F300456

General Info

Members Datasets Scaffolds Average Seq Length
195 137 182 300

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0006425|Ga0451577_0006425_7572_8579
Length 335
Sequence MNFGGLFYKGFRSFHEPEETMEELRTGREKYSWLPKFQKWGFRDRKNFKTGMVFLLPWTIGFLAFTLYPMLASLVYSFSIYHSRAPLEWNGIKNYVDLFTDDLFWTALYNTVYMVAIGVPLTLFVSFFCAVLLNLNVRGQAIYRVIYFLPSIVPTVASTILWLWILNPQAGIMNTVLGYIGIDGPNWMTNPAWSKPGLILLGMWGMGNTIVIYLSGLQDVPINLIEAAELDGANWWQRLWYITIPMVSPITLFNLITGVIFMFQYFAQAYVFRGFQNLGYPLNSTLFYSVLLYQNAFQWLKMGYASAMAWVLFIIILVCTLLLLKISDRFTYYAG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
3 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
4 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
5 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
6 2818991459 Paenibacillus sp. 597 Isolate Unclassified
7 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
8 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
9 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
10 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
16 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
67 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
68 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
69 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
70 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
71 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
74 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
77 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
80 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
81 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
82 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
83 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
84 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
85 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
86 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
87 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
90 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
93 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
94 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
95 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
96 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
105 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
106 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
107 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
108 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
126 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
127 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
132 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
135 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
136 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
137 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.74
Metatranscriptomes 3.59
Isolates 6.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.54
Nodule 0.51
Rhizoplane 0.51
Rhizosphere 94.36
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2790966 2162886007 Bacteria 8940
2 rootH2_10026864 3300003320 Bacteria 17464
3 rootH1_10248383 3300003323 Unclassified 1889
