F299131

General Info

Members Datasets Scaffolds Average Seq Length
194 139 168 251

Family's Representative Sequence

Representative Sequence 3300046616|Ga0495668_0014742|Ga0495668_0014742_324_1184
Length 286
Sequence LAAEKIKQTAADKFERCDPRAADGEDSMGSGQFEGKVALVTGAASGIGEATALAFADEGATVIVADIQADKGHAVVDAIKAKGVPAMYLQFDVRNEDSIRDGIDTIVRQYGKLDCAFNNAGVEGTFTPLLEQSNEMWDAIIDTDLRGTFHCMKYEIIQMLKQGGGAIVNCGSLCAMVGVAGMTSYVAAKHGVIGLTKTAALDYATQNIRVNAVCPGSILTQAAERNVFSLPPEQRDAMEAYLMANQPIGRWGKSEEIAAAVLWLCSPGASLMLGHAMMVDGGWTAR

Samples

Sample ID Description Type Environment
1 2802429637 Rhizobium anhuiense C15 Isolate Nodule
2 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
3 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
4 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
5 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
6 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
7 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
8 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
19 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
20 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
21 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
31 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
32 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
33 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
34 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
35 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
40 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
41 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
46 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
47 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
48 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
64 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
65 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
66 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
67 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
68 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
69 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
70 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
71 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
72 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
73 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
74 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
75 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
76 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
77 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
78 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
85 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
92 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
93 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
94 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
95 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
96 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
97 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
98 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
99 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
100 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
101 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
102 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
103 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
104 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
105 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
106 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
109 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
110 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
112 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
113 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
114 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
115 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
116 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
117 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
118 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
119 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
120 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
121 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
122 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
123 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
124 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
125 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
126 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
