F301585

General Info

Members Datasets Scaffolds Average Seq Length
196 152 392 116

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10684360|Ga0157374_106843602
Length 137
Sequence VDNNCLFCRIVAGEIPATVVHETDTTLAFRDIDPKAPVHVLVIPKEHHADVVTLAQNDPAGSADLLAACAAVAEAEGLLMEGFRLLFNTGGYAGQEVFHVHAHVLGGEPLGPMLVPKGPGFSAPSEGSGAGSGAASR

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
22 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
31 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
32 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
37 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
40 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
41 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
42 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
43 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
44 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
73 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
74 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
75 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
78 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
79 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
82 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
83 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
84 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
85 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
86 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
87 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
88 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
93 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
94 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
95 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
96 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
97 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
98 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
99 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
100 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
101 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
102 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
103 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
104 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
105 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
106 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
107 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
110 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
124 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
131 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
132 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
133 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
134 2582580736 Prauserella sp. Am3 Isolate Unclassified
135 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
136 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
137 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
138 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
139 2858882152 Micromonospora noduli MED15 Isolate Nodule
140 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
141 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
142 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
143 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
144 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
145 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
146 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
147 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
148 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
149 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
150 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
151 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
152 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.8
Metatranscriptomes 0
Isolates 10.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.02
Nodule 2.55
Rhizoplane 1.53
Rhizosphere 80.1
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10684360 3300013296 Bacteria 1038
2 JGI25406J46586_10238904 3300003203 Bacteria 533
3 rootH2_10202950 3300003320 Bacteria 1899
4 Ga0070683_100022477 3300005329 Bacteria 5636
5 Ga0070683_100121423 3300005329 Bacteria 2468
6 Ga0070670_100456685 3300005331 Bacteria 1133
7 Ga0068869_100448958 3300005334 Bacteria 1069
8 Ga0070666_11185404 3300005335 Bacteria 569