4 Ga0055541_1007905 3300003841 Bacteria 1721
5 Ga0058863_10155258 3300004799 Bacteria 2754
6 Ga0058861_10092516 3300004800 Bacteria 3435
7 Ga0058862_12729133 3300004803 Bacteria 3285
8 Ga0065704_10070831 3300005289 Bacteria 15617
9 Ga0065707_10007366 3300005295 Bacteria 3806
10 Ga0070658_10011056 3300005327 Bacteria 7235
11 Ga0070683_100002063 3300005329 Bacteria 15856
12 Ga0070670_100146358 3300005331 Bacteria 2044
13 Ga0070660_100257278 3300005339 Bacteria 1425
14 Ga0070675_100012547 3300005354 Bacteria 6644
15 Ga0070671_100015580 3300005355 Bacteria 6143
16 Ga0070673_100613478 3300005364 Bacteria 993
17 Ga0070713_100058389 3300005436 Unclassified 3218
18 Ga0070708_100499721 3300005445 Bacteria 1147
19 Ga0070706_100042136 3300005467 Bacteria 4216
20 Ga0070665_100000279 3300005548 Bacteria 84232
21 Ga0068855_100170937 3300005563 Unclassified 2461
22 Ga0068857_100024481 3300005577 Bacteria 5315
23 Ga0068856_100019125 3300005614 Bacteria 6649
24 Ga0068863_100193733 3300005841 Bacteria 1954
25 Ga0068863_100661187 3300005841 Unclassified 1037
26 Ga0068860_100743754 3300005843 Bacteria 992
27 Ga0081539_10003975 3300005985 Bacteria 17089
28 Ga0081539_10004050 3300005985 Bacteria 16791
29 Ga0081539_10087146 3300005985 Bacteria 1622
30 Ga0070717_10000014 3300006028 Bacteria 218451
31 Ga0075428_100242296 3300006844 Bacteria 1945
32 Ga0075433_10064874 3300006852 Bacteria 3202
33 Ga0075434_100190054 3300006871 Bacteria 2074
34 Ga0105240_10033910 3300009093 Bacteria 6591
35 Ga0111539_10940717 3300009094 Bacteria 1005
36 Ga0105245_10054466 3300009098 Unclassified 3592
37 Ga0114129_10003734 3300009147 Bacteria 21462
38 Ga0114129_10166668 3300009147 Bacteria 3006
39 Ga0114129_10229406 3300009147 Bacteria 2501
40 Ga0114129_10808114 3300009147 Bacteria 1196
41 Ga0105248_10768798 3300009177 Unclassified 1087
42 Ga0105239_10049656 3300010375 Bacteria 4600
43 Ga0157369_10650115 3300013105 Bacteria 1087
44 Ga0163162_10214225 3300013306 Bacteria 2056
45 Ga0157372_10444529 3300013307 Bacteria 1511
46 Ga0163163_10053135 3300014325 Bacteria 3998
47 Ga0163161_10175602 3300017792 Bacteria 1640
48 Ga0206352_10553142 3300020078 Bacteria 2659
49 Ga0206350_10658499 3300020080 Bacteria 4793
50 Ga0224712_10002466 3300022467 Bacteria 4565
51 Ga0224712_10003488 3300022467 Bacteria 4097
52 Ga0209566_101055 3300025225 Bacteria 11107
53 Ga0207705_10037362 3300025909 Bacteria 3475
54 Ga0207684_10030637 3300025910 Bacteria 4579
55 Ga0207659_10042420 3300025926 Unclassified 3190
56 Ga0207687_10068179 3300025927 Unclassified 2533
57 Ga0207700_10166055 3300025928 Unclassified 1837
58 Ga0207644_10506144 3300025931 Bacteria 997
59 Ga0207661_10141578 3300025944 Bacteria 2070
60 Ga0207702_10002226 3300026078 Bacteria 18592
61 Ga0207674_10035185 3300026116 Bacteria 5228
62 Ga0268266_10000236 3300028379 Bacteria 94541
63 Ga0268264_10181073 3300028381 Bacteria 1914
64 Ga0265319_1001049 3300028563 Bacteria 17234
65 Ga0265318_10000978 3300028577 Bacteria 18306
66 Ga0265318_10007670 3300028577 Bacteria 4859
67 Ga0265336_10004403 3300028666 Bacteria 5334
68 Ga0265338_10010055 3300028800 Bacteria 11181
