F302966

General Info

Members Datasets Scaffolds Average Seq Length
197 132 394 188

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_11220659|Ga0105243_112206591
Length 200
Sequence MSMDRPPSKAWWSSVKPNHHAHVIHQPGKRLMRDVPLKFVWNKVVGIGGRGVSANLNLVSFIDFLVVTVIFLLMSFSASGEVAVDKNVKLPKAENVDDVIEAPMVAVNGNQILVDGTLAGSTRAIEELGRMQKIDELFNILKNKRELWKQVQPNKPFPGVCILQVDQNVPALVVKSVFQTAAFAGYPNVSFMVGKLPKSG

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
25 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
43 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
44 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
45 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
61 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
62 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
63 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
64 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
67 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
68 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
71 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
72 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
73 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
74 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
75 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
76 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
77 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
80 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
81 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
82 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
83 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
84 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
85 3300041461 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaT Metatranscriptome Rhizoplane
86 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
87 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
88 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
89 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
90 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
91 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
92 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
93 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
94 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
95 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
101 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
105 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
106 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
109 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
110 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
111 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
112 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
113 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
114 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
124 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 61.42
Metatranscriptomes 38.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.54
Rhizosphere 91.37
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_11220659 3300009148 Bacteria 766
2 rootL2_10023736 3300003322 Bacteria 2625
3 Ga0058858_1374295 3300004785 Unclassified 1218
4 Ga0058859_10003016 3300004798 Bacteria 2087
5 Ga0058863_11269797 3300004799 Bacteria 768
6 Ga0058860_10025181 3300004801 Bacteria 1203
