F297816

General Info

Members Datasets Scaffolds Average Seq Length
193 164 386 115

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_1594608_c1|nmdc:mga06r32_1594608_c1_92_472
Length 126
Sequence VFLRAIDGARHEGTMRLSFRDALAQIPGPKGERFAEVFKHGTLSVEIYAPKGTDPQQPHSRDEVYIVVAGSGDFVCADQRETFGVGDFLFAPARAIHRFENFTNDLVVWVLFYGPEGGEASPTRAI

Samples

Sample ID Description Type Environment
1 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
94 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
95 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
115 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
116 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
117 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
118 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
119 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
120 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
121 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
127 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
128 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
136 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
137 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
138 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
139 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
140 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
141 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
142 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
154 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
155 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
156 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
157 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
158 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
159 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
160 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
161 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
162 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
163 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
164 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 4.15
Rhizosphere 94.3
Stem 0
Stem Tuber 0
Unclassified 23.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga06r32_1594608_c1 3300050510 Unclassified 591
2 Ga0065715_10845823 3300005293 Bacteria 581
3 Ga0070683_102215450 3300005329 Unclassified 527
4 Ga0070690_100329216 3300005330 Unclassified 1103
5 Ga0070690_100944538 3300005330 Unclassified 677
6 Ga0070670_100078437 3300005331 Bacteria 2837
7 Ga0070677_10003352 3300005333 Bacteria 5163
8 Ga0068869_100137672 3300005334 Bacteria 1882
9 Ga0070666_10308875 3300005335 Bacteria 1127
10 Ga0070660_100201551 3300005339 Bacteria 1614
11 Ga0070689_100282633 3300005340 Bacteria 1377
12 Ga0070689_101329802 3300005340 Unclassified 648
13 Ga0070692_10290598 3300005345 Bacteria 994
14 Ga0070668_100194057 3300005347 Bacteria 1664
15 Ga0070675_100038217 3300005354 Bacteria 3911
16 Ga0070659_100601385 3300005366 Bacteria 945
17 Ga0070667_100050004 3300005367 Bacteria 3521
18 Ga0070705_100470538 3300005440 Bacteria 947
19 Ga0070705_100849293 3300005440 Bacteria 730
20 Ga0070700_100828673 3300005441 Unclassified 747
21 Ga0070708_100722618 3300005445 Unclassified 937
22 Ga0070678_100005165 3300005456 Bacteria 7502
23 Ga0070662_100018944 3300005457 Bacteria 4664
24 Ga0068867_100023253 3300005459 Bacteria 4437
25 Ga0070707_100974086 3300005468 Bacteria 813
26 Ga0070707_101299195 3300005468 Unclassified 694
27 Ga0070679_100659164 3300005530 Bacteria 989
28 Ga0068853_100100723 3300005539 Bacteria 2554
29 Ga0070672_100002741 3300005543 Bacteria 11281
30 Ga0070686_100214003 3300005544 Bacteria 1389
31 Ga0070665_100094160 3300005548 Bacteria 3000
32 Ga0070704_101191784 3300005549 Unclassified 694
33 Ga0068855_100000506 3300005563 Bacteria 48223
34 Ga0068855_100670997 3300005563 Bacteria 1112
35 Ga0070664_100085736 3300005564 Bacteria 2721
36 Ga0068857_100171207 3300005577 Bacteria 1974
37 Ga0068857_100554567 3300005577 Unclassified 1083