69 Ga0265324_10000710 3300029957 Bacteria 22199
70 Ga0265328_10018107 3300031239 Bacteria 2720
71 Ga0265320_10007688 3300031240 Bacteria 6666
72 Ga0265320_10008827 3300031240 Bacteria 6133
73 Ga0265320_10016668 3300031240 Bacteria 4111
74 Ga0265325_10044938 3300031241 Bacteria 2297
75 Ga0265327_10003625 3300031251 Bacteria 14524
76 Ga0265316_10003625 3300031344 Bacteria 15563
77 Ga0265316_10023287 3300031344 Bacteria 5206
78 Ga0265316_10266323 3300031344 Unclassified 1255
79 Ga0316579_10016083 3300031691 Bacteria 3261
80 Ga0265314_10012927 3300031711 Bacteria 6779
81 Ga0265314_10051264 3300031711 Bacteria 2875
82 Ga0265342_10154023 3300031712 Bacteria 1274
83 Ga0316577_10025864 3300031733 Bacteria 3265
84 Ga0316577_10048069 3300031733 Bacteria 2383
85 Ga0307410_10067518 3300031852 Bacteria 2467
86 Ga0307409_100046957 3300031995 Bacteria 3273
87 Ga0307409_100061387 3300031995 Bacteria 2937
88 Ga0307416_100203209 3300032002 Bacteria 1882
89 Ga0307414_10617865 3300032004 Bacteria 974
90 Ga0307411_10058784 3300032005 Bacteria 2546
91 Ga0307411_10085231 3300032005 Bacteria 2188
92 Ga0307411_10099932 3300032005 Bacteria 2049
93 Ga0307415_100112456 3300032126 Bacteria 2023
94 Ga0307415_100151864 3300032126 Bacteria 1784
95 Ga0373951_0044724 3300035091 Bacteria 1076
96 Ga0316574_0021534 3300035398 Bacteria 3829
97 Ga0373937_0071365 3300036401 Bacteria 3203
98 Ga0373937_0244024 3300036401 Bacteria 1693
99 Ga0316582_0006725 3300036647 Bacteria 6068
100 Ga0316582_0152182 3300036647 Bacteria 1564
101 Ga0316582_0292638 3300036647 Bacteria 1118
102 Ga0316584_0317304 3300036712 Bacteria 1125
103 Ga0395905_0104523 3300037471 Bacteria 2659
104 Ga0316581_0050491 3300037588 Bacteria 1275
105 Ga0439433_0014085 3300041999 Bacteria 1760
106 Ga0439449_0073624 3300042007 Bacteria 1258
107 Ga0451577_0006425 3300042876 Bacteria 11726
108 Ga0451577_0279533 3300042876 Bacteria 1512
109 Ga0451577_0400938 3300042876 Bacteria 1245
110 Ga0453683_0000471 3300044673 Bacteria 46311
111 Ga0453683_0235985 3300044673 Bacteria 1164
112 Ga0453684_0000748 3300044712 Bacteria 113352
113 Ga0453684_0000958 3300044712 Bacteria 94987
114 Ga0453684_0036454 3300044712 Bacteria 6778
115 Ga0453684_0039647 3300044712 Bacteria 6413
116 Ga0453684_0062946 3300044712 Unclassified 4749
117 Ga0453684_0069027 3300044712 Bacteria 4485
118 Ga0453684_0083122 3300044712 Bacteria 3986
119 Ga0453684_0169320 3300044712 Bacteria 2576
120 Ga0453684_0185989 3300044712 Unclassified 2434
121 Ga0453684_0278379 3300044712 Bacteria 1909
122 Ga0453684_0300995 3300044712 Bacteria 1823
123 Ga0453684_0375516 3300044712 Bacteria 1597
124 Ga0453684_0477605 3300044712 Unclassified 1383
125 Ga0466968_0011914 3300044735 Bacteria 3394
126 Ga0466970_0193577 3300044765 Bacteria 1130
127 Ga0466957_0062217 3300044842 Bacteria 2292
128 Ga0466959_0012584 3300045049 Bacteria 6119
129 Ga0451576_0000126 3300045051 Bacteria 193283
130 Ga0451576_0003561 3300045051 Bacteria 21205
131 Ga0451576_0017257 3300045051 Bacteria 7941
132 Ga0451576_0670718 3300045051 Bacteria 1089
133 Ga0451576_0727992 3300045051 Bacteria 1042
