F303002

General Info

Members Datasets Scaffolds Average Seq Length
197 146 394 130

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_11567090|Ga0105239_115670901
Length 152
Sequence LSRDSFTDLARRVALLLQAQSDEEQMTSATVNVRYLVDDVEAAISWYTGHLGFYLLSNQAPAFADVKLGSLRLLLSGPKSSAARPMGDGSRPGPGGWNRIHLIVDDLLAEISRLKAEGVELRNDIVTGPGGSQILLVDPSGNLVELFELARH

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
55 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
61 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
62 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
102 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
103 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
112 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
117 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
120 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
121 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
122 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
123 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
124 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
125 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
126 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
127 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
128 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
129 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
135 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
136 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
137 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
138 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
139 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
140 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
141 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
142 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
143 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
144 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
145 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
146 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 0
Rhizoplane 5.08
Rhizosphere 90.86
Stem 0
Stem Tuber 0
Unclassified 8.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_11567090 3300010375 Unclassified 762
2 JGI25407J50210_10102288 3300003373 Bacteria 708
3 Ga0065712_10157904 3300005290 Bacteria 1322
4 Ga0065707_10633677 3300005295 Unclassified 642
5 Ga0070683_100007979 3300005329 Bacteria 8982
6 Ga0070683_100051982 3300005329 Unclassified 3795
7 Ga0070670_100702533 3300005331 Bacteria 909
8 Ga0070666_10690055 3300005335 Bacteria 748
9 Ga0070666_10994805 3300005335 Bacteria 622
10 Ga0070680_100324778 3300005336 Unclassified 1306
11 Ga0070682_100634796 3300005337 Bacteria 848
12 Ga0068868_101558138 3300005338 Bacteria 620
13 Ga0070669_101267510 3300005353 Bacteria 638
14 Ga0070675_100892903 3300005354 Bacteria 814
15 Ga0070671_100313357 3300005355 Bacteria 1337
16 Ga0070709_10375350 3300005434 Bacteria 1056
17 Ga0070714_100248729 3300005435 Bacteria 1643
18 Ga0070713_102288625 3300005436 Bacteria 523
19 Ga0070710_10132275 3300005437 Bacteria 1522
20 Ga0070700_101459579 3300005441 Bacteria 580
21 Ga0070694_100979836 3300005444 Bacteria 701
22 Ga0070678_101920802 3300005456 Unclassified 559
23 Ga0070681_10773009 3300005458 Bacteria 877
24 Ga0070698_100244556 3300005471 Bacteria 1727
25 Ga0070699_100000717 3300005518 Bacteria 30798
26 Ga0070699_100869883 3300005518 Unclassified 825
27 Ga0070679_100171082 3300005530 Bacteria 2145