38 Ga0070702_100304470 3300005615 Bacteria 1104
39 Ga0068852_100931998 3300005616 Bacteria 886
40 Ga0068859_100082397 3300005617 Bacteria 3260
41 Ga0068859_100352657 3300005617 Unclassified 1566
42 Ga0068864_100071755 3300005618 Bacteria 3017
43 Ga0068861_100927046 3300005719 Unclassified 827
44 Ga0068870_10014705 3300005840 Bacteria 3702
45 Ga0068870_10608424 3300005840 Unclassified 743
46 Ga0068858_100269125 3300005842 Bacteria 1621
47 Ga0068860_100343522 3300005843 Bacteria 1468
48 Ga0068862_100382894 3300005844 Bacteria 1312
49 Ga0068862_100414221 3300005844 Unclassified 1263
50 Ga0081455_10350617 3300005937 Bacteria 1041
51 Ga0068871_101283041 3300006358 Unclassified 688
52 Ga0068871_101946400 3300006358 Unclassified 559
53 Ga0075434_100016067 3300006871 Bacteria 7192
54 Ga0075434_101340508 3300006871 Bacteria 726
55 Ga0068865_100072182 3300006881 Bacteria 2451
56 Ga0097620_100082394 3300006931 Bacteria 3260
57 Ga0097620_100352677 3300006931 Unclassified 1566
58 Ga0105240_10149999 3300009093 Bacteria 2778
59 Ga0111539_10194978 3300009094 Bacteria 2363
60 Ga0111539_10197958 3300009094 Bacteria 2344
61 Ga0114129_10545396 3300009147 Bacteria 1509
62 Ga0105242_10101585 3300009176 Bacteria 2437
63 Ga0105242_10111895 3300009176 Unclassified 2329
64 Ga0105239_10031463 3300010375 Bacteria 5835
65 Ga0157370_10414350 3300013104 Unclassified 1240
66 Ga0157378_11493185 3300013297 Unclassified 720
67 Ga0163162_10224245 3300013306 Bacteria 2009
68 Ga0163162_12405295 3300013306 Unclassified 606
69 Ga0157372_10103313 3300013307 Bacteria 3256
70 Ga0157372_10659120 3300013307 Unclassified 1219
71 Ga0157375_10122836 3300013308 Bacteria 2708
72 Ga0163163_10015374 3300014325 Bacteria 7074
73 Ga0157380_10116855 3300014326 Bacteria 2252
74 Ga0182008_10338800 3300014497 Bacteria 795
75 Ga0163161_10043115 3300017792 Bacteria 3248
76 Ga0163161_10169332 3300017792 Bacteria 1669
77 Ga0209257_1052364 3300025304 Bacteria 1146
78 Ga0207697_10066075 3300025315 Unclassified 1510
79 Ga0207682_10001139 3300025893 Bacteria 12314
80 Ga0207682_10392013 3300025893 Unclassified 656
81 Ga0207645_10018624 3300025907 Bacteria 4562
82 Ga0207643_10002572 3300025908 Bacteria 9825
83 Ga0207695_10050484 3300025913 Bacteria 4375
84 Ga0207657_10047934 3300025919 Bacteria 3732
85 Ga0207681_10390202 3300025923 Bacteria 1122
86 Ga0207681_10395235 3300025923 Bacteria 1115
87 Ga0207650_10138814 3300025925 Bacteria 1909
88 Ga0207659_10032739 3300025926 Bacteria 3571
89 Ga0207706_10015264 3300025933 Bacteria 6947
90 Ga0207686_10038448 3300025934 Unclassified 2895
91 Ga0207670_11192328 3300025936 Unclassified 644
92 Ga0207670_11759455 3300025936 Unclassified 527
93 Ga0207704_10072328 3300025938 Bacteria 2191
94 Ga0207691_10006267 3300025940 Bacteria 11483
95 Ga0207689_10057560 3300025942 Bacteria 3198
96 Ga0207661_11843641 3300025944 Unclassified 550
97 Ga0207679_10350338 3300025945 Bacteria 1287
98 Ga0207667_10001511 3300025949 Bacteria 29216
99 Ga0207651_10179610 3300025960 Bacteria 1678
100 Ga0207668_10116146 3300025972 Bacteria 2017
101 Ga0207703_10138351 3300026035 Bacteria 2111
102 Ga0207678_10209001 3300026067 Bacteria 1669
103 Ga0207708_10172334 3300026075 Bacteria 1714
104 Ga0207708_10877300 3300026075 Unclassified 776
105 Ga0207648_10008484 3300026089 Bacteria 9943
106 Ga0207648_12087635 3300026089 Bacteria 528
107 Ga0207676_10020487 3300026095 Bacteria 4840
108 Ga0207674_10041406 3300026116 Bacteria 4765
109 Ga0207675_100024644 3300026118 Bacteria 5594
110 Ga0207683_10008671 3300026121 Bacteria 8693
111 Ga0209974_10038265 3300027876 Bacteria 1594
112 Ga0207428_10106668 3300027907 Bacteria 2159
113 Ga0268265_10254571 3300028380 Bacteria 1557
114 Ga0268264_11391466 3300028381 Unclassified 712
115 Ga0265337_1028298 3300028556 Bacteria 1683
116 Ga0265332_10030376 3300031238 Unclassified 2360
117 Ga0265320_10133114 3300031240 Bacteria 1129
118 Ga0265339_10009901 3300031249 Bacteria 5952
119 Ga0265316_10012616 3300031344 Bacteria 7565
120 Ga0265313_10300238 3300031595 Bacteria 645