134 Ga0466967_0083610 3300045976 Unclassified 2887
135 Ga0466967_0162887 3300045976 Bacteria 2095
136 Ga0466967_0588164 3300045976 Bacteria 1098
137 Ga0495618_0113106 3300046514 Bacteria 1738
138 Ga0495613_0001658 3300046689 Bacteria 16948
139 Ga0495674_0380475 3300047319 Bacteria 1142
140 Ga0495684_0039769 3300047471 Bacteria 3605
141 Ga0496115_0001847 3300048918 Bacteria 15145
142 Ga0501031_0006661 3300049568 Bacteria 7538
143 Ga0501032_0000342 3300049569 Bacteria 39000
144 Ga0501032_0123634 3300049569 Bacteria 1710
145 Ga0501033_0007509 3300049570 Bacteria 8483
146 Ga0501034_0001215 3300049571 Bacteria 35262
147 Ga0501034_0096679 3300049571 Bacteria 2949
148 Ga0501034_0151987 3300049571 Unclassified 2290
149 Ga0501036_0003995 3300049572 Bacteria 11856
150 Ga0501037_0058123 3300049573 Unclassified 2822
151 Ga0501038_0050778 3300049574 Bacteria 3582
152 Ga0501039_0017037 3300049575 Bacteria 5571
153 Ga0501042_0007144 3300049578 Bacteria 7306
154 Ga0501046_0073332 3300049580 Bacteria 2656
155 Ga0501047_0003279 3300049581 Bacteria 15324
156 Ga0501048_0044577 3300049582 Bacteria 3170
157 Ga0501070_0075150 3300049586 Bacteria 2797
158 Ga0501073_0012776 3300049589 Bacteria 6125
159 Ga0501075_0359383 3300049591 Unclassified 1110
160 Ga0501080_0008221 3300049742 Bacteria 9447
161 Ga0501083_0001164 3300049744 Bacteria 17698
162 Ga0501283_025446 3300049779 Bacteria 969
163 Ga0501035_0007790 3300049822 Bacteria 10008
164 Ga0501044_0000187 3300049823 Bacteria 77620
165 Ga0501044_0025185 3300049823 Bacteria 6308
166 Ga0501044_0037071 3300049823 Bacteria 5098
167 Ga0501044_0066353 3300049823 Bacteria 3679
168 Ga0501044_0491757 3300049823 Unclassified 1129
169 nmdc:mga05p37_11516_c1 3300050507 Bacteria 10535
170 nmdc:mga05p37_231987_c1 3300050507 Bacteria 2223
171 nmdc:mga05p37_337639_c1 3300050507 Unclassified 1778
172 nmdc:mga05p37_437753_c1 3300050507 Bacteria 1517
173 nmdc:mga05p37_524318_c1 3300050507 Bacteria 1354
174 nmdc:mga09592_192101_c1 3300050508 Bacteria 1767
175 nmdc:mga06r32_437817_c1 3300050510 Unclassified 1287
176 nmdc:mga0n895_177302_c1 3300050512 Bacteria 2162
177 nmdc:mga0n895_197490_c1 3300050512 Bacteria 2043
178 nmdc:mga0a205_494574_c1 3300050515 Bacteria 1080
179 nmdc:mga0a205_79823_c1 3300050515 Bacteria 3162
180 Ga0500645_018061 3300053730 Bacteria 2205
181 Ga0501084_0021986 3300054114 Bacteria 5321
182 Ga0501084_0130382 3300054114 Bacteria 2117

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045051 Ga0451576_0727992 Ga0451576_0727992_271_1017 225
2 3300009147 Ga0114129_10229406 Ga0114129_102294062 256
3 3300049589 Ga0501073_0012776 Ga0501073_0012776_3863_4693 257
4 3300042007 Ga0439449_0073624 Ga0439449_0073624_453_1247 262
5 3300004799 Ga0058863_10155258 Ga0058863_101552582 267
6 3300004800 Ga0058861_10092516 Ga0058861_100925162 267
7 3300004803 Ga0058862_12729133 Ga0058862_127291332 267
8 3300020078 Ga0206352_10553142 Ga0206352_105531422 267
9 3300020080 Ga0206350_10658499 Ga0206350_106584992 267
10 3300022467 Ga0224712_10002466 Ga0224712_100024662 267
11 3300044735 Ga0466968_0011914 Ga0466968_0011914_2466_3335 270
12 3300045049 Ga0466959_0012584 Ga0466959_0012584_3459_4328 270