127 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
128 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
129 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
130 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
131 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
132 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
133 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
134 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
135 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
136 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
137 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
138 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
139 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.63
Metatranscriptomes 0
Isolates 12.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.19
Nodule 12.37
Rhizoplane 1.03
Rhizosphere 69.59
Stem 0
Stem Tuber 0
Unclassified 10.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10007630 3300003203 Bacteria 4923
2 JGI25406J46586_10036573 3300003203 Bacteria 1780
3 Ga0070658_10214123 3300005327 Bacteria 1628
4 Ga0070670_100341454 3300005331 Bacteria 1314
5 Ga0070671_100141972 3300005355 Bacteria 2026
6 Ga0070708_100637147 3300005445 Bacteria 1005
7 Ga0070663_100311499 3300005455 Unclassified 1263
8 Ga0070698_100004314 3300005471 Bacteria 15641
9 Ga0070698_100026855 3300005471 Bacteria 5987
10 Ga0070699_100116615 3300005518 Bacteria 2347
11 Ga0070665_100029401 3300005548 Bacteria 5531
12 Ga0070665_100215453 3300005548 Bacteria 1921
13 Ga0068855_100018501 3300005563 Bacteria 8376
14 Ga0068855_100039009 3300005563 Bacteria 5639
15 Ga0070664_100129653 3300005564 Bacteria 2214
16 Ga0068859_100057063 3300005617 Bacteria 3933
17 Ga0081455_10013679 3300005937 Bacteria 7992
18 Ga0081455_10066730 3300005937 Bacteria 3003
19 Ga0081455_10137439 3300005937 Bacteria 1902
20 Ga0081455_10233771 3300005937 Bacteria 1355
21 Ga0081539_10000921 3300005985 Bacteria 55381
22 Ga0081539_10007212 3300005985 Bacteria 10230
23 Ga0081539_10116203 3300005985 Bacteria 1337
24 Ga0075365_10042847 3300006038 Bacteria 2961
25 Ga0075428_100125324 3300006844 Bacteria 2795
26 Ga0075430_100235584 3300006846 Bacteria 1517
27 Ga0075433_10041365 3300006852 Bacteria 3993
28 Ga0075429_100495899 3300006880 Bacteria 1070
29 Ga0097620_100057064 3300006931 Bacteria 3933
30 Ga0099794_10078315 3300007265 Unclassified 1627
31 Ga0099795_10195300 3300007788 Bacteria 851
32 Ga0105240_10059157 3300009093 Plasmid 4783
33 Ga0105245_10079357 3300009098 Bacteria 2997
34 Ga0114129_10026694 3300009147 Bacteria 8180
35 Ga0114129_10210965 3300009147 Bacteria 2625
36 Ga0114129_10747660 3300009147 Bacteria 1252
37 Ga0105243_10730463 3300009148 Bacteria 969
38 Ga0105241_10137727 3300009174 Bacteria 1984
39 Ga0105241_10158378 3300009174 Bacteria 1859
40 Ga0105248_10049283 3300009177 Unclassified 4723
41 Ga0105237_10540290 3300009545 Unclassified 1172
42 Ga0105238_10175292 3300009551 Bacteria 2121
43 Ga0099796_10045998 3300010159 Unclassified 1497
44 Ga0105239_10064658 3300010375 Bacteria 4016
45 Ga0157374_10106915 3300013296 Bacteria 2688
46 Ga0157378_10322647 3300013297 Bacteria 1501
47 Ga0157372_10677352 3300013307 Bacteria 1200
48 Ga0163163_10267399 3300014325 Bacteria 1761
49 Ga0157376_10266829 3300014969 Unclassified 1606
50 Ga0213873_10000409 3300021358 Bacteria 7016
51 Ga0213873_10037697 3300021358 Unclassified 1232
52 Ga0213874_10004240 3300021377 Bacteria 3249
53 Ga0213876_10000854 3300021384 Bacteria 20513
54 Ga0213876_10055988 3300021384 Bacteria 2082
55 Ga0213876_10132177 3300021384 Bacteria 1327
56 Ga0213876_10172356 3300021384 Bacteria 1151
57 Ga0213875_10035079 3300021388 Bacteria 2368
58 Ga0207643_10166427 3300025908 Bacteria 1328
59 Ga0207705_10177335 3300025909 Bacteria 1607
60 Ga0207654_10131679 3300025911 Bacteria 1584
61 Ga0207695_10000140 3300025913 Bacteria 216271
62 Ga0207695_10049889 3300025913 Plasmid 4406
63 Ga0207694_10045529 3300025924 Bacteria 3389
64 Ga0207687_10110207 3300025927 Bacteria 2041
65 Ga0207644_10286740 3300025931 Bacteria 1323
66 Ga0207691_10208371 3300025940 Bacteria 1699
67 Ga0207711_10172244 3300025941 Unclassified 1964
68 Ga0207679_10173324 3300025945 Bacteria 1778
69 Ga0207708_10273625 3300026075 Bacteria 1366
70 Ga0209588_1013234 3300027671 Bacteria 2516
71 Ga0268266_10015890 3300028379 Bacteria 6442
72 Ga0307408_100005282 3300031548 Bacteria 8654
73 Ga0307409_100008139 3300031995 Bacteria 6335
