 Ga0496109_0020262
356 Ga0496112_0069274
357 Ga0496115_0004224
358 Ga0496121_0000066
359 Ga0496121_0000572
360 Ga0496121_0002260
361 Ga0496124_0414834
362 Ga0496125_0035449
363 Ga0496126_0144561
364 Ga0496126_0334536
365 Ga0501034_0116918
366 Ga0501047_0107953
367 Ga0501069_0045531
368 Ga0501070_0089567
369 Ga0501070_0218952
370 Ga0501071_0001866
371 Ga0501074_0133028
372 Ga0501035_0574287
373 Ga0501044_0001294
374 Ga0501044_0356751
375 nmdc:mga09592_196805_c1
376 nmdc:mga0n895_126525_c1
377 nmdc:mga0rr50_377466_c1
378 Ga0500643_004387
379 Ga0500643_005945
380 Ga0500643_009433
381 Ga0500562_013388
382 Ga0500592_000455
383 Ga0500559_0019747
384 Ga0500568_0000330
385 Ga0500568_0002627
386 Ga0500624_000903
387 Ga0500627_0000002
388 Ga0500627_0000047
389 Ga0500636_0006379
390 Ga0500596_001401
391 Ga0501082_0117099
392 2643832261
393 2644053944
394 2915359907

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

34

238

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

40

301

0.9

PF08659

KR

KR domain

34

226

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ixm-assembly1.cif.gz_B crystal structure of the ketone reductase chkred20 from the genome of chryseobacterium sp. ca49 complexed with nad 0.9589 4 274
4weo-assembly1.cif.gz_C crystal structure of a putative acetoin(diacetyl) reductase burkholderia cenocepacia 0.9585 3 273
4ni5-assembly1.cif.gz_A crystal structure of a short chain dehydrogenase from brucella suis 0.9583 3 274
7ucw-assembly1.cif.gz_B structure of mouse decr1 in complex with 2'-5' oligoadenylate 0.957 2 272
8hs5-assembly1.cif.gz_A brucella melitensis 7-alpha-hydroxysteroid dehydrogenase mutant: 1-53 truncation-i258m/k262t-nad+ 0.9565 4 272
ID Description Score Start End Superfamily
6ixmB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 4 274 3.40.50.720
4ni5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 3 274 3.40.50.720
af_A0A0P0X9U1_21_128_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.954 2 92 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9526 3 273 3.40.50.720
2c07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9524 5 275 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1C7MRI6-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase FabG 0.9746 4 226 GO:0016491
AF-X1HCU3-F1-model_v4 Uncharacterized protein 0.9738 1 91
AF-A0A7W1NW92-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9695 1 152
AF-A0A2N0QKI9-F1-model_v4 NAD(P)-binding protein 0.9671 4 127 GO:0005829
GO:0009688
GO:0010301
AF-A0A6B3ENR7-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9664 2 80 GO:0016491

Map