9 Ga0070680_100468259 3300005336 Bacteria 1077
10 Ga0070680_100794843 3300005336 Bacteria 815
11 Ga0068868_100707489 3300005338 Bacteria 902
12 Ga0070660_100229881 3300005339 Bacteria 1509
13 Ga0070668_100033940 3300005347 Bacteria 3888
14 Ga0070671_100333691 3300005355 Bacteria 1293
15 Ga0070659_100939683 3300005366 Bacteria 757
16 Ga0070667_100209619 3300005367 Bacteria 1732
17 Ga0070709_10484405 3300005434 Bacteria 937
18 Ga0070701_10504399 3300005438 Bacteria 786
19 Ga0070700_100144269 3300005441 Bacteria 1621
20 Ga0070700_100990751 3300005441 Bacteria 690
21 Ga0070685_10112579 3300005466 Bacteria 1679
22 Ga0070684_100005511 3300005535 Bacteria 9706
23 Ga0070684_100100542 3300005535 Bacteria 2582
24 Ga0070665_101744216 3300005548 Bacteria 630
25 Ga0070664_100086468 3300005564 Bacteria 2709
26 Ga0070664_100151290 3300005564 Bacteria 2049
27 Ga0070664_101292828 3300005564 Bacteria 689
28 Ga0068857_100105480 3300005577 Bacteria 2530
29 Ga0068856_100286977 3300005614 Bacteria 1663
30 Ga0068856_102484186 3300005614 Bacteria 525
31 Ga0068864_100626763 3300005618 Bacteria 1045
32 Ga0068861_100774500 3300005719 Bacteria 898
33 Ga0068858_100250684 3300005842 Bacteria 1681
34 Ga0068858_100646850 3300005842 Bacteria 1027
35 Ga0068860_100042927 3300005843 Bacteria 4315
36 Ga0081540_1006129 3300005983 Bacteria 8830
37 Ga0081539_10008009 3300005985 Bacteria 9376
38 Ga0081539_10012523 3300005985 Bacteria 6522
39 Ga0081539_10033765 3300005985 Bacteria 3108
40 Ga0075434_100727684 3300006871 Bacteria 1009
41 Ga0075429_100007315 3300006880 Bacteria 9584
42 Ga0075429_100969231 3300006880 Bacteria 744
43 Ga0111539_12065733 3300009094 Bacteria 661
44 Ga0105245_10191955 3300009098 Bacteria 1957
45 Ga0114129_10004287 3300009147 Bacteria 20151
46 Ga0105248_12841285 3300009177 Bacteria 552
47 Ga0105239_11754321 3300010375 Bacteria 719
48 Ga0157371_10646326 3300013102 Bacteria 789
49 Ga0157378_11922924 3300013297 Bacteria 641
50 Ga0163162_10693033 3300013306 Bacteria 1141
51 Ga0157372_10732915 3300013307 Bacteria 1149
52 Ga0157375_11357879 3300013308 Bacteria 836
53 Ga0163163_10981697 3300014325 Bacteria 908
54 Ga0157380_10319528 3300014326 Bacteria 1439
55 Ga0157379_10688410 3300014968 Bacteria 959
56 Ga0182007_10253406 3300015262 Bacteria 632
57 Ga0207642_10483201 3300025899 Bacteria 756
58 Ga0207710_10557908 3300025900 Bacteria 597
59 Ga0207680_10259779 3300025903 Bacteria 1202
60 Ga0207699_11169389 3300025906 Bacteria 570
61 Ga0207707_10297354 3300025912 Bacteria 1396
62 Ga0207657_10369522 3300025919 Bacteria 1130
63 Ga0207687_10225411 3300025927 Bacteria 1478
64 Ga0207644_10825641 3300025931 Bacteria 776
65 Ga0207690_10480692 3300025932 Bacteria 1002
66 Ga0207690_10726503 3300025932 Bacteria 818
67 Ga0207691_10270371 3300025940 Bacteria 1464
68 Ga0207691_10549609 3300025940 Bacteria 979
69 Ga0207689_10162644 3300025942 Bacteria 1839
70 Ga0207661_10000667 3300025944 Bacteria 22196
71 Ga0207661_10217338 3300025944 Bacteria 1688
72 Ga0207679_10127515 3300025945 Bacteria 2036
73 Ga0207668_10006834 3300025972 Bacteria 6764
74 Ga0207658_10259919 3300025986 Bacteria 1479
75 Ga0207677_10159444 3300026023 Bacteria 1751
76 Ga0207677_11546344 3300026023 Bacteria 613
77 Ga0207703_10400771 3300026035 Bacteria 1273
78 Ga0207703_10712081 3300026035 Bacteria 955
79 Ga0207678_10403589 3300026067 Bacteria 1184
80 Ga0207702_10507487 3300026078 Bacteria 1176
81 Ga0207702_11205383 3300026078 Bacteria 751
82 Ga0207702_12205656 3300026078 Bacteria 539
83 Ga0207641_10580246 3300026088 Bacteria 1096
84 Ga0207674_10108714 3300026116 Bacteria 2749
85 Ga0207675_101860992 3300026118 Bacteria 621
86 Ga0207675_102747954 3300026118 Bacteria 500
87 Ga0207683_10412739 3300026121 Bacteria 1243
88 Ga0207698_11105122 3300026142 Bacteria 806
89 Ga0268265_10182265 3300028380 Bacteria 1805
90 Ga0268265_10678848 3300028380 Bacteria 993
91 Ga0268265_11927798 3300028380 Bacteria 598
92 Ga0268264_10040609 3300028381 Bacteria 3844
93 Ga0307515_10000148 3300028794 Bacteria 170303
94 Ga0307515_10053486 3300028794 Bacteria 5956
95 Ga0307512_10338600 3300030522 Bacteria 671
96 Ga0307513_10072008 3300031456 Bacteria 3604
97 Ga0307513_10415146 3300031456 Bacteria 1077
98 Ga0307509_10006392 3300031507 Bacteria 15880
99 Ga0307509_10785307 3300031507 Bacteria 617
100 Ga0307408_100250819 3300031548 Bacteria 1460
101 Ga0307508_10494802 3300031616 Bacteria 817
102 Ga0307514_10150327 3300031649 Bacteria 1564