7 Ga0058860_10180196 3300004801 Bacteria 1372
8 Ga0058860_11839685 3300004801 Bacteria 610
9 Ga0058860_12015984 3300004801 Bacteria 682
10 Ga0058862_12070624 3300004803 Bacteria 830
11 Ga0070683_101026825 3300005329 Bacteria 792
12 Ga0068868_100030709 3300005338 Bacteria 4121
13 Ga0070660_101200745 3300005339 Bacteria 643
14 Ga0070691_10213996 3300005341 Bacteria 1018
15 Ga0070700_100351526 3300005441 Bacteria 1093
16 Ga0070694_100419683 3300005444 Bacteria 1051
17 Ga0070678_100011907 3300005456 Bacteria 5384
18 Ga0068867_100122315 3300005459 Bacteria 2013
19 Ga0070686_100729308 3300005544 Unclassified 793
20 Ga0070695_101101080 3300005545 Bacteria 650
21 Ga0070696_100309129 3300005546 Bacteria 1213
22 Ga0070665_100080829 3300005548 Bacteria 3256
23 Ga0068855_100155751 3300005563 Bacteria 2596
24 Ga0068855_100606457 3300005563 Bacteria 1180
25 Ga0068857_100782742 3300005577 Bacteria 910
26 Ga0068856_100853740 3300005614 Bacteria 930
27 Ga0070702_100074691 3300005615 Unclassified 2012
28 Ga0068866_10423874 3300005718 Bacteria 864
29 Ga0068863_101034540 3300005841 Bacteria 825
30 Ga0068860_100297611 3300005843 Bacteria 1580
31 Ga0068860_100896604 3300005843 Bacteria 903
32 Ga0081455_10270486 3300005937 Unclassified 1233
33 Ga0097621_100126647 3300006237 Bacteria 2170
34 Ga0097621_101211810 3300006237 Bacteria 711
35 Ga0075430_100010011 3300006846 Bacteria 8022
36 Ga0075431_100308443 3300006847 Bacteria 1598
37 Ga0075431_100392438 3300006847 Bacteria 1390
38 Ga0075435_100022045 3300007076 Bacteria 4910
39 Ga0111539_10075561 3300009094 Bacteria 3968
40 Ga0111539_10191867 3300009094 Bacteria 2384
41 Ga0111539_11154709 3300009094 Bacteria 900
42 Ga0105247_10001165 3300009101 Bacteria 19515
43 Ga0114129_10423532 3300009147 Bacteria 1750
44 Ga0114129_11375515 3300009147 Unclassified 872
45 Ga0105242_10023675 3300009176 Bacteria 4841
46 Ga0105242_11214200 3300009176 Bacteria 774
47 Ga0105248_11509414 3300009177 Bacteria 761
48 Ga0105237_10526792 3300009545 Bacteria 1188
49 Ga0105249_11361834 3300009553 Bacteria 781
50 Ga0157378_10519525 3300013297 Bacteria 1192
51 Ga0163162_11352842 3300013306 Bacteria 810
52 Ga0157380_10270903 3300014326 Bacteria 1548
53 Ga0182008_10257668 3300014497 Bacteria 901
54 Ga0157379_11266793 3300014968 Bacteria 711
55 Ga0157376_10098748 3300014969 Bacteria 2546
56 Ga0157376_10631429 3300014969 Unclassified 1069
57 Ga0157376_11113503 3300014969 Bacteria 816
58 Ga0207710_10000945 3300025900 Bacteria 15368
59 Ga0207671_10307718 3300025914 Bacteria 1252
60 Ga0207686_10484605 3300025934 Bacteria 957
61 Ga0207670_10227825 3300025936 Bacteria 1430
62 Ga0207670_10829946 3300025936 Unclassified 771
63 Ga0207704_10125732 3300025938 Bacteria 1765
64 Ga0207665_10495940 3300025939 Bacteria 943
65 Ga0207667_10210029 3300025949 Bacteria 1995
66 Ga0207712_10904685 3300025961 Bacteria 780
67 Ga0207677_10018803 3300026023 Bacteria 4156
68 Ga0207678_10263568 3300026067 Bacteria 1477
69 Ga0207702_10346836 3300026078 Bacteria 1420
70 Ga0207702_10514827 3300026078 Bacteria 1168
71 Ga0207702_10650498 3300026078 Bacteria 1037
72 Ga0207648_10014832 3300026089 Bacteria 7187
73 Ga0207675_101421499 3300026118 Bacteria 714
74 Ga0207428_10315840 3300027907 Bacteria 1154
75 Ga0268266_10196246 3300028379 Bacteria 1845
76 Ga0265318_10250486 3300028577 Unclassified 646
77 Ga0265328_10146148 3300031239 Unclassified 888
78 Ga0265320_10250787 3300031240 Unclassified 785
