F301682

General Info

Members Datasets Scaffolds Average Seq Length
196 150 386 114

Family's Representative Sequence

Representative Sequence 3300025936|Ga0207670_10485605|Ga0207670_104856052
Length 137
Sequence VKLVVAIVRQEKLNDVLEELFNARIAGLTISRVHGHGGETERVETYRGTTVKMELTEKVRLEIGVSDHFVQTTIDAIIAGARTGDVGDGKIFVMPVEQVVRIRTGETDRAAVTPEPLPDIGCQVNGLICRRQGSFDG

Samples

Sample ID Description Type Environment
1 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
6 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
52 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
57 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
58 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
61 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
78 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
79 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
80 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
81 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
82 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
83 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
84 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
85 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
86 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
87 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
88 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
99 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
100 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
101 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
109 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
110 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
111 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
112 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
113 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
114 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
117 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
120 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
121 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
122 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
123 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
124 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
125 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
126 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
127 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
128 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
129 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
130 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
131 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
135 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
136 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
140 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
141 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
143 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
144 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
145 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
146 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
147 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
149 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
150 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.92
Metatranscriptomes 3.57
Isolates 0.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.1
Nodule 0
Rhizoplane 0
Rhizosphere 87.76
Stem 0
Stem Tuber 0
Unclassified 4.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207670_10485605 3300025936 Bacteria 1001
2 JGI25156J39149_1004902 3300002705 Bacteria 3971
3 JGI25154J39366_1000699 3300002738 Bacteria 15314
4 Ga0055525_1021195 3300003759 Bacteria 553