74 Ga0307409_100120335 3300031995 Bacteria 2222
75 Ga0373950_0000033 3300034818 Bacteria 145634
76 Ga0436364_0460959 3300037853 Bacteria 1663
77 Ga0436364_0975268 3300037853 Bacteria 945
78 Ga0436364_1349988 3300037853 Bacteria 4195
79 Ga0395901_0181126 3300038443 Bacteria 2210
80 Ga0436365_0075977 3300039437 Bacteria 2132
81 Ga0436365_0307047 3300039437 Bacteria 1188
82 Ga0436365_0528037 3300039437 Bacteria 2385
83 Ga0436365_1129336 3300039437 Bacteria 2880
84 Ga0436365_1195610 3300039437 Bacteria 37854
85 Ga0436365_1238037 3300039437 Bacteria 3029
86 Ga0436365_1403212 3300039437 Bacteria 2817
87 Ga0436361_0476821 3300039447 Bacteria 2195
88 Ga0436361_0807354 3300039447 Bacteria 992
89 Ga0436363_0153483 3300039450 Bacteria 968
90 Ga0436363_1239764 3300039450 Bacteria 1327
91 Ga0436363_1505385 3300039450 Bacteria 9873
92 Ga0436363_1678498 3300039450 Bacteria 7504
93 Ga0436362_0397379 3300039453 Bacteria 2935
94 Ga0436362_0485972 3300039453 Bacteria 5363
95 Ga0436362_1024174 3300039453 Bacteria 1855
96 Ga0436362_1211480 3300039453 Bacteria 1324
97 Ga0436362_1304868 3300039453 Unclassified 2027
98 Ga0451577_0767317 3300042876 Bacteria 872
99 Ga0466969_0099209 3300044656 Bacteria 1373
100 Ga0466966_0000489 3300044684 Bacteria 25414
101 Ga0466966_0000977 3300044684 Bacteria 18327
102 Ga0466961_0000121 3300044693 Bacteria 52226
103 Ga0466963_0179836 3300044694 Unclassified 1476
104 Ga0466971_0055316 3300044719 Unclassified 1789
105 Ga0466971_0243297 3300044719 Bacteria 856
106 Ga0466957_0185404 3300044842 Bacteria 1360
107 Ga0466957_0339183 3300044842 Unclassified 1017
108 Ga0466959_0001690 3300045049 Bacteria 13685
109 Ga0466959_0003814 3300045049 Bacteria 9989
110 Ga0466959_0247461 3300045049 Bacteria 1230
111 Ga0466958_0000078 3300045836 Bacteria 29811
112 Ga0466967_0039330 3300045976 Bacteria 4065
113 Ga0495653_0500812 3300046463 Bacteria 757
114 Ga0495606_0016524 3300046507 Bacteria 5621
115 Ga0495616_0000122 3300046513 Bacteria 67299
116 Ga0495654_0003141 3300046530 Bacteria 10250
117 Ga0495654_0004433 3300046530 Bacteria 8327
118 Ga0495668_0001127 3300046616 Bacteria 27533
119 Ga0495668_0010784 3300046616 Bacteria 5514
120 Ga0495668_0014742 3300046616 Bacteria 4577
121 Ga0495668_0023394 3300046616 Bacteria 3524
122 Ga0496102_0228540 3300048905 Bacteria 1754
123 Ga0496114_0261985 3300048917 Bacteria 1522
124 Ga0496121_0260022 3300048924 Bacteria 1199
125 Ga0501031_0005469 3300049568 Bacteria 8265
126 Ga0501036_0108131 3300049572 Bacteria 2351
127 Ga0501038_0037218 3300049574 Bacteria 4267
128 Ga0501039_0000332 3300049575 Bacteria 33774
129 Ga0501040_0001503 3300049576 Bacteria 14797
130 Ga0501041_0003844 3300049577 Bacteria 8646
131 Ga0501042_0001346 3300049578 Bacteria 14370
132 Ga0501042_0001766 3300049578 Bacteria 12929
133 Ga0501043_0025440 3300049579 Bacteria 4645
134 Ga0501046_0005195 3300049580 Bacteria 11655
135 Ga0501048_0006437 3300049582 Bacteria 8926
136 Ga0501070_0073378 3300049586 Bacteria 2831
137 Ga0501071_0009747 3300049587 Bacteria 6408
138 Ga0501072_0000395 3300049588 Bacteria 31213
139 Ga0501074_0005881 3300049590 Bacteria 8845
140 Ga0501075_0048673 3300049591 Bacteria 3186
141 Ga0501076_0000206 3300049592 Bacteria 35473
142 Ga0501076_0378254 3300049592 Bacteria 1164
143 Ga0501077_0453122 3300049593 Bacteria 821
144 Ga0501080_0077699 3300049742 Bacteria 3087
145 Ga0501080_0175358 3300049742 Bacteria 1975
146 Ga0501081_0006282 3300049743 Bacteria 7702
147 Ga0501083_0128070 3300049744 Bacteria 1664
148 Ga0501035_0031208 3300049822 Bacteria 4853
149 Ga0501045_0000454 3300049824 Bacteria 25338
150 nmdc:mga0yw44_21123_c1 3300050492 Bacteria 3626
151 nmdc:mga05p37_818626_c1 3300050507 Bacteria 1016
152 nmdc:mga09592_570306_c1 3300050508 Bacteria 971
153 Ga0500651_0025399 3300053093 Bacteria 3717
154 Ga0500592_000059 3300053116 Bacteria 31069
155 Ga0500592_015637 3300053116 Bacteria 1218
156 Ga0500604_0004314 3300053151 Bacteria 3775
157 Ga0500604_0012272 3300053151 Bacteria 2312
158 Ga0500627_0000871 3300053158 Bacteria 8087
159 Ga0500627_0001468 3300053158 Bacteria 6596
160 Ga0500627_0001874 3300053158 Bacteria 6023
161 Ga0500627_0069475 3300053158 Bacteria 1558
162 Ga0500645_086244 3300053730 Bacteria 893
163 Ga0501084_0032212 3300054114 Bacteria 4384
164 Ga0501084_0246633 3300054114 Bacteria 1508
165 Ga0501082_0056919 3300060353 Bacteria 3368
166 Ga0466962_0020366 3300061719 Bacteria 3186
167 Ga0466962_0063544 3300061719 Unclassified 1762
168 Ga0530510_0017680 3300061734 Bacteria 5052