79 Ga0307513_10420173 3300031456 Bacteria 1067
80 Ga0265314_10023969 3300031711 Bacteria 4638
81 Ga0316576_10026806 3300031727 Unclassified 4048
82 Ga0316576_10156183 3300031727 Bacteria 1720
83 Ga0316576_10164025 3300031727 Unclassified 1676
84 Ga0316576_11010180 3300031727 Unclassified 592
85 Ga0307413_10977661 3300031824 Bacteria 724
86 Ga0307406_10000716 3300031901 Bacteria 18704
87 Ga0307412_10012859 3300031911 Bacteria 4888
88 Ga0307416_102003541 3300032002 Bacteria 682
89 Ga0316592_1007772 3300033524 Unclassified 2100
90 Ga0316586_1010264 3300033527 Unclassified 1416
91 Ga0316588_1007760 3300033528 Bacteria 2187
92 Ga0316588_1009306 3300033528 Bacteria 2046
93 Ga0316588_1015930 3300033528 Bacteria 1661
94 Ga0316588_1050050 3300033528 Bacteria 1012
95 Ga0316588_1077688 3300033528 Unclassified 819
96 Ga0316587_1004269 3300033529 Bacteria 2069
97 Ga0316587_1022853 3300033529 Bacteria 1074
98 Ga0316587_1024996 3300033529 Bacteria 1036
99 Ga0316587_1054245 3300033529 Bacteria 737
100 Ga0316587_1055429 3300033529 Unclassified 730
101 Ga0316596_1014297 3300033541 Bacteria 1966
102 Ga0316596_1098855 3300033541 Bacteria 789
103 Ga0373934_0038817 3300035086 Unclassified 1876
104 Ga0373933_0010840 3300035724 Bacteria 5002
105 Ga0265778_000962 3300036457 Bacteria 2472
106 Ga0265778_031385 3300036457 Bacteria 688
107 Ga0316582_0148584 3300036647 Bacteria 1583
108 Ga0316582_0383347 3300036647 Bacteria 968
109 Ga0436365_1066764 3300039437 Unclassified 608
110 Ga0436365_1085098 3300039437 Bacteria 713
111 Ga0436360_1151448 3300039438 Unclassified 646
112 Ga0436360_1284718 3300039438 Bacteria 628
113 Ga0436361_0184711 3300039447 Bacteria 736
114 Ga0436361_0599073 3300039447 Bacteria 657
115 Ga0451793_0541013 3300041452 Bacteria 900
116 Ga0451793_0831071 3300041452 Bacteria 2660
117 Ga0451797_1377055 3300041453 Bacteria 1078
118 Ga0451802_0993267 3300041460 Bacteria 2439
119 Ga0451805_087800 3300041461 Bacteria 1678
120 Ga0439431_0070387 3300041997 Bacteria 931
121 Ga0439445_0039115 3300042004 Bacteria 1256
122 Ga0439449_0094553 3300042007 Bacteria 1104
123 Ga0439434_0023724 3300042435 Bacteria 1848
124 Ga0466964_0351643 3300044706 Bacteria 757
125 Ga0451576_0057276 3300045051 Bacteria 4074
126 Ga0451576_0255192 3300045051 Bacteria 1833
127 Ga0451576_0302211 3300045051 Unclassified 1674
128 Ga0495676_0343804 3300047321 Bacteria 998
129 Ga0496121_0512338 3300048924 Bacteria 759
130 Ga0496122_0230376 3300048925 Bacteria 1054
131 Ga0501310_004581 3300049130 Bacteria 1393
132 Ga0501310_019812 3300049130 Bacteria 831
133 Ga0501304_002280 3300049160 Bacteria 1321
134 Ga0501305_006425 3300049161 Bacteria 1459
135 Ga0501311_006679 3300049527 Bacteria 1307
136 Ga0501312_000849 3300049528 Bacteria 2730
137 Ga0501318_034310 3300049534 Bacteria 703
138 Ga0501321_017513 3300049537 Bacteria 862
139 Ga0501336_001940 3300049552 Bacteria 1292
140 Ga0501034_0029447 3300049571 Bacteria 5581
141 Ga0501069_0332869 3300049585 Bacteria 893
142 Ga0501072_0352238 3300049588 Unclassified 1169
143 Ga0501073_0031845 3300049589 Bacteria 3761
144 Ga0501080_0011258 3300049742 Bacteria 8188
145 Ga0501083_0007079 3300049744 Bacteria 7962
146 Ga0501083_0105780 3300049744 Bacteria 1853
147 Ga0501083_0367033 3300049744 Bacteria 936
148 nmdc:mga0qj67_56763_c1 3300050509 Bacteria 3104
149 nmdc:mga06r32_362015_c1 3300050510 Bacteria 1434
150 nmdc:mga06r32_467375_c1 3300050510 Bacteria 1240