13 3300031344 Ga0265316_10266323 Ga0265316_102663231 271
14 3300047319 Ga0495674_0380475 Ga0495674_0380475_218_1042 271
15 3300032004 Ga0307414_10617865 Ga0307414_106178651 273
16 3300031344 Ga0265316_10003625 Ga0265316_100036259 275
17 3300044842 Ga0466957_0062217 Ga0466957_0062217_712_1617 275
18 3300005354 Ga0070675_100012547 Ga0070675_1000125474 278
19 3300025926 Ga0207659_10042420 Ga0207659_100424202 278
20 3300009093 Ga0105240_10033910 Ga0105240_100339105 280
21 3300036401 Ga0373937_0071365 Ga0373937_0071365_1612_2490 281
22 3300046514 Ga0495618_0113106 Ga0495618_0113106_122_1000 281
23 3300046689 Ga0495613_0001658 Ga0495613_0001658_10054_10932 281
24 3300047471 Ga0495684_0039769 Ga0495684_0039769_1889_2767 281
25 3300006844 Ga0075428_100242296 Ga0075428_1002422962 283
26 3300036647 Ga0316582_0292638 Ga0316582_0292638_208_1092 283
27 3300044673 Ga0453683_0235985 Ga0453683_0235985_190_1110 283
28 3300044712 Ga0453684_0083122 Ga0453684_0083122_2643_3563 283
29 3300045051 Ga0451576_0017257 Ga0451576_0017257_4339_5259 283
30 3300031691 Ga0316579_10016083 Ga0316579_100160832 284
31 3300042876 Ga0451577_0400938 Ga0451577_0400938_62_940 284
32 3300044712 Ga0453684_0185989 Ga0453684_0185989_493_1371 284
33 3300049823 Ga0501044_0491757 Ga0501044_0491757_196_1107 284
34 3300054114 Ga0501084_0021986 Ga0501084_0021986_2184_3095 284
35 3300013105 Ga0157369_10650115 Ga0157369_106501151 286
36 3300003841 Ga0055541_1007905 Ga0055541_10079051 287
37 3300025225 Ga0209566_101055 Ga0209566_10105510 287
38 3300045051 Ga0451576_0670718 Ga0451576_0670718_121_987 287
39 3300049571 Ga0501034_0096679 Ga0501034_0096679_1034_1945 287
40 3300049573 Ga0501037_0058123 Ga0501037_0058123_1659_2570 287
41 3300049823 Ga0501044_0025185 Ga0501044_0025185_1538_2449 287
42 3300049744 Ga0501083_0001164 Ga0501083_0001164_15866_16777 288
43 3300005548 Ga0070665_100000279 Ga0070665_10000027963 289
44 3300028379 Ga0268266_10000236 Ga0268266_1000023670 289
45 3300031995 Ga0307409_100061387 Ga0307409_1000613872 290
46 3300032005 Ga0307411_10099932 Ga0307411_100999322 290
47 3300036401 Ga0373937_0244024 Ga0373937_0244024_189_1070 290
48 3300045976 Ga0466967_0588164 Ga0466967_0588164_96_1052 291
49 3300005327 Ga0070658_10011056 Ga0070658_100110562 292
50 3300005339 Ga0070660_100257278 Ga0070660_1002572782 292
51 3300005355 Ga0070671_100015580 Ga0070671_1000155805 292
52 3300005364 Ga0070673_100613478 Ga0070673_1006134781 292
53 3300005563 Ga0068855_100170937 Ga0068855_1001709372 292
54 3300005841 Ga0068863_100193733 Ga0068863_1001937332 292
55 3300005985 Ga0081539_10087146 Ga0081539_100871462 292
56 3300006852 Ga0075433_10064874 Ga0075433_100648743 292
57 3300009098 Ga0105245_10054466 Ga0105245_100544663 292
58 3300009147 Ga0114129_10166668 Ga0114129_101666682 292
59 3300009177 Ga0105248_10768798 Ga0105248_107687982 292
60 3300010375 Ga0105239_10049656 Ga0105239_100496562 292
61 3300017792 Ga0163161_10175602 Ga0163161_101756022 292
62 3300025909 Ga0207705_10037362 Ga0207705_100373622 292
63 3300025927 Ga0207687_10068179 Ga0207687_100681792 292