121 Ga0265314_10001318 3300031711 Bacteria 28124
122 Ga0307405_10183641 3300031731 Bacteria 1504
123 Ga0307407_10976338 3300031903 Bacteria 653
124 Ga0307412_10754665 3300031911 Bacteria 840
125 Ga0307409_100523597 3300031995 Bacteria 1159
126 Ga0307409_100959470 3300031995 Bacteria 871
127 Ga0307416_101406217 3300032002 Bacteria 803
128 Ga0307414_10520217 3300032004 Bacteria 1056
129 Ga0307414_10848876 3300032004 Bacteria 835
130 Ga0307411_10048527 3300032005 Bacteria 2752
131 Ga0307415_100703170 3300032126 Bacteria 912
132 Ga0373952_0085396 3300035092 Bacteria 812
133 Ga0373931_0231747 3300035691 Bacteria 1116
134 Ga0395900_1825984 3300037418 Bacteria 518
135 Ga0395905_0001158 3300037471 Bacteria 32992
136 Ga0395901_0041402 3300038443 Bacteria 4774
137 Ga0436363_0928267 3300039450 Unclassified 624
138 Ga0439449_0223724 3300042007 Bacteria 706
139 Ga0439435_0037333 3300042436 Unclassified 1346
140 Ga0439460_0270339 3300042461 Unclassified 590
141 Ga0451577_0307362 3300042876 Bacteria 1437
142 Ga0453683_0792792 3300044673 Unclassified 623
143 Ga0466966_0219574 3300044684 Bacteria 1148
144 Ga0453684_0184566 3300044712 Bacteria 2446
145 Ga0453684_0517678 3300044712 Unclassified 1318
146 Ga0451576_1608587 3300045051 Unclassified 674
147 Ga0466958_0078655 3300045836 Bacteria 2027
148 Ga0466967_1301958 3300045976 Unclassified 724
149 Ga0495592_0000127 3300046454 Bacteria 67688
150 Ga0495653_0533433 3300046463 Bacteria 728
151 Ga0495662_0116301 3300046476 Bacteria 1311
152 Ga0495618_0002211 3300046514 Bacteria 12701
153 Ga0495630_0005795 3300046517 Bacteria 8729
154 Ga0495666_0245046 3300046526 Bacteria 817
155 Ga0495652_0037384 3300046529 Bacteria 4212
156 Ga0495640_0008499 3300046533 Bacteria 8049
157 Ga0495586_0000319 3300046535 Bacteria 30458
158 Ga0495621_0267421 3300046539 Unclassified 702
159 Ga0495667_0126116 3300046559 Bacteria 1652
160 Ga0495599_0005573 3300046678 Bacteria 7555
161 Ga0495658_0229828 3300046683 Bacteria 1163
162 Ga0495624_0242940 3300046690 Bacteria 1089
163 Ga0495581_0334989 3300047315 Bacteria 883
164 Ga0495674_0018052 3300047319 Bacteria 6568
165 Ga0495675_0471285 3300047444 Bacteria 724
166 Ga0495686_0012938 3300047472 Bacteria 5819
167 Ga0496100_1333440 3300048903 Unclassified 566
168 Ga0496104_1560067 3300048907 Bacteria 563
169 Ga0496105_0075698 3300048908 Unclassified 2780
170 Ga0496106_0315519 3300048909 Bacteria 1254
171 Ga0496107_0051778 3300048910 Bacteria 2962
172 Ga0496109_0584765 3300048912 Bacteria 1052
173 Ga0496112_0014441 3300048915 Bacteria 7328
174 Ga0496114_0987468 3300048917 Bacteria 725
175 Ga0501034_0983424 3300049571 Unclassified 728
176 Ga0501072_1007228 3300049588 Unclassified 649
177 Ga0501223_116979 3300049663 Bacteria 561
178 Ga0501242_030773 3300049674 Bacteria 726
179 Ga0501249_116754 3300049679 Bacteria 649
180 Ga0501249_159168 3300049679 Unclassified 573
181 Ga0501081_1240346 3300049743 Unclassified 565
182 Ga0501270_149580 3300049767 Bacteria 531
183 nmdc:mga0k408_668044_c1 3300050493 Unclassified 610
184 nmdc:mga05p37_594103_c1 3300050507 Bacteria 1251
185 nmdc:mga0qj67_134381_c1 3300050509 Bacteria 2004
186 nmdc:mga06r32_515729_c1 3300050510 Bacteria 1171
187 nmdc:mga08y16_1070749_c1 3300050511 Bacteria 783
188 nmdc:mga08y16_933378_c1 3300050511 Bacteria 852
189 nmdc:mga0n895_108860_c1 3300050512 Bacteria 2786
190 nmdc:mga0n895_544735_c1 3300050512 Bacteria 1166
191 Ga0495601_0257612 3300053077 Bacteria 1139
192 Ga0501082_0660710 3300060353 Bacteria 915
193 2572255533 2571042365 Bacteria 3289345
194 nmdc:mga06r32_1594608_c1
195 Ga0065715_10845823
196 Ga0070683_102215450
197 Ga0070690_100329216
198 Ga0070690_100944538
199 Ga0070670_100078437
200 Ga0070677_10003352
201 Ga0068869_100137672
202 Ga0070666_10308875
203 Ga0070660_100201551
204 Ga0070689_100282633
205 Ga0070689_101329802
206 Ga0070692_10290598
207 Ga0070668_100194057
208 Ga0070675_100038217
209 Ga0070659_100601385
210 Ga0070667_100050004
211 Ga0070705_100470538
212 Ga0070705_100849293
213 Ga0070700_100828673