5 Ga0055542_1001446 3300003762 Bacteria 11830
6 Ga0055541_1000676 3300003841 Bacteria 8852
7 Ga0055541_1011596 3300003841 Bacteria 1288
8 Ga0065712_10326069 3300005290 Bacteria 820
9 Ga0065715_10309460 3300005293 Bacteria 1021
10 Ga0070683_100005522 3300005329 Bacteria 10564
11 Ga0068868_101226764 3300005338 Bacteria 694
12 Ga0070689_100348248 3300005340 Bacteria 1242
13 Ga0070668_100609258 3300005347 Bacteria 956
14 Ga0070675_100000004 3300005354 Bacteria 361974
15 Ga0070674_100174580 3300005356 Bacteria 1641
16 Ga0070673_101101441 3300005364 Bacteria 742
17 Ga0070667_101195047 3300005367 Bacteria 712
18 Ga0070705_101788641 3300005440 Bacteria 521
19 Ga0070708_102229701 3300005445 Bacteria 506
20 Ga0070706_101329158 3300005467 Bacteria 659
21 Ga0070707_100023871 3300005468 Bacteria 5785
22 Ga0070707_100124214 3300005468 Bacteria 2507
23 Ga0070707_100953489 3300005468 Bacteria 823
24 Ga0070699_101139120 3300005518 Bacteria 716
25 Ga0070684_100041931 3300005535 Bacteria 3949
26 Ga0070697_100793481 3300005536 Bacteria 838
27 Ga0068853_100240721 3300005539 Bacteria 1658
28 Ga0070696_100478528 3300005546 Bacteria 987
29 Ga0070665_100972514 3300005548 Bacteria 861
30 Ga0068855_101287735 3300005563 Bacteria 757
31 Ga0068857_100110654 3300005577 Bacteria 2469
32 Ga0068856_101476156 3300005614 Bacteria 694
33 Ga0070702_100016559 3300005615 Bacteria 3785
34 Ga0068861_100825896 3300005719 Bacteria 872
35 Ga0068862_100511874 3300005844 Bacteria 1141
36 Ga0068862_101872580 3300005844 Bacteria 610
37 Ga0068871_100649293 3300006358 Bacteria 963
38 Ga0075433_10133193 3300006852 Bacteria 2209
39 Ga0075434_100025623 3300006871 Bacteria 5771
40 Ga0075434_101089818 3300006871 Bacteria 812
41 Ga0075429_100075347 3300006880 Bacteria 2939
42 Ga0075436_100118628 3300006914 Bacteria 1850
43 Ga0105245_10885596 3300009098 Bacteria 934
44 Ga0114129_10316112 3300009147 Bacteria 2077
45 Ga0105242_10000369 3300009176 Bacteria 35831
46 Ga0105238_11422977 3300009551 Bacteria 721
47 Ga0157316_1029479 3300012510 Bacteria 656
48 Ga0157370_10667659 3300013104 Bacteria 950
49 Ga0157369_10379809 3300013105 Bacteria 1466
50 Ga0157378_10006155 3300013297 Bacteria 10505
51 Ga0163162_10499734 3300013306 Bacteria 1346
52 Ga0157375_10323920 3300013308 Bacteria 1706
53 Ga0163163_10016105 3300014325 Bacteria 6935
54 Ga0163163_10226370 3300014325 Bacteria 1919
55 Ga0163163_11044090 3300014325 Bacteria 880
56 Ga0163163_11386987 3300014325 Bacteria 764
57 Ga0157379_11856099 3300014968 Bacteria 593
58 Ga0157376_10593591 3300014969 Bacteria 1101
59 Ga0157376_11182472 3300014969 Bacteria 792
60 Ga0163161_11114699 3300017792 Bacteria 679
61 Ga0209784_100484 3300025224 Bacteria 15981
62 Ga0209566_100653 3300025225 Bacteria 20948
63 Ga0209674_100220 3300025226 Bacteria 53058
64 Ga0209563_103778 3300025230 Bacteria 3042
65 Ga0209646_1000058 3300025246 Bacteria 259999
66 Ga0209026_1003386 3300025250 Bacteria 5262
67 Ga0209677_105068 3300025253 Bacteria 3562
68 Ga0209148_1000043 3300025254 Bacteria 461531
69 Ga0209759_1004914 3300025256 Bacteria 4837
70 Ga0207643_10102507 3300025908 Bacteria 1679
71 Ga0207684_10315100 3300025910 Bacteria 1348
72 Ga0207684_10694858 3300025910 Bacteria 865
73 Ga0207707_10298067 3300025912 Bacteria 1394
74 Ga0207660_10128879 3300025917 Bacteria 1924
75 Ga0207646_10039344 3300025922 Bacteria 4256
76 Ga0207646_10086341 3300025922 Bacteria 2807
77 Ga0207646_10993828 3300025922 Bacteria 742
78 Ga0207659_10000002 3300025926 Bacteria 619441
79 Ga0207700_10005047 3300025928 Bacteria 7853
80 Ga0207686_10027489 3300025934 Bacteria 3332
81 Ga0207669_10155166 3300025937 Bacteria 1609
82 Ga0207689_11005812 3300025942 Bacteria 703