28 Ga0070684_100067654 3300005535 Bacteria 3139
29 Ga0070686_100475681 3300005544 Bacteria 965
30 Ga0070696_100795436 3300005546 Bacteria 778
31 Ga0070665_102555180 3300005548 Bacteria 512
32 Ga0068857_100960614 3300005577 Bacteria 821
33 Ga0068859_100005295 3300005617 Bacteria 13118
34 Ga0068859_100996823 3300005617 Bacteria 920
35 Ga0068861_100012369 3300005719 Bacteria 5951
36 Ga0068858_100333526 3300005842 Bacteria 1451
37 Ga0068860_100000051 3300005843 Bacteria 208179
38 Ga0068860_100276507 3300005843 Bacteria 1640
39 Ga0068860_100569791 3300005843 Bacteria 1136
40 Ga0068862_100153458 3300005844 Unclassified 2051
41 Ga0068862_100206345 3300005844 Bacteria 1774
42 Ga0068862_100693682 3300005844 Bacteria 986
43 Ga0081455_10033963 3300005937 Bacteria 4576
44 Ga0081538_10030279 3300005981 Bacteria 3678
45 Ga0081538_10044118 3300005981 Bacteria 2786
46 Ga0070717_10192142 3300006028 Bacteria 1784
47 Ga0070712_100412950 3300006175 Bacteria 1117
48 Ga0075428_100001779 3300006844 Bacteria 23012
49 Ga0075428_100098743 3300006844 Bacteria 3183
50 Ga0075430_100011162 3300006846 Bacteria 7615
51 Ga0075430_100167603 3300006846 Bacteria 1827
52 Ga0075430_100756292 3300006846 Bacteria 801
53 Ga0075431_100003137 3300006847 Bacteria 15989
54 Ga0075431_100968418 3300006847 Bacteria 819
55 Ga0075429_100003912 3300006880 Bacteria 12726
56 Ga0075429_100066615 3300006880 Bacteria 3135
57 Ga0068865_100000361 3300006881 Bacteria 25141
58 Ga0068865_100565607 3300006881 Bacteria 957
59 Ga0097620_100005295 3300006931 Bacteria 13118
60 Ga0097620_100192207 3300006931 Bacteria 2125
61 Ga0097620_100996472 3300006931 Bacteria 920
62 Ga0099795_10423457 3300007788 Bacteria 609
63 Ga0105240_10008432 3300009093 Bacteria 14744
64 Ga0105240_10236001 3300009093 Bacteria 2122
65 Ga0111539_10360768 3300009094 Bacteria 1691
66 Ga0111539_11663310 3300009094 Bacteria 740
67 Ga0105245_10047487 3300009098 Bacteria 3838
68 Ga0114129_10001355 3300009147 Bacteria 32892
69 Ga0114129_10001963 3300009147 Bacteria 28149
70 Ga0114129_10053874 3300009147 Bacteria 5642
71 Ga0114129_10891709 3300009147 Bacteria 1128
72 Ga0105243_10256182 3300009148 Bacteria 1565
73 Ga0105241_11877694 3300009174 Bacteria 587
74 Ga0105242_10162291 3300009176 Bacteria 1957
75 Ga0105242_11414196 3300009176 Bacteria 723
76 Ga0105249_10151847 3300009553 Unclassified 2231
77 Ga0105249_10267265 3300009553 Bacteria 1702
78 Ga0105239_10328409 3300010375 Bacteria 1725
79 Ga0105239_12132724 3300010375 Bacteria 651
80 Ga0105246_12064403 3300011119 Bacteria 551
81 Ga0157369_11285546 3300013105 Bacteria 746
82 Ga0157375_10521674 3300013308 Unclassified 1351
83 Ga0157375_10777709 3300013308 Bacteria 1107
84 Ga0163163_10199112 3300014325 Bacteria 2051
85 Ga0163163_12804014 3300014325 Bacteria 544
86 Ga0157380_10234637 3300014326 Bacteria 1650
87 Ga0157380_10473225 3300014326 Bacteria 1209
88 Ga0157377_10239697 3300014745 Bacteria 1170
89 Ga0157379_10408347 3300014968 Bacteria 1249
90 Ga0157379_10581976 3300014968 Bacteria 1044
91 Ga0157376_10117899 3300014969 Bacteria 2348
92 Ga0163161_10297090 3300017792 Bacteria 1271
93 Ga0213876_10038119 3300021384 Bacteria 2536
94 Ga0207688_10068496 3300025901 Bacteria 2010
95 Ga0207707_11079822 3300025912 Bacteria 655
96 Ga0207695_10167726 3300025913 Bacteria 2123
97 Ga0207671_10737164 3300025914 Bacteria 783
98 Ga0207660_10049294 3300025917 Unclassified 2984
99 Ga0207660_11377113 3300025917 Bacteria 572
100 Ga0207652_10350308 3300025921 Unclassified 1333
101 Ga0207681_11135958 3300025923 Bacteria 656
