F297759
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 193 | 143 | 386 | 261 |
Family's Representative Sequence
| Representative Sequence | 3300049576|Ga0501040_0332109|Ga0501040_0332109_21_899 |
| Length | 292 |
| Sequence | LTYQDVLRYLGGEDEGREPTPVEDTMSHTWDPDRYLAYADERGRPFVDLLARVPAENPRVVVDLGCGPGTLTALLAARWPSADVTGVDSSPEMIEAARAVDGIHWEVGDLRDWARPDPLALREPVDVLVSNATLQWVPEHLELMPGLLDRLQPGGWLAFQVPGNFDEPSHTTRTDLAARAPYAEHVRDARVPASHDPDVYARVLLDLGCEVDAWETTYLHVLTGEDPVFDWVSGTGARPTLQALPDDLRPLFEDEFKKLLREAYPADTAGRVVLPFRRIFVVARKPQGVPVP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 2 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 5 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 13 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 14 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 15 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 16 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 18 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 19 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 23 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 24 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 25 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 26 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 27 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 28 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 29 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 30 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 31 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 34 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 35 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 36 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 37 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 38 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 49 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 50 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 51 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 52 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 53 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 54 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 55 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 56 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 57 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 58 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 59 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 60 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 61 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 62 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 63 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 64 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 65 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 66 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 67 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 68 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 69 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 70 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 71 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 72 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 73 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 74 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 75 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 76 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 77 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 78 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 79 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 80 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 81 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 82 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 83 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 84 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 85 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 86 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 87 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 88 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 89 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 90 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 91 