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300027671 Ga0209588_1013234 Ga0209588_10132342 204
2 3300005937 Ga0081455_10013679 Ga0081455_100136796 216
3 3300038443 Ga0395901_0181126 Ga0395901_0181126_1242_1949 218
4 3300039453 Ga0436362_0485972 Ga0436362_0485972_64_729 218
5 3300039453 Ga0436362_1024174 Ga0436362_1024174_14_679 218
6 3300044842 Ga0466957_0339183 Ga0466957_0339183_345_1007 218
7 3300046463 Ga0495653_0500812 Ga0495653_0500812_18_725 218
8 3300048924 Ga0496121_0260022 Ga0496121_0260022_16_723 218
9 3300053730 Ga0500645_086244 Ga0500645_086244_37_744 218
10 iso_pu_bacteria 8016530956 8016533605 218
11 3300005985 Ga0081539_10116203 Ga0081539_101162032 219
12 3300039437 Ga0436365_1129336 Ga0436365_1129336_792_1523 222
13 3300049586 Ga0501070_0073378 Ga0501070_0073378_946_1713 222
14 3300005937 Ga0081455_10137439 Ga0081455_101374392 225
15 3300039437 Ga0436365_1238037 Ga0436365_1238037_1643_2404 225
16 3300039450 Ga0436363_0153483 Ga0436363_0153483_82_906 225
17 3300006852 Ga0075433_10041365 Ga0075433_100413653 226
18 3300009147 Ga0114129_10747660 Ga0114129_107476602 226
19 3300021388 Ga0213875_10035079 Ga0213875_100350794 226
20 3300050507 nmdc:mga05p37_818626_c1 nmdc:mga05p37_818626_c1_105_866 226
21 3300044719 Ga0466971_0243297 Ga0466971_0243297_54_815 227
22 iso_pu_bacteria 2802429637 2806076189 228
23 3300021384 Ga0213876_10000854 Ga0213876_1000085410 229
24 3300039437 Ga0436365_1195610 Ga0436365_1195610_7160_7921 229
25 3300005327 Ga0070658_10214123 Ga0070658_102141232 231
26 3300025909 Ga0207705_10177335 Ga0207705_101773353 231
27 3300037853 Ga0436364_1349988 Ga0436364_1349988_1181_1942 231
28 3300039450 Ga0436363_1678498 Ga0436363_1678498_2853_3614 231
29 iso_pu_bacteria 2932784394 2932793408 231
30 iso_pu_bacteria 2932818245 2932827783 231
31 iso_pu_bacteria 2932828146 2932836736 231
32 iso_pu_bacteria 2935638405 2935647998 231
33 iso_pu_bacteria 2935665750 2935674901 231
34 iso_pu_bacteria 2935703347 2935712970 231
35 iso_pu_bacteria 2935827899 2935837505 231
36 iso_pu_bacteria 8016511872 8016512792 231
37 iso_pu_bacteria 8016522445 8016528452 231
38 iso_pu_bacteria 8016539877 8016546833 231
39 iso_pu_bacteria 8016548790 8016555285 231
40 iso_pu_bacteria 8016557553 8016563647 231
41 iso_pu_bacteria 8016566248 8016571940 231
42 iso_pu_bacteria 8016575299 8016576149 231
43 iso_pu_bacteria 8016595262 8016601380 231
44 iso_pu_bacteria 8016622563 8016625383 231
45 iso_pu_bacteria 8017057580 8017067302 231
46 iso_pu_bacteria 8019530166 8019533393 231
47 iso_pu_bacteria 8019547302 8019552429 231
48 iso_pu_bacteria 8019576017 8019586476 231
49 iso_pu_bacteria 8019597564 8019607921 231
50 iso_pu_bacteria 8019608314 8019608639 231
51 3300005331 Ga0070670_100341454 Ga0070670_1003414541 232
52 3300005563 Ga0068855_100039009 Ga0068855_1000390094 232
53 3300005564 Ga0070664_100129653 Ga0070664_1001296533 232