102 Ga0207650_11009899 3300025925 Bacteria 708
103 Ga0207659_10628832 3300025926 Bacteria 916
104 Ga0207659_10696271 3300025926 Bacteria 870
105 Ga0207644_10286853 3300025931 Bacteria 1323
106 Ga0207706_11043639 3300025933 Bacteria 685
107 Ga0207686_11179847 3300025934 Bacteria 626
108 Ga0207709_10256594 3300025935 Bacteria 1280
109 Ga0207670_11118504 3300025936 Bacteria 665
110 Ga0207669_10916742 3300025937 Bacteria 733
111 Ga0207704_10007298 3300025938 Bacteria 5214
112 Ga0207691_11455530 3300025940 Bacteria 561
113 Ga0207711_10000302 3300025941 Bacteria 52984
114 Ga0207711_10402803 3300025941 Bacteria 1271
115 Ga0207661_10005956 3300025944 Bacteria 8606
116 Ga0207661_10046177 3300025944 Bacteria 3453
117 Ga0207712_10427469 3300025961 Bacteria 1119
118 Ga0207658_11759510 3300025986 Bacteria 566
119 Ga0207677_10228988 3300026023 Bacteria 1496
120 Ga0207703_10231299 3300026035 Bacteria 1657
121 Ga0207708_11144182 3300026075 Bacteria 679
122 Ga0207676_10606956 3300026095 Bacteria 1052
123 Ga0207674_10492674 3300026116 Unclassified 1184
124 Ga0207674_11807475 3300026116 Bacteria 578
125 Ga0207675_100021165 3300026118 Bacteria 6059
126 Ga0207683_10564412 3300026121 Bacteria 1053
127 Ga0268265_10185555 3300028380 Unclassified 1791
128 Ga0268265_10218114 3300028380 Bacteria 1667
129 Ga0268265_11286280 3300028380 Bacteria 731
130 Ga0268264_10000021 3300028381 Bacteria 481580
131 Ga0268264_10234294 3300028381 Bacteria 1697
132 Ga0268264_11497017 3300028381 Bacteria 686
133 Ga0265326_10205528 3300028558 Bacteria 566
134 Ga0265331_10168890 3300031250 Bacteria 990
135 Ga0265327_10005976 3300031251 Bacteria 9907
136 Ga0307508_10658750 3300031616 Bacteria 653
137 Ga0265314_10086985 3300031711 Bacteria 2044
138 Ga0307516_10000001 3300031730 Bacteria 510338
139 Ga0307516_10648319 3300031730 Bacteria 711
140 Ga0307416_101734664 3300032002 Bacteria 729
141 Ga0307415_102135461 3300032126 Bacteria 547
142 Ga0307510_10072375 3300033180 Bacteria 3425
143 Ga0373940_0220839 3300035088 Bacteria 630
144 Ga0373955_0824028 3300035172 Bacteria 571
145 Ga0373925_0487070 3300037068 Bacteria 1012
146 Ga0395899_0208319 3300037312 Bacteria 1360
147 Ga0395900_0218017 3300037418 Bacteria 1925
148 Ga0395900_0295761 3300037418 Unclassified 1607
149 Ga0395898_0067756 3300037466 Bacteria 3455
150 Ga0395898_0586543 3300037466 Bacteria 1057
151 Ga0395905_0648210 3300037471 Bacteria 958
152 Ga0395901_0466546 3300038443 Unclassified 1289
153 Ga0395901_1529449 3300038443 Bacteria 622
154 Ga0436362_0121922 3300039453 Bacteria 851
155 Ga0439456_012054 3300042013 Bacteria 1792
156 Ga0495603_0688983 3300046455 Unclassified 584
157 Ga0495585_0074660 3300046492 Bacteria 1845
158 Ga0495630_0302451 3300046517 Bacteria 1222
159 Ga0495645_0023142 3300046543 Bacteria 4498
160 Ga0495660_0126344 3300046810 Bacteria 1288
161 Ga0495674_0325670 3300047319 Bacteria 1251
162 Ga0496101_0071381 3300048904 Bacteria 2545
163 Ga0496102_0245753 3300048905 Bacteria 1687
164 Ga0496103_0306834 3300048906 Bacteria 1021
165 Ga0496109_0120564 3300048912 Bacteria 2443
166 Ga0496109_0756465 3300048912 Bacteria 909
167 Ga0496110_0075869 3300048913 Bacteria 2988
168 Ga0496110_0089897 3300048913 Bacteria 2745
169 Ga0496111_0117666 3300048914 Bacteria 1961
170 Ga0496112_0074962 3300048915 Bacteria 3346
171 Ga0496113_0702501 3300048916 Bacteria 807
172 Ga0496116_0154181 3300048919 Bacteria 1271
173 Ga0501036_1371945 3300049572 Bacteria 573
174 Ga0501041_0549398 3300049577 Bacteria 736
175 Ga0501048_0386414 3300049582 Bacteria 1000