83 Ga0207661_10003687 3300025944 Bacteria 10676
84 Ga0207677_11549252 3300026023 Bacteria 613
85 Ga0207639_10171858 3300026041 Bacteria 1836
86 Ga0207702_10019545 3300026078 Bacteria 5605
87 Ga0207702_11231124 3300026078 Bacteria 743
88 Ga0207674_10141260 3300026116 Bacteria 2367
89 Ga0207674_11651311 3300026116 Bacteria 609
90 Ga0207675_100241766 3300026118 Bacteria 1745
91 Ga0265318_10197216 3300028577 Bacteria 736
92 Ga0265336_10050545 3300028666 Bacteria 1257
93 Ga0265332_10000010 3300031238 Bacteria 289041
94 Ga0265332_10000621 3300031238 Bacteria 23112
95 Ga0265332_10029285 3300031238 Bacteria 2407
96 Ga0265340_10412269 3300031247 Bacteria 596
97 Ga0265340_10433852 3300031247 Bacteria 579
98 Ga0265339_10000589 3300031249 Bacteria 28322
99 Ga0265339_10392824 3300031249 Bacteria 649
100 Ga0265331_10007043 3300031250 Bacteria 6556
101 Ga0265316_10149944 3300031344 Bacteria 1747
102 Ga0307408_100104190 3300031548 Bacteria 2167
103 Ga0265313_10002385 3300031595 Bacteria 16299
104 Ga0265313_10164685 3300031595 Bacteria 940
105 Ga0316579_10011958 3300031691 Bacteria 3703
106 Ga0265314_10000836 3300031711 Bacteria 36429
107 Ga0265342_10087701 3300031712 Bacteria 1787
108 Ga0316576_10081807 3300031727 Bacteria 2397
109 Ga0316576_10324214 3300031727 Unclassified 1149
110 Ga0316576_10332689 3300031727 Unclassified 1132
111 Ga0316578_10836238 3300031728 Unclassified 533
112 Ga0307405_10053927 3300031731 Bacteria 2507
113 Ga0307405_11353368 3300031731 Bacteria 621
114 Ga0307413_10208557 3300031824 Bacteria 1417
115 Ga0307413_10702660 3300031824 Bacteria 840
116 Ga0307410_10567749 3300031852 Bacteria 942
117 Ga0307406_11012669 3300031901 Bacteria 713
118 Ga0307406_11241203 3300031901 Bacteria 648
119 Ga0307407_10096296 3300031903 Bacteria 1826
120 Ga0307412_10188774 3300031911 Bacteria 1556
121 Ga0307409_101122266 3300031995 Bacteria 808
122 Ga0307414_10285844 3300032004 Bacteria 1388
123 Ga0307414_10547569 3300032004 Bacteria 1031
124 Ga0307411_11006984 3300032005 Bacteria 746
125 Ga0307415_100660350 3300032126 Bacteria 938
126 Ga0316592_1063551 3300033524 Unclassified 830
127 Ga0316588_1033151 3300033528 Unclassified 1217
128 Ga0316588_1041360 3300033528 Bacteria 1102
129 Ga0316588_1052986 3300033528 Unclassified 985
130 Ga0316588_1068173 3300033528 Bacteria 872
131 Ga0316588_1152957 3300033528 Bacteria 592
132 Ga0373931_0443661 3300035691 Bacteria 829
133 Ga0373935_0301751 3300035692 Bacteria 1132
134 Ga0373937_1514807 3300036401 Unclassified 618
135 Ga0316582_0601970 3300036647 Unclassified 757
136 Ga0395900_0179690 3300037418 Bacteria 2151
137 Ga0400491_09785 3300038727 Bacteria 1461
138 Ga0400488_42824 3300038741 Bacteria 1562
139 Ga0400486_12230 3300038742 Bacteria 3162
140 Ga0400487_20158 3300039110 Bacteria 2531
141 Ga0400487_34090 3300039110 Bacteria 2710
142 Ga0436363_1325217 3300039450 Bacteria 981
143 Ga0439456_018530 3300042013 Bacteria 1461
144 Ga0439435_0076502 3300042436 Bacteria 999
145 Ga0451577_0749631 3300042876 Bacteria 883
146 Ga0451577_1055054 3300042876 Bacteria 728
147 Ga0466969_0610738 3300044656 Bacteria 501
148 Ga0466972_0062122 3300044658 Bacteria 1790
149 Ga0466972_0214825 3300044658 Bacteria 900
150 Ga0453683_0003197 3300044673 Bacteria 12191
151 Ga0466961_0017309 3300044693 Bacteria 4628
152 Ga0466964_0048241 3300044706 Bacteria 1740
153 Ga0453684_1045980 3300044712 Bacteria 866
154 Ga0453684_2293075 3300044712 Bacteria 537
155 Ga0466968_0038623 3300044735 Bacteria 2006
156 Ga0466970_0011126 3300044765 Bacteria 4582
157 Ga0466957_0014234 3300044842 Bacteria 4630
158 Ga0466960_0071285 3300044901 Bacteria 1730
159 Ga0466959_0088517 3300045049 Bacteria 2226
160 Ga0466959_0093075 3300045049 Bacteria 2163