64 3300025931 Ga0207644_10506144 Ga0207644_105061441 292
65 3300037471 Ga0395905_0104523 Ga0395905_0104523_948_1829 292
66 3300050507 nmdc:mga05p37_437753_c1 nmdc:mga05p37_437753_c1_195_1079 292
67 3300050507 nmdc:mga05p37_524318_c1 nmdc:mga05p37_524318_c1_113_1000 292
68 3300050508 nmdc:mga09592_192101_c1 nmdc:mga09592_192101_c1_269_1201 292
69 3300050512 nmdc:mga0n895_177302_c1 nmdc:mga0n895_177302_c1_35_919 292
70 3300050515 nmdc:mga0a205_79823_c1 nmdc:mga0a205_79823_c1_1358_2242 292
71 3300005331 Ga0070670_100146358 Ga0070670_1001463582 293
72 3300009094 Ga0111539_10940717 Ga0111539_109407171 293
73 3300014325 Ga0163163_10053135 Ga0163163_100531352 293
74 3300031711 Ga0265314_10051264 Ga0265314_100512643 293
75 3300045051 Ga0451576_0000126 Ga0451576_0000126_43600_44523 293
76 3300045051 Ga0451576_0003561 Ga0451576_0003561_6554_7477 293
77 3300049569 Ga0501032_0123634 Ga0501032_0123634_647_1531 293
78 3300049581 Ga0501047_0003279 Ga0501047_0003279_14203_15087 293
79 3300049586 Ga0501070_0075150 Ga0501070_0075150_1300_2184 293
80 3300049742 Ga0501080_0008221 Ga0501080_0008221_8388_9272 293
81 3300049823 Ga0501044_0000187 Ga0501044_0000187_61638_62522 293
82 3300003320 rootH2_10026864 rootH2_100268648 294
83 3300005467 Ga0070706_100042136 Ga0070706_1000421363 294
84 3300005577 Ga0068857_100024481 Ga0068857_1000244813 294
85 3300005614 Ga0068856_100019125 Ga0068856_1000191252 294
86 3300006028 Ga0070717_10000014 Ga0070717_1000001412 294
87 3300025910 Ga0207684_10030637 Ga0207684_100306373 294
88 3300026078 Ga0207702_10002226 Ga0207702_1000222613 294
89 3300026116 Ga0207674_10035185 Ga0207674_100351853 294
90 3300031240 Ga0265320_10008827 Ga0265320_100088272 294
91 3300045976 Ga0466967_0083610 Ga0466967_0083610_1464_2378 294
92 3300049779 Ga0501283_025446 Ga0501283_025446_41_928 294
93 3300053730 Ga0500645_018061 Ga0500645_018061_945_1907 294
94 3300003323 rootH1_10248383 rootH1_102483832 295
95 3300005436 Ga0070713_100058389 Ga0070713_1000583892 295
96 3300006871 Ga0075434_100190054 Ga0075434_1001900542 295
97 3300009147 Ga0114129_10003734 Ga0114129_1000373414 295
98 3300025928 Ga0207700_10166055 Ga0207700_101660552 295
99 3300049571 Ga0501034_0001215 Ga0501034_0001215_12480_13370 295
100 3300049823 Ga0501044_0037071 Ga0501044_0037071_95_985 295
101 3300050507 nmdc:mga05p37_11516_c1 nmdc:mga05p37_11516_c1_2264_3214 295
102 3300050512 nmdc:mga0n895_197490_c1 nmdc:mga0n895_197490_c1_101_1051 295
103 iso_pu_bacteria 8002317523 8002321066 295
104 3300005329 Ga0070683_100002063 Ga0070683_10000206312 296
105 3300009147 Ga0114129_10808114 Ga0114129_108081142 296
106 3300013306 Ga0163162_10214225 Ga0163162_102142252 296
107 3300022467 Ga0224712_10003488 Ga0224712_100034882 296
108 3300025944 Ga0207661_10141578 Ga0207661_101415782 296
109 3300028563 Ga0265319_1001049 Ga0265319_100104913 296
110 3300028577 Ga0265318_10000978 Ga0265318_100009785 296
111 3300028577 Ga0265318_10007670 Ga0265318_100076704 296
112 3300028666 Ga0265336_10004403 Ga0265336_100044032 296
113 3300028800 Ga0265338_10010055 Ga0265338_100100556 296
114 3300029957 Ga0265324_10000710 Ga0265324_100007106 296