176 Ga0501073_0247800 3300049589 Bacteria 1230
177 Ga0501074_0177933 3300049590 Bacteria 1518
178 Ga0501079_0572870 3300049741 Bacteria 888
179 Ga0501081_0184001 3300049743 Bacteria 1512
180 Ga0501045_0179672 3300049824 Bacteria 1577
181 Ga0501045_0188047 3300049824 Bacteria 1539
182 nmdc:mga05p37_754749_c1 3300050507 Bacteria 1072
183 nmdc:mga05p37_9480_c1 3300050507 Bacteria 11527
184 nmdc:mga05p37_9489_c1 3300050507 Bacteria 11520
185 nmdc:mga09592_121846_c1 3300050508 Bacteria 1596
186 nmdc:mga09592_2057_c1 3300050508 Bacteria 16210
187 nmdc:mga0qj67_1116045_c1 3300050509 Bacteria 616
188 nmdc:mga0qj67_38263_c1 3300050509 Bacteria 3763
189 nmdc:mga0qj67_59414_c1 3300050509 Bacteria 3031
190 nmdc:mga06r32_12637_c1 3300050510 Bacteria 7629
191 nmdc:mga08y16_439749_c1 3300050511 Bacteria 1331
192 nmdc:mga0n895_533416_c1 3300050512 Bacteria 1180
193 Ga0495601_0656412 3300053077 Bacteria 671
194 Ga0500556_0000504 3300053104 Bacteria 26918
195 Ga0500645_045381 3300053730 Bacteria 1291
196 Ga0590074_008568 3300059423 Unclassified 1703
197 Ga0501082_0497110 3300060353 Bacteria 1066
198 Ga0105239_11567090
199 JGI25407J50210_10102288
200 Ga0065712_10157904
201 Ga0065707_10633677
202 Ga0070683_100007979
203 Ga0070683_100051982
204 Ga0070670_100702533
205 Ga0070666_10690055
206 Ga0070666_10994805
207 Ga0070680_100324778
208 Ga0070682_100634796
209 Ga0068868_101558138
210 Ga0070669_101267510
211 Ga0070675_100892903
212 Ga0070671_100313357
213 Ga0070709_10375350
214 Ga0070714_100248729
215 Ga0070713_102288625
216 Ga0070710_10132275
217 Ga0070700_101459579
218 Ga0070694_100979836
219 Ga0070678_101920802
220 Ga0070681_10773009
221 Ga0070698_100244556
222 Ga0070699_100000717
223 Ga0070699_100869883
224 Ga0070679_100171082
225 Ga0070684_100067654
226 Ga0070686_100475681
227 Ga0070696_100795436
228 Ga0070665_102555180
229 Ga0068857_100960614
230 Ga0068859_100005295
231 Ga0068859_100996823
232 Ga0068861_100012369
233 Ga0068858_100333526
234 Ga0068860_100000051
235 Ga0068860_100276507
236 Ga0068860_100569791
237 Ga0068862_100153458
238 Ga0068862_100206345
239 Ga0068862_100693682
240 Ga0081455_10033963
241 Ga0081538_10030279
242 Ga0081538_10044118
243 Ga0070717_10192142
244 Ga0070712_100412950
245 Ga0075428_100001779
246 Ga0075428_100098743
247 Ga0075430_100011162
248 Ga0075430_100167603
249 Ga0075430_100756292
250 Ga0075431_100003137
251 Ga0075431_100968418
252 Ga0075429_100003912
253 Ga0075429_100066615
254 Ga0068865_100000361
255 Ga0068865_100565607
256 Ga0097620_100005295
257 Ga0097620_100192207
258 Ga0097620_100996472
259 Ga0099795_10423457
260 Ga0105240_10008432
261 Ga0105240_10236001
262 Ga0111539_10360768
263 Ga0111539_11663310
264 Ga0105245_10047487
265 Ga0114129_10001355
266 Ga0114129_10001963
267 Ga0114129_10053874
268 Ga0114129_10891709
269 Ga0105243_10256182
270 Ga0105241_11877694
271 Ga0105242_10162291
272 Ga0105242_11414196
273 Ga0105249_10151847
274 Ga0105249_10267265
275 Ga0105239_10328409
276 Ga0105239_12132724
277 Ga0105246_12064403
278 Ga0157369_11285546
279 Ga0157375_10521674
280 Ga0157375_10777709
281 Ga0163163_10199112
282 Ga0163163_12804014
283 Ga0157380_10234637
284 Ga0157380_10473225
285 Ga0157377_10239697
286 Ga0157379_10408347
287 Ga0157379_10581976
288 Ga0157376_10117899
289 Ga0163161_10297090
290 Ga0213876_10038119
291 Ga0207688_10068496
292 Ga0207707_11079822
293 Ga0207695_10167726
294 Ga0207671_10737164
295 Ga0207660_10049294
296 Ga0207660_11377113
297 Ga0207652_10350308
298 Ga0207681_11135958
299 Ga0207650_11009899