54 3300005937 Ga0081455_10066730 Ga0081455_100667303 232
55 3300009147 Ga0114129_10210965 Ga0114129_102109652 232
56 3300021377 Ga0213874_10004240 Ga0213874_100042402 232
57 3300021384 Ga0213876_10055988 Ga0213876_100559882 232
58 3300025908 Ga0207643_10166427 Ga0207643_101664271 232
59 3300025945 Ga0207679_10173324 Ga0207679_101733243 232
60 3300031995 Ga0307409_100120335 Ga0307409_1001203352 232
61 3300039437 Ga0436365_1403212 Ga0436365_1403212_1082_1849 232
62 3300039450 Ga0436363_1505385 Ga0436363_1505385_5894_6661 232
63 3300039453 Ga0436362_0397379 Ga0436362_0397379_2004_2771 232
64 3300042876 Ga0451577_0767317 Ga0451577_0767317_84_842 232
65 3300044842 Ga0466957_0185404 Ga0466957_0185404_174_941 232
66 3300045976 Ga0466967_0039330 Ga0466967_0039330_216_983 232
67 3300046507 Ga0495606_0016524 Ga0495606_0016524_444_1214 232
68 3300048917 Ga0496114_0261985 Ga0496114_0261985_162_929 232
69 3300049592 Ga0501076_0378254 Ga0501076_0378254_192_950 232
70 3300003203 JGI25406J46586_10007630 JGI25406J46586_100076306 233
71 3300003203 JGI25406J46586_10036573 JGI25406J46586_100365732 233
72 3300005355 Ga0070671_100141972 Ga0070671_1001419722 233
73 3300005445 Ga0070708_100637147 Ga0070708_1006371471 233
74 3300005455 Ga0070663_100311499 Ga0070663_1003114991 233
75 3300005471 Ga0070698_100004314 Ga0070698_10000431412 233
76 3300005471 Ga0070698_100026855 Ga0070698_1000268553 233
77 3300005518 Ga0070699_100116615 Ga0070699_1001166154 233
78 3300005548 Ga0070665_100029401 Ga0070665_1000294011 233
79 3300005548 Ga0070665_100215453 Ga0070665_1002154532 233
80 3300005563 Ga0068855_100018501 Ga0068855_1000185016 233
81 3300005617 Ga0068859_100057063 Ga0068859_1000570633 233
82 3300005937 Ga0081455_10233771 Ga0081455_102337712 233
83 3300005985 Ga0081539_10000921 Ga0081539_100009216 233
84 3300005985 Ga0081539_10007212 Ga0081539_100072126 233
85 3300006038 Ga0075365_10042847 Ga0075365_100428473 233
86 3300006844 Ga0075428_100125324 Ga0075428_1001253241 233
87 3300006846 Ga0075430_100235584 Ga0075430_1002355841 233
88 3300006880 Ga0075429_100495899 Ga0075429_1004958991 233
89 3300006931 Ga0097620_100057064 Ga0097620_1000570643 233
90 3300007265 Ga0099794_10078315 Ga0099794_100783152 233
91 3300007788 Ga0099795_10195300 Ga0099795_101953001 233
92 3300009093 Ga0105240_10059157 Ga0105240_100591573 233
93 3300009098 Ga0105245_10079357 Ga0105245_100793572 233
94 3300009147 Ga0114129_10026694 Ga0114129_100266946 233
95 3300009148 Ga0105243_10730463 Ga0105243_107304631 233
96 3300009174 Ga0105241_10137727 Ga0105241_101377272 233
97 3300009174 Ga0105241_10158378 Ga0105241_101583781 233
98 3300009177 Ga0105248_10049283 Ga0105248_100492831 233
99 3300009545 Ga0105237_10540290 Ga0105237_105402901 233
100 3300009551 Ga0105238_10175292 Ga0105238_101752921 233
101 3300010159 Ga0099796_10045998 Ga0099796_100459981 233
102 3300010375 Ga0105239_10064658 Ga0105239_100646582 233