151 nmdc:mga08y16_1257206_c1 3300050511 Bacteria 709
152 nmdc:mga08y16_157001_c1 3300050511 Bacteria 2364
153 nmdc:mga08y16_760965_c1 3300050511 Bacteria 964
154 nmdc:mga0rr50_136291_c1 3300050513 Bacteria 1971
155 Ga0501084_0005191 3300054114 Bacteria 10656
156 Ga0587084_007849 3300059477 Bacteria 1337
157 Ga0587093_015724 3300059478 Bacteria 958
158 Ga0587093_022339 3300059478 Bacteria 856
159 Ga0587070_006632 3300059491 Bacteria 1571
160 Ga0587070_020404 3300059491 Bacteria 1108
161 Ga0587070_020603 3300059491 Bacteria 1105
162 Ga0587070_025670 3300059491 Bacteria 1029
163 Ga0587077_010262 3300059493 Bacteria 1444
164 Ga0587083_0022302 3300059505 Bacteria 1185
165 Ga0587085_004385 3300059506 Bacteria 1601
166 Ga0587085_014803 3300059506 Bacteria 1106
167 Ga0587086_002319 3300059507 Bacteria 1783
168 Ga0587086_031653 3300059507 Bacteria 781
169 Ga0587092_003704 3300059512 Bacteria 1761
170 Ga0587092_013237 3300059512 Bacteria 1176
171 Ga0587125_002664 3300059607 Bacteria 1454
172 Ga0587101_005685 3300059623 Bacteria 1395
173 Ga0587101_005694 3300059623 Bacteria 1394
174 Ga0587101_018699 3300059623 Bacteria 973
175 Ga0587109_005791 3300059624 Bacteria 1792
176 Ga0587109_016700 3300059624 Bacteria 1261
177 Ga0587109_018104 3300059624 Bacteria 1227
178 Ga0587109_025082 3300059624 Bacteria 1093
179 Ga0587109_026471 3300059624 Bacteria 1073
180 Ga0587109_028433 3300059624 Bacteria 1046
181 Ga0587062_002869 3300059639 Bacteria 1688
182 Ga0587062_002879 3300059639 Bacteria 1686
183 Ga0587062_007781 3300059639 Bacteria 1261
184 Ga0587068_013876 3300059641 Bacteria 1249
185 Ga0587068_018073 3300059641 Bacteria 1132
186 Ga0587068_028920 3300059641 Bacteria 951
187 Ga0587068_030590 3300059641 Bacteria 931
188 Ga0587072_031628 3300059643 Bacteria 991
189 Ga0587076_025930 3300059645 Bacteria 1006
190 Ga0587076_034423 3300059645 Bacteria 916
191 Ga0587079_040101 3300059647 Bacteria 942
192 Ga0587100_000246 3300059648 Bacteria 2347
193 Ga0587071_066892 3300060344 Bacteria 775
194 Ga0587111_0003644 3300060346 Bacteria 2216
195 Ga0587111_0010470 3300060346 Bacteria 1593
196 Ga0587111_0029563 3300060346 Bacteria 1111
197 Ga0587111_0039058 3300060346 Bacteria 1004
198 Ga0105243_11220659
199 rootL2_10023736
200 Ga0058858_1374295
201 Ga0058859_10003016
202 Ga0058863_11269797
203 Ga0058860_10025181
204 Ga0058860_10180196
205 Ga0058860_11839685
206 Ga0058860_12015984
207 Ga0058862_12070624
208 Ga0070683_101026825
209 Ga0068868_100030709
210 Ga0070660_101200745
211 Ga0070691_10213996
212 Ga0070700_100351526
213 Ga0070694_100419683
214 Ga0070678_100011907
215 Ga0068867_100122315
216 Ga0070686_100729308
217 Ga0070695_101101080
218 Ga0070696_100309129
219 Ga0070665_100080829
220 Ga0068855_100155751
221 Ga0068855_100606457
222 Ga0068857_100782742
223 Ga0068856_100853740
224 Ga0070702_100074691
225 Ga0068866_10423874
226 Ga0068863_101034540
227 Ga0068860_100297611
228 Ga0068860_100896604
229 Ga0081455_10270486
230 Ga0097621_100126647
231 Ga0097621_101211810
232 Ga0075430_100010011
233 Ga0075431_100308443
234 Ga0075431_100392438
235 Ga0075435_100022045
236 Ga0111539_10075561
237 Ga0111539_10191867
238 Ga0111539_11154709
239 Ga0105247_10001165
240 Ga0114129_10423532
241 Ga0114129_11375515
242 Ga0105242_10023675
243 Ga0105242_11214200
244 Ga0105248_11509414
245 Ga0105237_10526792
246 Ga0105249_11361834
247 Ga0157378_10519525