161 Ga0451576_0001706 3300045051 Bacteria 36282
162 Ga0451576_0002018 3300045051 Bacteria 32079
163 Ga0451576_0006044 3300045051 Bacteria 14944
164 Ga0451576_0076526 3300045051 Bacteria 3482
165 Ga0451576_0284739 3300045051 Bacteria 1728
166 Ga0451576_0367675 3300045051 Bacteria 1506
167 Ga0466967_0043621 3300045976 Bacteria 3884
168 Ga0495656_0482360 3300046615 Bacteria 656
169 Ga0496124_0474532 3300048927 Bacteria 846
170 Ga0501300_018541 3300049523 Bacteria 1016
171 Ga0501033_0551439 3300049570 Bacteria 794
172 Ga0501039_0455147 3300049575 Bacteria 1005
173 Ga0501042_0088933 3300049578 Bacteria 2216
174 Ga0501042_1358405 3300049578 Bacteria 518
175 Ga0501043_1304079 3300049579 Bacteria 507
176 Ga0501046_0068114 3300049580 Bacteria 2771
177 Ga0501047_0106249 3300049581 Bacteria 2687
178 Ga0501048_0651748 3300049582 Bacteria 756
179 Ga0501280_000079 3300049776 Bacteria 25935
180 Ga0501280_100420 3300049776 Bacteria 556
181 Ga0501282_000175 3300049778 Bacteria 7824
182 Ga0501035_0061611 3300049822 Bacteria 3339
183 nmdc:mga09592_967860_c1 3300050508 Bacteria 713
184 nmdc:mga06r32_703101_c1 3300050510 Bacteria 976
185 nmdc:mga0n895_2053705_c1 3300050512 Bacteria 529
186 nmdc:mga0n895_66389_c1 3300050512 Bacteria 3572
187 nmdc:mga0n895_7607_c1 3300050512 Bacteria 9314
188 nmdc:mga08x19_30476_c1 3300050514 Bacteria 3388
189 nmdc:mga0a205_250363_c1 3300050515 Bacteria 1651
190 Ga0587109_107626 3300059624 Bacteria 648
191 Ga0501082_0877396 3300060353 Bacteria 785
192 Ga0530510_0010298 3300061734 Bacteria 6552
193 2885278473 2885270888 Bacteria 9831543
194 Ga0207670_10485605
195 JGI25156J39149_1004902
196 JGI25154J39366_1000699
197 Ga0055525_1021195
198 Ga0055542_1001446
199 Ga0055541_1000676
200 Ga0055541_1011596
201 Ga0065712_10326069
202 Ga0065715_10309460
203 Ga0070683_100005522
204 Ga0068868_101226764
205 Ga0070689_100348248
206 Ga0070668_100609258
207 Ga0070675_100000004
208 Ga0070674_100174580
209 Ga0070673_101101441
210 Ga0070667_101195047
211 Ga0070705_101788641
212 Ga0070708_102229701
213 Ga0070706_101329158
214 Ga0070707_100023871
215 Ga0070707_100124214
216 Ga0070707_100953489
217 Ga0070699_101139120
218 Ga0070684_100041931
219 Ga0070697_100793481
220 Ga0068853_100240721
221 Ga0070696_100478528
222 Ga0070665_100972514
223 Ga0068855_101287735
224 Ga0068857_100110654
225 Ga0068856_101476156
226 Ga0070702_100016559
227 Ga0068861_100825896
228 Ga0068862_100511874
229 Ga0068862_101872580
230 Ga0068871_100649293
231 Ga0075433_10133193
232 Ga0075434_100025623
233 Ga0075434_101089818
234 Ga0075429_100075347
235 Ga0075436_100118628
236 Ga0105245_10885596
237 Ga0114129_10316112
238 Ga0105242_10000369
239 Ga0105238_11422977
240 Ga0157316_1029479
241 Ga0157370_10667659
242 Ga0157369_10379809
243 Ga0157378_10006155
244 Ga0163162_10499734
245 Ga0157375_10323920
246 Ga0163163_10016105
247 Ga0163163_10226370
248 Ga0163163_11044090
249 Ga0163163_11386987
250 Ga0157379_11856099
251 Ga0157376_10593591
252 Ga0157376_11182472
253 Ga0163161_11114699
254 Ga0209784_100484
255 Ga0209566_100653
256 Ga0209674_100220
257 Ga0209563_103778
258 Ga0209646_1000058
259 Ga0209026_1003386
260 Ga0209677_105068
261 Ga0209148_1000043
262 Ga0209759_1004914
263 Ga0207643_10102507
264 Ga0207684_10315100
265 Ga0207684_10694858
266 Ga0207707_10298067
267 Ga0207660_10128879
268 Ga0207646_10039344
269 Ga0207646_10086341
270 Ga0207646_10993828
271 Ga0207659_10000002
272 Ga0207700_10005047
273 Ga0207686_10027489
274 Ga0207669_10155166
275 Ga0207689_11005812
276 Ga0207661_10003687
277 Ga0207677_11549252
278 Ga0207639_10171858
279 Ga0207702_10019545
280 Ga0207702_11231124
281 Ga0207674_10141260
282 Ga0207674_11651311
283 Ga0207675_100241766
284 Ga0265318_10197216