103 3300013296 Ga0157374_10106915 Ga0157374_101069151 233
104 3300013297 Ga0157378_10322647 Ga0157378_103226472 233
105 3300013307 Ga0157372_10677352 Ga0157372_106773521 233
106 3300014325 Ga0163163_10267399 Ga0163163_102673992 233
107 3300014969 Ga0157376_10266829 Ga0157376_102668291 233
108 3300021358 Ga0213873_10000409 Ga0213873_1000040911 233
109 3300021358 Ga0213873_10037697 Ga0213873_100376972 233
110 3300021384 Ga0213876_10132177 Ga0213876_101321772 233
111 3300021384 Ga0213876_10172356 Ga0213876_101723562 233
112 3300025911 Ga0207654_10131679 Ga0207654_101316791 233
113 3300025913 Ga0207695_10000140 Ga0207695_10000140178 233
114 3300025913 Ga0207695_10049889 Ga0207695_100498893 233
115 3300025924 Ga0207694_10045529 Ga0207694_100455292 233
116 3300025927 Ga0207687_10110207 Ga0207687_101102071 233
117 3300025931 Ga0207644_10286740 Ga0207644_102867401 233
118 3300025940 Ga0207691_10208371 Ga0207691_102083713 233
119 3300025941 Ga0207711_10172244 Ga0207711_101722441 233
120 3300026075 Ga0207708_10273625 Ga0207708_102736251 233
121 3300028379 Ga0268266_10015890 Ga0268266_100158907 233
122 3300031548 Ga0307408_100005282 Ga0307408_1000052829 233
123 3300031995 Ga0307409_100008139 Ga0307409_1000081394 233
124 3300034818 Ga0373950_0000033 Ga0373950_0000033_25144_25908 233
125 3300037853 Ga0436364_0460959 Ga0436364_0460959_266_1027 233
126 3300037853 Ga0436364_0975268 Ga0436364_0975268_137_928 233
127 3300039437 Ga0436365_0075977 Ga0436365_0075977_1006_1767 233
128 3300039437 Ga0436365_0307047 Ga0436365_0307047_114_878 233
129 3300039437 Ga0436365_0528037 Ga0436365_0528037_1422_2183 233
130 3300039447 Ga0436361_0476821 Ga0436361_0476821_818_1582 233
131 3300039447 Ga0436361_0807354 Ga0436361_0807354_162_932 233
132 3300039450 Ga0436363_1239764 Ga0436363_1239764_523_1284 233
133 3300039453 Ga0436362_1211480 Ga0436362_1211480_94_855 233
134 3300039453 Ga0436362_1304868 Ga0436362_1304868_797_1561 233
135 3300044656 Ga0466969_0099209 Ga0466969_0099209_144_908 233
136 3300044684 Ga0466966_0000489 Ga0466966_0000489_24301_25065 233
137 3300044684 Ga0466966_0000977 Ga0466966_0000977_754_1518 233
138 3300044693 Ga0466961_0000121 Ga0466961_0000121_30997_31761 233
139 3300044693 Ga0466961_0000121 Ga0466961_0000121_6683_7447 233
140 3300044694 Ga0466963_0179836 Ga0466963_0179836_669_1433 233
141 3300044719 Ga0466971_0055316 Ga0466971_0055316_798_1562 233
142 3300045049 Ga0466959_0001690 Ga0466959_0001690_6698_7462 233
143 3300045049 Ga0466959_0003814 Ga0466959_0003814_5691_6455 233
144 3300045049 Ga0466959_0247461 Ga0466959_0247461_375_1139 233
145 3300045836 Ga0466958_0000078 Ga0466958_0000078_25056_25820 233
146 3300045836 Ga0466958_0000078 Ga0466958_0000078_742_1506 233
147 3300046513 Ga0495616_0000122 Ga0495616_0000122_50866_51645 233
148 3300046530 Ga0495654_0003141 Ga0495654_0003141_3663_4439 233
149 3300046530 Ga0495654_0004433 Ga0495654_0004433_5031_5810 233