103 Ga0307516_10028620 3300031730 Bacteria 5637
104 Ga0307516_10115759 3300031730 Bacteria 2477
105 Ga0307516_10395697 3300031730 Bacteria 1041
106 Ga0307516_10658134 3300031730 Bacteria 703
107 Ga0307405_10521219 3300031731 Bacteria 956
108 Ga0307405_10865728 3300031731 Bacteria 762
109 Ga0307405_11988605 3300031731 Bacteria 520
110 Ga0307413_11003923 3300031824 Bacteria 715
111 Ga0307410_10023301 3300031852 Bacteria 3846
112 Ga0307410_10885091 3300031852 Bacteria 764
113 Ga0307410_11138609 3300031852 Bacteria 678
114 Ga0307410_11932764 3300031852 Bacteria 526
115 Ga0326468_10000586 3300031889 Bacteria 3766
116 Ga0307406_10006037 3300031901 Bacteria 6653
117 Ga0307406_10268394 3300031901 Bacteria 1295
118 Ga0307406_10642755 3300031901 Bacteria 880
119 Ga0307406_11254556 3300031901 Bacteria 645
120 Ga0307407_10055552 3300031903 Bacteria 2289
121 Ga0307412_11035765 3300031911 Bacteria 727
122 Ga0307409_100068356 3300031995 Bacteria 2809
123 Ga0307409_100261099 3300031995 Bacteria 1589
124 Ga0307409_101069004 3300031995 Bacteria 827
125 Ga0307409_102175442 3300031995 Bacteria 584
126 Ga0307416_100239952 3300032002 Bacteria 1755
127 Ga0307416_102359285 3300032002 Bacteria 632
128 Ga0307414_10036324 3300032004 Bacteria 3289
129 Ga0307411_10891010 3300032005 Bacteria 790
130 Ga0307415_100089349 3300032126 Bacteria 2225
131 Ga0307415_100253494 3300032126 Bacteria 1431
132 Ga0307510_10393404 3300033180 Bacteria 830
133 Ga0373951_0000210 3300035091 Bacteria 20860
134 Ga0373962_0003088 3300035242 Bacteria 3991
135 Ga0373935_0019393 3300035692 Bacteria 4147
136 Ga0373937_2158178 3300036401 Bacteria 503
137 Ga0395899_0036602 3300037312 Bacteria 3681
138 Ga0395900_0102371 3300037418 Bacteria 2942
139 Ga0395898_0028053 3300037466 Bacteria 5645
140 Ga0395905_0098343 3300037471 Bacteria 2748
141 Ga0395901_0267293 3300038443 Bacteria 1779
142 Ga0451787_301077 3300041441 Bacteria 522
143 Ga0451797_1298497 3300041453 Bacteria 509
144 Ga0451851_0920254 3300041507 Bacteria 623
145 Ga0439463_100728 3300042016 Bacteria 745
146 Ga0450905_100244 3300042142 Bacteria 519
147 Ga0466966_0484427 3300044684 Bacteria 744
148 Ga0466967_0137726 3300045976 Bacteria 2271
149 Ga0466967_2292508 3300045976 Bacteria 535
150 Ga0495594_0083173 3300046499 Bacteria 1789
151 Ga0495594_0586142 3300046499 Bacteria 632
152 Ga0495668_0453325 3300046616 Bacteria 706
153 Ga0495649_0545962 3300046694 Bacteria 574
154 Ga0496108_0000065 3300048911 Bacteria 117405
155 Ga0501034_0756205 3300049571 Bacteria 867
156 Ga0501036_0421443 3300049572 Bacteria 1113
157 Ga0501037_0414981 3300049573 Bacteria 922
158 Ga0501038_0261950 3300049574 Bacteria 1366
159 Ga0501042_0610621 3300049578 Bacteria 793
160 Ga0501043_1071192 3300049579 Bacteria 571
161 Ga0501047_0003807 3300049581 Bacteria 14177
162 Ga0501048_0440009 3300049582 Bacteria 933
163 Ga0501070_0907042 3300049586 Bacteria 687
164 Ga0501073_0581931 3300049589 Bacteria 773
165 Ga0501079_1279403 3300049741 Bacteria 578
166 Ga0501044_0229795 3300049823 Bacteria 1803
167 nmdc:mga05p37_44467_c1 3300050507 Bacteria 5464
168 nmdc:mga09592_191472_c1 3300050508 Bacteria 1770
169 nmdc:mga09592_93159_c1 3300050508 Bacteria 2576
170 nmdc:mga0qj67_47978_c1 3300050509 Bacteria 3374
171 nmdc:mga06r32_1345424_c1 3300050510 Bacteria 657
172 nmdc:mga06r32_205942_c1 3300050510 Bacteria 1955
173 nmdc:mga08y16_1756060_c1 3300050511 Bacteria 574
174 Ga0500579_128677 3300053143 Bacteria 1194
175 Ga0500600_0064271 3300053149 Bacteria 2034
176 Ga0501084_0755491 3300054114 Bacteria 819
177 2516092084 2515154203 Bacteria 5458536
178 2583151000 2582580736 Bacteria 5325865
179 2753267319 2751185782 Bacteria 11227053
180 2832005408 2832004796 Bacteria 6538017
181 2855674069 2855670206 Bacteria 7120389
182 2857295378 2857288857 Bacteria 7189066
183 2858886596 2858882152 Bacteria 7230291
184 2858898195 2858895516 Bacteria 7378898
185 2866065789 2866065130 Bacteria 6518152
186 2867512934 2867507094 Bacteria 6506033
187 2869067450 2869061728 Bacteria 7112407
188 2869072608 2869068681 Bacteria 7205615
189 2880495937 2880489317 Bacteria 7096270
190 2880496432 2880495981 Bacteria 7340502
191 2929225067 2929219909 Bacteria 6984360
192 2929231969 2929226422 Bacteria 7248583
193 2996224858 2996221748 Bacteria 6799777
194 8054705252 8054704163 Bacteria 7247792
195 8054730002 8054727385 Bacteria 7558670
196 8055416428 8055412473 Bacteria 6257500