285 Ga0265336_10050545
286 Ga0265332_10000010
287 Ga0265332_10000621
288 Ga0265332_10029285
289 Ga0265340_10412269
290 Ga0265340_10433852
291 Ga0265339_10000589
292 Ga0265339_10392824
293 Ga0265331_10007043
294 Ga0265316_10149944
295 Ga0307408_100104190
296 Ga0265313_10002385
297 Ga0265313_10164685
298 Ga0316579_10011958
299 Ga0265314_10000836
300 Ga0265342_10087701
301 Ga0316576_10081807
302 Ga0316576_10324214
303 Ga0316576_10332689
304 Ga0316578_10836238
305 Ga0307405_10053927
306 Ga0307405_11353368
307 Ga0307413_10208557
308 Ga0307413_10702660
309 Ga0307410_10567749
310 Ga0307406_11012669
311 Ga0307406_11241203
312 Ga0307407_10096296
313 Ga0307412_10188774
314 Ga0307409_101122266
315 Ga0307414_10285844
316 Ga0307414_10547569
317 Ga0307411_11006984
318 Ga0307415_100660350
319 Ga0316592_1063551
320 Ga0316588_1033151
321 Ga0316588_1041360
322 Ga0316588_1052986
323 Ga0316588_1068173
324 Ga0316588_1152957
325 Ga0373931_0443661
326 Ga0373935_0301751
327 Ga0373937_1514807
328 Ga0316582_0601970
329 Ga0395900_0179690
330 Ga0400491_09785
331 Ga0400488_42824
332 Ga0400486_12230
333 Ga0400487_20158
334 Ga0400487_34090
335 Ga0436363_1325217
336 Ga0439456_018530
337 Ga0439435_0076502
338 Ga0451577_0749631
339 Ga0451577_1055054
340 Ga0466969_0610738
341 Ga0466972_0062122
342 Ga0466972_0214825
343 Ga0453683_0003197
344 Ga0466961_0017309
345 Ga0466964_0048241
346 Ga0453684_1045980
347 Ga0453684_2293075
348 Ga0466968_0038623
349 Ga0466970_0011126
350 Ga0466957_0014234
351 Ga0466960_0071285
352 Ga0466959_0088517
353 Ga0466959_0093075
354 Ga0451576_0001706
355 Ga0451576_0002018
356 Ga0451576_0006044
357 Ga0451576_0076526
358 Ga0451576_0284739
359 Ga0451576_0367675
360 Ga0466967_0043621
361 Ga0495656_0482360
362 Ga0496124_0474532
363 Ga0501300_018541
364 Ga0501033_0551439
365 Ga0501039_0455147
366 Ga0501042_0088933
367 Ga0501042_1358405
368 Ga0501043_1304079
369 Ga0501046_0068114
370 Ga0501047_0106249
371 Ga0501048_0651748
372 Ga0501280_000079
373 Ga0501280_100420
374 Ga0501282_000175
375 Ga0501035_0061611
376 nmdc:mga09592_967860_c1
377 nmdc:mga06r32_703101_c1
378 nmdc:mga0n895_2053705_c1
379 nmdc:mga0n895_66389_c1
380 nmdc:mga0n895_7607_c1
381 nmdc:mga08x19_30476_c1
382 nmdc:mga0a205_250363_c1
383 Ga0587109_107626
384 Ga0501082_0877396
385 Ga0530510_0010298
386 2885278473

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

1

106

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9989 1 112
4c3k-assembly2.cif.gz_A structure of mixed pii-adp complexes from s. elongatus 0.9914 1 112
3bzq-assembly1.cif.gz_A high resolution crystal structure of nitrogen regulatory protein (rv2919c) of mycobacterium tuberculosis 0.991 2 112
2eg1-assembly1.cif.gz_A the crystal structure of pii protein 0.9885 1 112
3t9z-assembly1.cif.gz_A a. fulgidus glnk3, ligand-free 0.9875 1 108
ID Description Score Start End Superfamily
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9721 1 111 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9682 2 111 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9622 1 111 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9294 2 112 3.30.70.120
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9205 2 108 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A2U1T6E6-F1-model_v4 P-II family nitrogen regulator 0.9504 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9416 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A357BKJ3-F1-model_v4 P-II family nitrogen regulator 0.9325 1 112 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A424YGZ9-F1-model_v4 deleted 0.9297 1 108
AF-A0A521EF94-F1-model_v4 Nitrogen regulatory protein P-II family 0.9241 1 110 GO:0005524
GO:0005829
GO:0006808
GO:0030234

Map