115 3300031239 Ga0265328_10018107 Ga0265328_100181072 296
116 3300031240 Ga0265320_10007688 Ga0265320_100076883 296
117 3300031240 Ga0265320_10016668 Ga0265320_100166683 296
118 3300031241 Ga0265325_10044938 Ga0265325_100449382 296
119 3300031251 Ga0265327_10003625 Ga0265327_100036256 296
120 3300031344 Ga0265316_10023287 Ga0265316_100232875 296
121 3300031711 Ga0265314_10012927 Ga0265314_100129272 296
122 3300031712 Ga0265342_10154023 Ga0265342_101540232 296
123 3300044673 Ga0453683_0000471 Ga0453683_0000471_5998_6957 296
124 3300044712 Ga0453684_0036454 Ga0453684_0036454_4832_5728 296
125 3300044765 Ga0466970_0193577 Ga0466970_0193577_80_1027 296
126 3300048918 Ga0496115_0001847 Ga0496115_0001847_4161_5075 296
127 3300049568 Ga0501031_0006661 Ga0501031_0006661_4679_5599 296
128 3300049569 Ga0501032_0000342 Ga0501032_0000342_37616_38536 296
129 3300049570 Ga0501033_0007509 Ga0501033_0007509_7458_8378 296
130 3300049572 Ga0501036_0003995 Ga0501036_0003995_950_1870 296
131 3300049574 Ga0501038_0050778 Ga0501038_0050778_699_1619 296
132 3300049575 Ga0501039_0017037 Ga0501039_0017037_3226_4146 296
133 3300049578 Ga0501042_0007144 Ga0501042_0007144_5997_6917 296
134 3300049580 Ga0501046_0073332 Ga0501046_0073332_531_1451 296
135 3300049582 Ga0501048_0044577 Ga0501048_0044577_1351_2271 296
136 3300049822 Ga0501035_0007790 Ga0501035_0007790_2254_3174 296
137 3300049823 Ga0501044_0066353 Ga0501044_0066353_2471_3391 296
138 iso_pu_bacteria 2643221676 2644426993 296
139 3300005841 Ga0068863_100661187 Ga0068863_1006611872 297
140 3300031852 Ga0307410_10067518 Ga0307410_100675182 297
141 3300031995 Ga0307409_100046957 Ga0307409_1000469571 297
142 3300032002 Ga0307416_100203209 Ga0307416_1002032092 297
143 3300032005 Ga0307411_10058784 Ga0307411_100587843 297
144 3300032126 Ga0307415_100151864 Ga0307415_1001518642 297
145 3300013307 Ga0157372_10444529 Ga0157372_104445292 298
146 3300044712 Ga0453684_0062946 Ga0453684_0062946_3578_4477 298
147 3300031733 Ga0316577_10048069 Ga0316577_100480692 300
148 3300036712 Ga0316584_0317304 Ga0316584_0317304_35_979 300
149 3300041999 Ga0439433_0014085 Ga0439433_0014085_448_1356 300
150 3300036647 Ga0316582_0152182 Ga0316582_0152182_98_1042 301
151 3300035398 Ga0316574_0021534 Ga0316574_0021534_2741_3661 302
152 3300044712 Ga0453684_0300995 Ga0453684_0300995_693_1613 302
153 iso_pu_bacteria 2888578766 2888584294 305
154 3300037588 Ga0316581_0050491 Ga0316581_0050491_207_1151 306
155 3300044712 Ga0453684_0477605 Ga0453684_0477605_57_995 308
156 3300050510 nmdc:mga06r32_437817_c1 nmdc:mga06r32_437817_c1_295_1233 308
157 3300005985 Ga0081539_10003975 Ga0081539_100039757 310
158 iso_pu_bacteria 2515154155 2515853098 310
159 iso_pu_bacteria 2675903058 2676473813 310
160 iso_pu_bacteria 2827628540 2827628702 310
161 3300036647 Ga0316582_0006725 Ga0316582_0006725_1452_2396 311
162 iso_pu_bacteria 2585428059 2587744193 311
163 iso_pu_bacteria 2643221676 2644422043 311
164 iso_pu_bacteria 8054795415 8054797406 311
165 3300005985 Ga0081539_10004050 Ga0081539_1000405012 312
166 3300031733 Ga0316577_10025864 Ga0316577_100258642 312