197 Ga0157374_10684360
198 JGI25406J46586_10238904
199 rootH2_10202950
200 Ga0070683_100022477
201 Ga0070683_100121423
202 Ga0070670_100456685
203 Ga0068869_100448958
204 Ga0070666_11185404
205 Ga0070680_100468259
206 Ga0070680_100794843
207 Ga0068868_100707489
208 Ga0070660_100229881
209 Ga0070668_100033940
210 Ga0070671_100333691
211 Ga0070659_100939683
212 Ga0070667_100209619
213 Ga0070709_10484405
214 Ga0070701_10504399
215 Ga0070700_100144269
216 Ga0070700_100990751
217 Ga0070685_10112579
218 Ga0070684_100005511
219 Ga0070684_100100542
220 Ga0070665_101744216
221 Ga0070664_100086468
222 Ga0070664_100151290
223 Ga0070664_101292828
224 Ga0068857_100105480
225 Ga0068856_100286977
226 Ga0068856_102484186
227 Ga0068864_100626763
228 Ga0068861_100774500
229 Ga0068858_100250684
230 Ga0068858_100646850
231 Ga0068860_100042927
232 Ga0081540_1006129
233 Ga0081539_10008009
234 Ga0081539_10012523
235 Ga0081539_10033765
236 Ga0075434_100727684
237 Ga0075429_100007315
238 Ga0075429_100969231
239 Ga0111539_12065733
240 Ga0105245_10191955
241 Ga0114129_10004287
242 Ga0105248_12841285
243 Ga0105239_11754321
244 Ga0157371_10646326
245 Ga0157378_11922924
246 Ga0163162_10693033
247 Ga0157372_10732915
248 Ga0157375_11357879
249 Ga0163163_10981697
250 Ga0157380_10319528
251 Ga0157379_10688410
252 Ga0182007_10253406
253 Ga0207642_10483201
254 Ga0207710_10557908
255 Ga0207680_10259779
256 Ga0207699_11169389
257 Ga0207707_10297354
258 Ga0207657_10369522
259 Ga0207687_10225411
260 Ga0207644_10825641
261 Ga0207690_10480692
262 Ga0207690_10726503
263 Ga0207691_10270371
264 Ga0207691_10549609
265 Ga0207689_10162644
266 Ga0207661_10000667
267 Ga0207661_10217338
268 Ga0207679_10127515
269 Ga0207668_10006834
270 Ga0207658_10259919
271 Ga0207677_10159444
272 Ga0207677_11546344
273 Ga0207703_10400771
274 Ga0207703_10712081
275 Ga0207678_10403589
276 Ga0207702_10507487
277 Ga0207702_11205383
278 Ga0207702_12205656
279 Ga0207641_10580246
280 Ga0207674_10108714
281 Ga0207675_101860992
282 Ga0207675_102747954
283 Ga0207683_10412739
284 Ga0207698_11105122
285 Ga0268265_10182265
286 Ga0268265_10678848
287 Ga0268265_11927798
288 Ga0268264_10040609
289 Ga0307515_10000148
290 Ga0307515_10053486
291 Ga0307512_10338600
292 Ga0307513_10072008
293 Ga0307513_10415146
294 Ga0307509_10006392
295 Ga0307509_10785307
296 Ga0307408_100250819
297 Ga0307508_10494802
298 Ga0307514_10150327
299 Ga0307516_10028620
300 Ga0307516_10115759
301 Ga0307516_10395697
302 Ga0307516_10658134
303 Ga0307405_10521219
304 Ga0307405_10865728
305 Ga0307405_11988605
306 Ga0307413_11003923
307 Ga0307410_10023301
308 Ga0307410_10885091
309 Ga0307410_11138609
310 Ga0307410_11932764
311 Ga0326468_10000586
312 Ga0307406_10006037
313 Ga0307406_10268394
314 Ga0307406_10642755
315 Ga0307406_11254556
316 Ga0307407_10055552
317 Ga0307412_11035765
318 Ga0307409_100068356
319 Ga0307409_100261099
320 Ga0307409_101069004
321 Ga0307409_102175442
322 Ga0307416_100239952
323 Ga0307416_102359285
324 Ga0307414_10036324
325 Ga0307411_10891010
326 Ga0307415_100089349
327 Ga0307415_100253494
328 Ga0307510_10393404
329 Ga0373951_0000210
330 Ga0373962_0003088
331 Ga0373935_0019393
332 Ga0373937_2158178
333 Ga0395899_0036602
334 Ga0395900_0102371
335 Ga0395898_0028053
336 Ga0395905_0098343
337 Ga0395901_0267293
338 Ga0451787_301077
339 Ga0451797_1298497
340 Ga0451851_0920254
341 Ga0439463_100728
342 Ga0450905_100244
343 Ga0466966_0484427
344 Ga0466967_0137726
345 Ga0466967_2292508
346 Ga0495594_0083173
347 Ga0495594_0586142
348 Ga0495668_0453325
349 Ga0495649_0545962
350 Ga0496108_0000065
351 Ga0501034_0756205
352 Ga0501036_0421443
353 Ga0501037_0414981
354 Ga0501038_0261950
355 Ga0501042_0610621
356 Ga0501043_1071192
357 Ga0501047_0003807
358 Ga0501048_0440009
359 Ga0501070_0907042
360 Ga0501073_0581931
361 Ga0501079_1279403
362 Ga0501044_0229795
363 nmdc:mga05p37_44467_c1
364 nmdc:mga09592_191472_c1
365 nmdc:mga09592_93159_c1
366 nmdc:mga0qj67_47978_c1
367 nmdc:mga06r32_1345424_c1
368 nmdc:mga06r32_205942_c1
369 nmdc:mga08y16_1756060_c1
370 Ga0500579_128677
371 Ga0500600_0064271
372 Ga0501084_0755491
373 2516092084
374 2583151000
375 2753267319
376 2832005408
377 2855674069
378 2857295378
379 2858886596
380 2858898195
381 2866065789
382 2867512934
383 2869067450
384 2869072608
385 2880495937
386 2880496432
387 2929225067
388 2929231969
389 2996224858
390 8054705252
391 8054730002
392 8055416428