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 92 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 93 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 94 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 95 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 96 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 106 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 107 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 108 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 109 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 113 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 115 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 116 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 117 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 118 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 119 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 121 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 123 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 124 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 125 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 126 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 127 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 128 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 129 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 130 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 131 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 132 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 133 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 134 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 135 | 2738543034 | Rhodococcus sp. OK269 | Isolate | Unclassified |
| 136 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 137 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 138 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 139 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 140 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 141 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 142 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 143 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.75 |
| Metatranscriptomes | 1.04 |
| Isolates | 6.22 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 1.04 |
| Bulb | 0 |
| Endosphere | 1.04 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 89.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501040_0332109 | 3300049576 | Bacteria | 1088 |
| 2 | Ga0070661_100319883 | 3300005344 | Bacteria | 1212 |
| 3 | Ga0070659_100159728 | 3300005366 | Bacteria | 1842 |
| 4 | Ga0070709_10000307 | 3300005434 | Bacteria | 31007 |
| 5 | Ga0070714_100000177 | 3300005435 | Bacteria | 51633 |
| 6 | Ga0070714_100004302 | 3300005435 | Bacteria | 10732 |
| 7 | Ga0070714_100017714 | 3300005435 | Bacteria | 5776 |
| 8 | Ga0070713_100008876 | 3300005436 | Bacteria | 7157 |
| 9 | Ga0070713_100009966 | 3300005436 | Bacteria | 6844 |
| 10 | Ga0070713_100061836 | 3300005436 | Bacteria | 3134 |
| 11 | Ga0070713_100236089 | 3300005436 | Unclassified | 1664 |
| 12 | Ga0070710_10004352 | 3300005437 | Bacteria | 6710 |
| 13 | Ga0070711_100006333 | 3300005439 | Bacteria | 7127 |
| 14 | Ga0070711_100583713 | 3300005439 | Bacteria | 931 |
| 15 | Ga0070706_100017087 | 3300005467 | Bacteria | 6702 |
| 16 | Ga0070698_100000475 | 3300005471 | Bacteria | 42531 |
| 17 | Ga0070679_100052320 | 3300005530 | Bacteria | 4069 |
| 18 | Ga0068855_100793597 | 3300005563 | Bacteria | 1007 |
| 19 | Ga0068857_100465360 | 3300005577 | Bacteria | 1184 |
| 20 | Ga0081538_10108652 | 3300005981 | Bacteria | 1369 |
| 21 | Ga0081540_1002856 | 3300005983 | Bacteria | 13989 |
| 22 | Ga0070717_10014735 | 3300006028 | Bacteria | 6015 |
| 23 | Ga0070717_10017097 | 3300006028 | Bacteria | 5635 |
| 24 | Ga0070717_10027607 | 3300006028 | Bacteria | 4538 |
| 25 | Ga0070717_10237032 | 3300006028 | Bacteria | 1608 |
| 26 | Ga0075365_10148413 | 3300006038 | Bacteria | 1630 |
| 27 | Ga0075363_100043472 | 3300006048 | Bacteria | 2377 |
| 28 | Ga0070715_10069078 | 3300006163 | Bacteria | 1573 |
| 29 | Ga0070716_100002016 | 3300006173 | Bacteria | 9280 |
| 30 | Ga0070712_100033594 | 3300006175 | Bacteria | 3472 |
| 31 | Ga0075428_100048092 | 3300006844 | Bacteria | 4682 |