300 Ga0207659_10628832
301 Ga0207659_10696271
302 Ga0207644_10286853
303 Ga0207706_11043639
304 Ga0207686_11179847
305 Ga0207709_10256594
306 Ga0207670_11118504
307 Ga0207669_10916742
308 Ga0207704_10007298
309 Ga0207691_11455530
310 Ga0207711_10000302
311 Ga0207711_10402803
312 Ga0207661_10005956
313 Ga0207661_10046177
314 Ga0207712_10427469
315 Ga0207658_11759510
316 Ga0207677_10228988
317 Ga0207703_10231299
318 Ga0207708_11144182
319 Ga0207676_10606956
320 Ga0207674_10492674
321 Ga0207674_11807475
322 Ga0207675_100021165
323 Ga0207683_10564412
324 Ga0268265_10185555
325 Ga0268265_10218114
326 Ga0268265_11286280
327 Ga0268264_10000021
328 Ga0268264_10234294
329 Ga0268264_11497017
330 Ga0265326_10205528
331 Ga0265331_10168890
332 Ga0265327_10005976
333 Ga0307508_10658750
334 Ga0265314_10086985
335 Ga0307516_10000001
336 Ga0307516_10648319
337 Ga0307416_101734664
338 Ga0307415_102135461
339 Ga0307510_10072375
340 Ga0373940_0220839
341 Ga0373955_0824028
342 Ga0373925_0487070
343 Ga0395899_0208319
344 Ga0395900_0218017
345 Ga0395900_0295761
346 Ga0395898_0067756
347 Ga0395898_0586543
348 Ga0395905_0648210
349 Ga0395901_0466546
350 Ga0395901_1529449
351 Ga0436362_0121922
352 Ga0439456_012054
353 Ga0495603_0688983
354 Ga0495585_0074660
355 Ga0495630_0302451
356 Ga0495645_0023142
357 Ga0495660_0126344
358 Ga0495674_0325670
359 Ga0496101_0071381
360 Ga0496102_0245753
361 Ga0496103_0306834
362 Ga0496109_0120564
363 Ga0496109_0756465
364 Ga0496110_0075869
365 Ga0496110_0089897
366 Ga0496111_0117666
367 Ga0496112_0074962
368 Ga0496113_0702501
369 Ga0496116_0154181
370 Ga0501036_1371945
371 Ga0501041_0549398
372 Ga0501048_0386414
373 Ga0501073_0247800
374 Ga0501074_0177933
375 Ga0501079_0572870
376 Ga0501081_0184001
377 Ga0501045_0179672
378 Ga0501045_0188047
379 nmdc:mga05p37_754749_c1
380 nmdc:mga05p37_9480_c1
381 nmdc:mga05p37_9489_c1
382 nmdc:mga09592_121846_c1
383 nmdc:mga09592_2057_c1
384 nmdc:mga0qj67_1116045_c1
385 nmdc:mga0qj67_38263_c1
386 nmdc:mga0qj67_59414_c1
387 nmdc:mga06r32_12637_c1
388 nmdc:mga08y16_439749_c1
389 nmdc:mga0n895_533416_c1
390 Ga0495601_0656412
391 Ga0500556_0000504
392 Ga0500645_045381
393 Ga0590074_008568
394 Ga0501082_0497110

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

29

146

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8433 3 125
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.837 3 125
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8359 1 125
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8297 1 125
2i7r-assembly1.cif.gz_B conserved domain protein 0.8185 7 125
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8933 74 121 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8741 73 125 3.30.720.110
2kjzB01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.845 7 52 3.30.720.120
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8375 73 125 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8287 73 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A538D3E7-F1-model_v4 VOC family protein 0.9899 7 125 GO:0004493
GO:0046491
GO:0046872
AF-A0A538D3E7-F1-model_v4 VOC family protein 0.9817 7 125 GO:0004493
GO:0046491
GO:0046872
AF-A0A538JBW9-F1-model_v4 VOC family protein 0.9775 1 127 GO:0004493
GO:0046491
GO:0046872
AF-A0A2V8PY47-F1-model_v4 Glyoxalase 0.9774 7 125 GO:0004493
GO:0046491
GO:0046872
AF-A0A2T0K182-F1-model_v4 Catechol 2,3-dioxygenase-like lactoylglutathione lyase family enzyme 0.9766 1 126 GO:0004462
GO:0004493
GO:0046491
GO:0046872
GO:0051213

Map