214 Ga0070708_100722618
215 Ga0070678_100005165
216 Ga0070662_100018944
217 Ga0068867_100023253
218 Ga0070707_100974086
219 Ga0070707_101299195
220 Ga0070679_100659164
221 Ga0068853_100100723
222 Ga0070672_100002741
223 Ga0070686_100214003
224 Ga0070665_100094160
225 Ga0070704_101191784
226 Ga0068855_100000506
227 Ga0068855_100670997
228 Ga0070664_100085736
229 Ga0068857_100171207
230 Ga0068857_100554567
231 Ga0070702_100304470
232 Ga0068852_100931998
233 Ga0068859_100082397
234 Ga0068859_100352657
235 Ga0068864_100071755
236 Ga0068861_100927046
237 Ga0068870_10014705
238 Ga0068870_10608424
239 Ga0068858_100269125
240 Ga0068860_100343522
241 Ga0068862_100382894
242 Ga0068862_100414221
243 Ga0081455_10350617
244 Ga0068871_101283041
245 Ga0068871_101946400
246 Ga0075434_100016067
247 Ga0075434_101340508
248 Ga0068865_100072182
249 Ga0097620_100082394
250 Ga0097620_100352677
251 Ga0105240_10149999
252 Ga0111539_10194978
253 Ga0111539_10197958
254 Ga0114129_10545396
255 Ga0105242_10101585
256 Ga0105242_10111895
257 Ga0105239_10031463
258 Ga0157370_10414350
259 Ga0157378_11493185
260 Ga0163162_10224245
261 Ga0163162_12405295
262 Ga0157372_10103313
263 Ga0157372_10659120
264 Ga0157375_10122836
265 Ga0163163_10015374
266 Ga0157380_10116855
267 Ga0182008_10338800
268 Ga0163161_10043115
269 Ga0163161_10169332
270 Ga0209257_1052364
271 Ga0207697_10066075
272 Ga0207682_10001139
273 Ga0207682_10392013
274 Ga0207645_10018624
275 Ga0207643_10002572
276 Ga0207695_10050484
277 Ga0207657_10047934
278 Ga0207681_10390202
279 Ga0207681_10395235
280 Ga0207650_10138814
281 Ga0207659_10032739
282 Ga0207706_10015264
283 Ga0207686_10038448
284 Ga0207670_11192328
285 Ga0207670_11759455
286 Ga0207704_10072328
287 Ga0207691_10006267
288 Ga0207689_10057560
289 Ga0207661_11843641
290 Ga0207679_10350338
291 Ga0207667_10001511
292 Ga0207651_10179610
293 Ga0207668_10116146
294 Ga0207703_10138351
295 Ga0207678_10209001
296 Ga0207708_10172334
297 Ga0207708_10877300
298 Ga0207648_10008484
299 Ga0207648_12087635
300 Ga0207676_10020487
301 Ga0207674_10041406
302 Ga0207675_100024644
303 Ga0207683_10008671
304 Ga0209974_10038265
305 Ga0207428_10106668
306 Ga0268265_10254571
307 Ga0268264_11391466
308 Ga0265337_1028298
309 Ga0265332_10030376
310 Ga0265320_10133114
311 Ga0265339_10009901
312 Ga0265316_10012616
313 Ga0265313_10300238
314 Ga0265314_10001318
315 Ga0307405_10183641
316 Ga0307407_10976338
317 Ga0307412_10754665
318 Ga0307409_100523597
319 Ga0307409_100959470
320 Ga0307416_101406217
321 Ga0307414_10520217
322 Ga0307414_10848876
323 Ga0307411_10048527
324 Ga0307415_100703170
325 Ga0373952_0085396
326 Ga0373931_0231747
327 Ga0395900_1825984
328 Ga0395905_0001158
329 Ga0395901_0041402
330 Ga0436363_0928267
331 Ga0439449_0223724
332 Ga0439435_0037333
333 Ga0439460_0270339
334 Ga0451577_0307362
335 Ga0453683_0792792
336 Ga0466966_0219574
337 Ga0453684_0184566
338 Ga0453684_0517678
339 Ga0451576_1608587
340 Ga0466958_0078655
341 Ga0466967_1301958
342 Ga0495592_0000127
343 Ga0495653_0533433
344 Ga0495662_0116301
345 Ga0495618_0002211
346 Ga0495630_0005795
347 Ga0495666_0245046
348 Ga0495652_0037384
349 Ga0495640_0008499
350 Ga0495586_0000319
351 Ga0495621_0267421
352 Ga0495667_0126116
353 Ga0495599_0005573
354 Ga0495658_0229828
355 Ga0495624_0242940
356 Ga0495581_0334989
357 Ga0495674_0018052
358 Ga0495675_0471285
359 Ga0495686_0012938
360 Ga0496100_1333440
361 Ga0496104_1560067
362 Ga0496105_0075698
363 Ga0496106_0315519
364 Ga0496107_0051778
365 Ga0496109_0584765
366 Ga0496112_0014441
367 Ga0496114_0987468
368 Ga0501034_0983424
369 Ga0501072_1007228
370 Ga0501223_116979
371 Ga0501242_030773
372 Ga0501249_116754
373 Ga0501249_159168
374 Ga0501081_1240346
375 Ga0501270_149580
376 nmdc:mga0k408_668044_c1
377 nmdc:mga05p37_594103_c1
378 nmdc:mga0qj67_134381_c1
379 nmdc:mga06r32_515729_c1
380 nmdc:mga08y16_1070749_c1
381 nmdc:mga08y16_933378_c1
382 nmdc:mga0n895_108860_c1
383 nmdc:mga0n895_544735_c1
384 Ga0495601_0257612
385 Ga0501082_0660710
386 2572255533