167 3300044712 Ga0453684_0000748 Ga0453684_0000748_85933_86880 312
168 3300044712 Ga0453684_0069027 Ga0453684_0069027_3034_3981 312
169 3300044712 Ga0453684_0169320 Ga0453684_0169320_1478_2425 312
170 3300044712 Ga0453684_0278379 Ga0453684_0278379_706_1653 312
171 3300049591 Ga0501075_0359383 Ga0501075_0359383_139_1086 312
172 3300054114 Ga0501084_0130382 Ga0501084_0130382_742_1689 312
173 iso_pu_bacteria 2888578766 2888581787 312
174 iso_pu_bacteria 2919425241 2919426848 312
175 3300042876 Ga0451577_0279533 Ga0451577_0279533_406_1365 313
176 iso_pu_bacteria 2818991459 2819668564 313
177 iso_pu_bacteria 2904755435 2904757537 313
178 3300032005 Ga0307411_10085231 Ga0307411_100852312 314
179 3300032126 Ga0307415_100112456 Ga0307415_1001124561 314
180 3300049571 Ga0501034_0151987 Ga0501034_0151987_607_1569 314
181 3300045976 Ga0466967_0162887 Ga0466967_0162887_56_1030 315
182 2162886007 SwRhRL2b_contig_2790966 SwRhRL2b_0538.00000200 316
183 3300005289 Ga0065704_10070831 Ga0065704_100708313 316
184 3300005295 Ga0065707_10007366 Ga0065707_100073663 316
185 3300005445 Ga0070708_100499721 Ga0070708_1004997212 316
186 3300005843 Ga0068860_100743754 Ga0068860_1007437541 316
187 3300028381 Ga0268264_10181073 Ga0268264_101810732 316
188 3300035091 Ga0373951_0044724 Ga0373951_0044724_10_960 316
189 3300042876 Ga0451577_0006425 Ga0451577_0006425_7572_8579 316
190 3300044712 Ga0453684_0000958 Ga0453684_0000958_69505_70512 316
191 3300044712 Ga0453684_0039647 Ga0453684_0039647_2490_3497 316
192 3300044712 Ga0453684_0375516 Ga0453684_0375516_256_1221 316
193 3300050507 nmdc:mga05p37_231987_c1 nmdc:mga05p37_231987_c1_393_1370 316
194 3300050507 nmdc:mga05p37_337639_c1 nmdc:mga05p37_337639_c1_90_1040 316
195 3300050515 nmdc:mga0a205_494574_c1 nmdc:mga0a205_494574_c1_114_1064 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

101

332

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.9177 26 307
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9153 26 307
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9059 26 307
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.893 26 307
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8858 27 313
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9602 69 310 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9525 70 313 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9448 70 313 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9412 69 310 1.10.3720.10
af_I6XFF3_60_302_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9408 70 310 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V4SQ86-F1-model_v4 Sugar ABC transporter permease 0.9876 33 310 GO:0005886
GO:0055085
AF-A0A7V5YWK9-F1-model_v4 Sugar ABC transporter permease 0.9866 52 316 GO:0005886
GO:0055085
AF-A0A7G7G1S1-F1-model_v4 Sugar ABC transporter permease 0.9842 26 316 GO:0005886
GO:0055085
AF-A0A3M1QT38-F1-model_v4 Sugar ABC transporter permease 0.9834 52 316 GO:0005886
GO:0055085
AF-C0B6R2-F1-model_v4 ABC transporter, permease protein 0.9818 82 315 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
85.17 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map