150 3300046616 Ga0495668_0001127 Ga0495668_0001127_19358_20134 233
151 3300046616 Ga0495668_0010784 Ga0495668_0010784_3115_3894 233
152 3300046616 Ga0495668_0014742 Ga0495668_0014742_324_1184 233
153 3300046616 Ga0495668_0023394 Ga0495668_0023394_1077_1856 233
154 3300048905 Ga0496102_0228540 Ga0496102_0228540_696_1484 233
155 3300049568 Ga0501031_0005469 Ga0501031_0005469_6847_7608 233
156 3300049572 Ga0501036_0108131 Ga0501036_0108131_166_927 233
157 3300049574 Ga0501038_0037218 Ga0501038_0037218_532_1293 233
158 3300049575 Ga0501039_0000332 Ga0501039_0000332_23736_24497 233
159 3300049576 Ga0501040_0001503 Ga0501040_0001503_1231_1992 233
160 3300049577 Ga0501041_0003844 Ga0501041_0003844_1376_2137 233
161 3300049578 Ga0501042_0001346 Ga0501042_0001346_10373_11134 233
162 3300049578 Ga0501042_0001766 Ga0501042_0001766_5164_5925 233
163 3300049579 Ga0501043_0025440 Ga0501043_0025440_959_1720 233
164 3300049580 Ga0501046_0005195 Ga0501046_0005195_6949_7710 233
165 3300049582 Ga0501048_0006437 Ga0501048_0006437_1608_2369 233
166 3300049587 Ga0501071_0009747 Ga0501071_0009747_41_802 233
167 3300049588 Ga0501072_0000395 Ga0501072_0000395_27291_28052 233
168 3300049590 Ga0501074_0005881 Ga0501074_0005881_6758_7519 233
169 3300049591 Ga0501075_0048673 Ga0501075_0048673_967_1728 233
170 3300049592 Ga0501076_0000206 Ga0501076_0000206_9394_10155 233
171 3300049593 Ga0501077_0453122 Ga0501077_0453122_41_802 233
172 3300049742 Ga0501080_0077699 Ga0501080_0077699_1155_1916 233
173 3300049742 Ga0501080_0175358 Ga0501080_0175358_377_1141 233
174 3300049743 Ga0501081_0006282 Ga0501081_0006282_535_1296 233
175 3300049744 Ga0501083_0128070 Ga0501083_0128070_55_816 233
176 3300049822 Ga0501035_0031208 Ga0501035_0031208_1982_2743 233
177 3300049824 Ga0501045_0000454 Ga0501045_0000454_1207_1968 233
178 3300050492 nmdc:mga0yw44_21123_c1 nmdc:mga0yw44_21123_c1_1864_2625 233
179 3300050508 nmdc:mga09592_570306_c1 nmdc:mga09592_570306_c1_122_883 233
180 3300053093 Ga0500651_0025399 Ga0500651_0025399_584_1345 233
181 3300053116 Ga0500592_000059 Ga0500592_000059_29454_30233 233
182 3300053116 Ga0500592_015637 Ga0500592_015637_292_1071 233
183 3300053151 Ga0500604_0004314 Ga0500604_0004314_366_1145 233
184 3300053151 Ga0500604_0012272 Ga0500604_0012272_1006_1785 233
185 3300053158 Ga0500627_0000871 Ga0500627_0000871_3690_4466 233
186 3300053158 Ga0500627_0001468 Ga0500627_0001468_3356_4135 233
187 3300053158 Ga0500627_0001874 Ga0500627_0001874_4607_5386 233
188 3300053158 Ga0500627_0069475 Ga0500627_0069475_388_1185 233
189 3300054114 Ga0501084_0032212 Ga0501084_0032212_3092_3853 233
190 3300054114 Ga0501084_0246633 Ga0501084_0246633_243_1004 233
191 3300060353 Ga0501082_0056919 Ga0501082_0056919_1489_2250 233
192 3300061719 Ga0466962_0020366 Ga0466962_0020366_124_888 233
193 3300061719 Ga0466962_0063544 Ga0466962_0063544_613_1377 233
194 3300061734 Ga0530510_0017680 Ga0530510_0017680_532_1293 233