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

44

113

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5u9e-assembly1.cif.gz_B structure of the regulatory domain of the arac family transcriptional activator rhar 0.8852 48 103
5u93-assembly1.cif.gz_A structure of the regulatory domain of the arac family transcriptional activator rhar 0.8733 32 103
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.8585 24 105
5fpz-assembly1.cif.gz_A-2 the structure of kdgf from yersinia enterocolitica with malonate bound in the active site. 0.8567 24 105
5fpx-assembly1.cif.gz_A the structure of kdgf from yersinia enterocolitica. 0.8511 24 104
ID Description Score Start End Superfamily
af_P09377_6_85_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8695 30 101 2.60.120.10
af_O06336_46_171_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8578 24 103 2.60.120.10
5fpxA00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8511 24 104 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8492 24 104 2.60.120.10
5wxuF01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8468 33 103 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A7Y4QRH1-F1-model_v4 Cupin domain-containing protein 1.001 35 110
AF-A0A7V9TIN0-F1-model_v4 Cupin domain-containing protein 0.9977 25 109
AF-A0A7C5N0U8-F1-model_v4 Cupin domain-containing protein 0.9948 5 109
AF-A0A6I5R592-F1-model_v4 Cupin domain-containing protein 0.994 5 111
AF-A0A285MXM5-F1-model_v4 Cupin domain-containing protein 0.9924 5 110

Map