| 32 | Ga0075428_100281545 | 3300006844 | Bacteria | 1789 |
| 33 | Ga0075430_100002300 | 3300006846 | Bacteria | 15849 |
| 34 | Ga0075430_100195754 | 3300006846 | Bacteria | 1679 |
| 35 | Ga0075431_100009044 | 3300006847 | Bacteria | 9988 |
| 36 | Ga0075431_100097300 | 3300006847 | Bacteria | 3039 |
| 37 | Ga0075431_100133957 | 3300006847 | Bacteria | 2554 |
| 38 | Ga0075433_10022907 | 3300006852 | Bacteria | 5249 |
| 39 | Ga0075434_100462146 | 3300006871 | Bacteria | 1290 |
| 40 | Ga0075429_100005140 | 3300006880 | Bacteria | 11251 |
| 41 | Ga0075429_100060333 | 3300006880 | Bacteria | 3304 |
| 42 | Ga0075435_100095290 | 3300007076 | Bacteria | 2461 |
| 43 | Ga0114129_10021581 | 3300009147 | Bacteria | 9141 |
| 44 | Ga0105248_10530081 | 3300009177 | Bacteria | 1328 |
| 45 | Ga0157369_10118531 | 3300013105 | Bacteria | 2810 |
| 46 | Ga0157369_10427073 | 3300013105 | Bacteria | 1374 |
| 47 | Ga0163161_10453053 | 3300017792 | Bacteria | 1037 |
| 48 | Ga0206356_10717618 | 3300020070 | Bacteria | 1356 |
| 49 | Ga0206353_10595818 | 3300020082 | Bacteria | 1554 |
| 50 | Ga0213875_10000469 | 3300021388 | Bacteria | 34620 |
| 51 | Ga0207692_10000173 | 3300025898 | Bacteria | 20587 |
| 52 | Ga0207699_10001935 | 3300025906 | Bacteria | 9753 |
| 53 | Ga0207684_10008983 | 3300025910 | Bacteria | 8860 |
| 54 | Ga0207693_10010057 | 3300025915 | Bacteria | 7684 |
| 55 | Ga0207663_10027834 | 3300025916 | Bacteria | 3300 |
| 56 | Ga0207663_10200629 | 3300025916 | Bacteria | 1439 |
| 57 | Ga0207700_10000291 | 3300025928 | Bacteria | 29714 |
| 58 | Ga0207700_10004937 | 3300025928 | Bacteria | 7925 |
| 59 | Ga0207700_10043116 | 3300025928 | Bacteria | 3312 |
| 60 | Ga0207700_10064327 | 3300025928 | Bacteria | 2793 |
| 61 | Ga0207700_10095276 | 3300025928 | Bacteria | 2361 |
| 62 | Ga0207664_10000163 | 3300025929 | Bacteria | 53290 |
| 63 | Ga0207664_10001030 | 3300025929 | Bacteria | 18668 |
| 64 | Ga0207664_10005944 | 3300025929 | Bacteria | 8353 |
| 65 | Ga0207664_10103649 | 3300025929 | Bacteria | 2354 |
| 66 | Ga0207664_10109508 | 3300025929 | Bacteria | 2295 |
| 67 | Ga0207665_10002384 | 3300025939 | Bacteria | 12690 |
| 68 | Ga0207677_10066352 | 3300026023 | Bacteria | 2523 |
| 69 | Ga0207678_10576596 | 3300026067 | Bacteria | 985 |
| 70 | Ga0207674_10027856 | 3300026116 | Bacteria | 5969 |
| 71 | Ga0207698_10402063 | 3300026142 | Bacteria | 1309 |
| 72 | Ga0265337_1000015 | 3300028556 | Bacteria | 80871 |
| 73 | Ga0265326_10000453 | 3300028558 | Bacteria | 16127 |
| 74 | Ga0265319_1001068 | 3300028563 | Bacteria | 17089 |
| 75 | Ga0265334_10000278 | 3300028573 | Bacteria | 28820 |
| 76 | Ga0265323_10005723 | 3300028653 | Bacteria | 5268 |
| 77 | Ga0265336_10000833 | 3300028666 | Bacteria | 16072 |
| 78 | Ga0265338_10000767 | 3300028800 | Bacteria | 54778 |
| 79 | Ga0265338_10008616 | 3300028800 | Bacteria | 12336 |
| 80 | Ga0265338_10037090 | 3300028800 | Bacteria | 4647 |
| 81 | Ga0265338_10082568 | 3300028800 | Bacteria | 2690 |
| 82 | Ga0265324_10001791 | 3300029957 | Bacteria | 11726 |
| 83 | Ga0265332_10002335 | 3300031238 | Bacteria | 9677 |
| 84 | Ga0265320_10000498 | 3300031240 | Bacteria | 30619 |
| 85 | Ga0265340_10001538 | 3300031247 | Bacteria | 13244 |
| 86 | Ga0265316_10079070 | 3300031344 | Bacteria | 2523 |
| 87 | Ga0265313_10018523 | 3300031595 | Bacteria | 3905 |
| 88 | Ga0265314_10002535 | 3300031711 | Bacteria | 18582 |
| 89 | Ga0265342_10001186 | 3300031712 | Bacteria | 24747 |
| 90 | Ga0307413_10319310 | 3300031824 | Bacteria | 1186 |
| 91 | Ga0307410_10223733 | 3300031852 | Bacteria | 1449 |
| 92 | Ga0307410_10544649 | 3300031852 | Bacteria | 961 |
| 93 | Ga0307409_100159249 | 3300031995 | Bacteria | 1972 |
| 94 | Ga0307409_100379898 | 3300031995 | Bacteria | 1343 |
| 95 | Ga0316214_1002061 | 3300033545 | Bacteria | 2444 |
| 96 | Ga0373926_0044001 | 3300035083 | Bacteria | 1599 |
| 97 | Ga0373934_0018531 | 3300035086 | Bacteria | 2664 |
| 98 | Ga0373934_0031444 | 3300035086 | Bacteria | 2078 |
| 99 | Ga0373923_0067613 | 3300035111 | Bacteria | 1529 |
| 100 | Ga0373956_0014976 | 3300035119 | Bacteria | 3243 |
| 101 | Ga0373946_0283489 | 3300035171 | Unclassified | 816 |
| 102 | Ga0373955_0019423 | 3300035172 | Bacteria | 3396 |