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

4

112

0.94

PF01230

HIT

HIT domain

12

110

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.965 4 109
6j65-assembly1.cif.gz_B crystal structure of human hint1 mutant complexing with ap4a ii 0.9599 4 109
3o1x-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c84a mutant from rabbit complexed with adenosine 0.9593 4 109
3o1c-assembly1.cif.gz_A-2 high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) c38a mutant from rabbit complexed with adenosine 0.9592 4 109
5km6-assembly1.cif.gz_A-2 human histidine triad nucleotide binding protein 1 (hhint1) h112n mutant ara-a nucleoside phosphoramidate substrate complex 0.9589 4 109
ID Description Score Start End Superfamily
4q61B00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9584 5 108 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9533 1 114 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9507 4 109 3.30.428.10
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9502 1 115 3.30.428.10
af_Q8STA5_22_150_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9434 1 109 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A6I2Z066-F1-model_v4 HIT domain-containing protein 0.9946 1 111 GO:0003824
AF-A0A7Y0GTJ9-F1-model_v4 Histidine triad nucleotide-binding protein 0.9941 4 109 GO:0003824
AF-A0A6G4VCG8-F1-model_v4 Histidine triad nucleotide-binding protein 0.9939 2 109 GO:0003824
AF-A0A542XNQ8-F1-model_v4 Histidine triad (HIT) family protein 0.9932 4 115 GO:0003824
AF-A0A6I5HKX2-F1-model_v4 HIT domain-containing protein 0.993 2 111 GO:0003824

Map