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

36

228

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

42

284

0.92

PF08659

KR

KR domain

36

201

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
7djs-assembly1.cif.gz_D crystal structure of isopiperitenol dehydrogenase from pseudomonas aeruginosa complexed with nad 0.9623 10 232
4nbv-assembly1.cif.gz_A crystal structure of fabg from cupriavidus taiwanensis 0.9588 10 228
1yde-assembly4.cif.gz_N crystal structure of human retinal short-chain dehydrogenase/reductase 3 0.9556 41 230
3s55-assembly2.cif.gz_H crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to nad 0.954 22 231
3s55-assembly2.cif.gz_G crystal structure of a putative short-chain dehydrogenase/reductase from mycobacterium abscessus bound to nad 0.9537 21 231
ID Description Score Start End Superfamily
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9589 63 229 3.40.50.720
af_Q2FVE2_1_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9527 44 232 3.40.50.720
5h5xG00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9398 2 232 3.40.50.720
4iinB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9393 8 229 3.40.50.720
4weoA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9382 8 229 3.40.50.720
ID Description Score Start End GO Terms
AF-B7BHE1-F1-model_v4 Oxidoreductase, short chain dehydrogenase/reductase family protein 0.9932 39 232
AF-A0A150TW08-F1-model_v4 Short-chain dehydrogenase 0.9902 21 232 GO:0016491
AF-A0A2D6MRT4-F1-model_v4 Short-chain dehydrogenase 0.9888 35 232 GO:0016491
AF-A0A839YPI3-F1-model_v4 NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family) 0.9882 24 232
AF-A0A0F5IU74-F1-model_v4 Oxidoreductase 0.9861 25 232

Feature Viewer

pLDDT pTM Quality
92.28 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map