248 Ga0163162_11352842
249 Ga0157380_10270903
250 Ga0182008_10257668
251 Ga0157379_11266793
252 Ga0157376_10098748
253 Ga0157376_10631429
254 Ga0157376_11113503
255 Ga0207710_10000945
256 Ga0207671_10307718
257 Ga0207686_10484605
258 Ga0207670_10227825
259 Ga0207670_10829946
260 Ga0207704_10125732
261 Ga0207665_10495940
262 Ga0207667_10210029
263 Ga0207712_10904685
264 Ga0207677_10018803
265 Ga0207678_10263568
266 Ga0207702_10346836
267 Ga0207702_10514827
268 Ga0207702_10650498
269 Ga0207648_10014832
270 Ga0207675_101421499
271 Ga0207428_10315840
272 Ga0268266_10196246
273 Ga0265318_10250486
274 Ga0265328_10146148
275 Ga0265320_10250787
276 Ga0307513_10420173
277 Ga0265314_10023969
278 Ga0316576_10026806
279 Ga0316576_10156183
280 Ga0316576_10164025
281 Ga0316576_11010180
282 Ga0307413_10977661
283 Ga0307406_10000716
284 Ga0307412_10012859
285 Ga0307416_102003541
286 Ga0316592_1007772
287 Ga0316586_1010264
288 Ga0316588_1007760
289 Ga0316588_1009306
290 Ga0316588_1015930
291 Ga0316588_1050050
292 Ga0316588_1077688
293 Ga0316587_1004269
294 Ga0316587_1022853
295 Ga0316587_1024996
296 Ga0316587_1054245
297 Ga0316587_1055429
298 Ga0316596_1014297
299 Ga0316596_1098855
300 Ga0373934_0038817
301 Ga0373933_0010840
302 Ga0265778_000962
303 Ga0265778_031385
304 Ga0316582_0148584
305 Ga0316582_0383347
306 Ga0436365_1066764
307 Ga0436365_1085098
308 Ga0436360_1151448
309 Ga0436360_1284718
310 Ga0436361_0184711
311 Ga0436361_0599073
312 Ga0451793_0541013
313 Ga0451793_0831071
314 Ga0451797_1377055
315 Ga0451802_0993267
316 Ga0451805_087800
317 Ga0439431_0070387
318 Ga0439445_0039115
319 Ga0439449_0094553
320 Ga0439434_0023724
321 Ga0466964_0351643
322 Ga0451576_0057276
323 Ga0451576_0255192
324 Ga0451576_0302211
325 Ga0495676_0343804
326 Ga0496121_0512338
327 Ga0496122_0230376
328 Ga0501310_004581
329 Ga0501310_019812
330 Ga0501304_002280
331 Ga0501305_006425
332 Ga0501311_006679
333 Ga0501312_000849
334 Ga0501318_034310
335 Ga0501321_017513
336 Ga0501336_001940
337 Ga0501034_0029447
338 Ga0501069_0332869
339 Ga0501072_0352238
340 Ga0501073_0031845
341 Ga0501080_0011258
342 Ga0501083_0007079
343 Ga0501083_0105780
344 Ga0501083_0367033
345 nmdc:mga0qj67_56763_c1
346 nmdc:mga06r32_362015_c1
347 nmdc:mga06r32_467375_c1
348 nmdc:mga08y16_1257206_c1
349 nmdc:mga08y16_157001_c1
350 nmdc:mga08y16_760965_c1
351 nmdc:mga0rr50_136291_c1
352 Ga0501084_0005191
353 Ga0587084_007849
354 Ga0587093_015724
355 Ga0587093_022339
356 Ga0587070_006632
357 Ga0587070_020404
358 Ga0587070_020603
359 Ga0587070_025670
360 Ga0587077_010262
361 Ga0587083_0022302
362 Ga0587085_004385
363 Ga0587085_014803
364 Ga0587086_002319
365 Ga0587086_031653
366 Ga0587092_003704
367 Ga0587092_013237
368 Ga0587125_002664
369 Ga0587101_005685
370 Ga0587101_005694
371 Ga0587101_018699
372 Ga0587109_005791
373 Ga0587109_016700
374 Ga0587109_018104
375 Ga0587109_025082
376 Ga0587109_026471
377 Ga0587109_028433
378 Ga0587062_002869
379 Ga0587062_002879
380 Ga0587062_007781
381 Ga0587068_013876
382 Ga0587068_018073
383 Ga0587068_028920
384 Ga0587068_030590
385 Ga0587072_031628
386 Ga0587076_025930
387 Ga0587076_034423
388 Ga0587079_040101
389 Ga0587100_000246
390 Ga0587071_066892
391 Ga0587111_0003644
392 Ga0587111_0010470
393 Ga0587111_0029563
394 Ga0587111_0039058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02472

ExbD

Biopolymer transport protein ExbD/TolR

50

196

0.76

Map