| 103 | Ga0373924_0043296 | 3300035410 | Bacteria | 1849 |
| 104 | Ga0373935_0003132 | 3300035692 | Bacteria | 9547 |
| 105 | Ga0373933_0194845 | 3300035724 | Bacteria | 1295 |
| 106 | Ga0373947_0000009 | 3300035725 | Bacteria | 172751 |
| 107 | Ga0373937_0160232 | 3300036401 | Bacteria | 2109 |
| 108 | Ga0373937_0206911 | 3300036401 | Bacteria | 1845 |
| 109 | Ga0436364_0841734 | 3300037853 | Bacteria | 2256 |
| 110 | Ga0436364_1327441 | 3300037853 | Bacteria | 2537 |
| 111 | Ga0436364_1518594 | 3300037853 | Bacteria | 37293 |
| 112 | Ga0395901_0351038 | 3300038443 | Bacteria | 1522 |
| 113 | Ga0466972_0071257 | 3300044658 | Bacteria | 1658 |
| 114 | Ga0466972_0152425 | 3300044658 | Bacteria | 1086 |
| 115 | Ga0466965_0028746 | 3300044683 | Bacteria | 2702 |
| 116 | Ga0466961_0029084 | 3300044693 | Bacteria | 3553 |
| 117 | Ga0466961_0177624 | 3300044693 | Bacteria | 1322 |
| 118 | Ga0466964_0072063 | 3300044706 | Bacteria | 1463 |
| 119 | Ga0466971_0006954 | 3300044719 | Bacteria | 4921 |
| 120 | Ga0466970_0077283 | 3300044765 | Bacteria | 1794 |
| 121 | Ga0466957_0009419 | 3300044842 | Bacteria | 5577 |
| 122 | Ga0466960_0085434 | 3300044901 | Bacteria | 1598 |
| 123 | Ga0466959_0219347 | 3300045049 | Bacteria | 1320 |
| 124 | Ga0466967_0141677 | 3300045976 | Bacteria | 2240 |
| 125 | Ga0466967_0173070 | 3300045976 | Bacteria | 2032 |
| 126 | Ga0466967_0427562 | 3300045976 | Bacteria | 1292 |
| 127 | Ga0495592_0132647 | 3300046454 | Bacteria | 1741 |
| 128 | Ga0495651_0007951 | 3300046462 | Bacteria | 8128 |
| 129 | Ga0495651_0211689 | 3300046462 | Bacteria | 1348 |
| 130 | Ga0495608_0013756 | 3300046511 | Bacteria | 5614 |
| 131 | Ga0495630_0166922 | 3300046517 | Bacteria | 1676 |
| 132 | Ga0495652_0038726 | 3300046529 | Bacteria | 4128 |
| 133 | Ga0495587_0123753 | 3300046536 | Bacteria | 1480 |
| 134 | Ga0495667_0026831 | 3300046559 | Bacteria | 3881 |
| 135 | Ga0495657_0033226 | 3300046675 | Bacteria | 3593 |
| 136 | Ga0495623_0046440 | 3300046679 | Bacteria | 2756 |
| 137 | Ga0495623_0193259 | 3300046679 | Bacteria | 1174 |
| 138 | Ga0495604_0032897 | 3300047317 | Bacteria | 4107 |
| 139 | Ga0495604_0067280 | 3300047317 | Bacteria | 2723 |
| 140 | Ga0495674_0800983 | 3300047319 | Bacteria | 733 |
| 141 | Ga0495680_0017370 | 3300047322 | Bacteria | 6146 |
| 142 | Ga0495680_0308643 | 3300047322 | Bacteria | 1109 |
| 143 | Ga0495675_0040323 | 3300047444 | Bacteria | 2975 |
| 144 | Ga0495684_0054208 | 3300047471 | Bacteria | 3059 |
| 145 | Ga0495602_0137749 | 3300048088 | Bacteria | 1936 |
| 146 | Ga0496104_0509396 | 3300048907 | Bacteria | 1115 |
| 147 | Ga0496110_0400368 | 3300048913 | Bacteria | 1251 |
| 148 | Ga0496114_0274778 | 3300048917 | Bacteria | 1485 |
| 149 | Ga0496126_0317089 | 3300048929 | Bacteria | 1282 |
| 150 | Ga0501031_0133441 | 3300049568 | Bacteria | 1622 |
| 151 | Ga0501031_0184783 | 3300049568 | Bacteria | 1361 |
| 152 | Ga0501032_0263624 | 3300049569 | Bacteria | 1117 |
| 153 | Ga0501032_0294747 | 3300049569 | Bacteria | 1049 |
| 154 | Ga0501036_0635960 | 3300049572 | Bacteria | 884 |
| 155 | Ga0501037_0117674 | 3300049573 | Bacteria | 1912 |
| 156 | Ga0501039_0050194 | 3300049575 | Bacteria | 3227 |
| 157 | Ga0501041_0012696 | 3300049577 | Bacteria | 4991 |
| 158 | Ga0501041_0049961 | 3300049577 | Bacteria | 2548 |
| 159 | Ga0501042_0021534 | 3300049578 | Bacteria | 4495 |
| 160 | Ga0501042_0136881 | 3300049578 | Bacteria | 1766 |
| 161 | Ga0501042_0281480 | 3300049578 | Bacteria | 1201 |
| 162 | Ga0501043_0353722 | 3300049579 | Bacteria | 1116 |
| 163 | Ga0501048_0065004 | 3300049582 | Bacteria | 2580 |
| 164 | Ga0501067_0030439 | 3300049583 | Bacteria | 2993 |
| 165 | Ga0501068_0245933 | 3300049584 | Bacteria | 1139 |
| 166 | Ga0501069_0079449 | 3300049585 | Bacteria | 1846 |
| 167 | Ga0501071_0251997 | 3300049587 | Bacteria | 1333 |
| 168 | Ga0501071_0659898 | 3300049587 | Bacteria | 805 |
| 169 | Ga0501076_0045622 | 3300049592 | Bacteria | 3460 |
| 170 | Ga0501035_0431726 | 3300049822 | Bacteria | 1092 |
| 171 | Ga0501045_0049243 | 3300049824 | Bacteria | 3072 |
| 172 | Ga0501045_0479146 | 3300049824 | Bacteria | 925 |
| 173 | nmdc:mga05p37_52418_c1 | 3300050507 | Bacteria | 5017 |
| 174 | nmdc:mga09592_28408_c1 | 3300050508 | Bacteria | 4647 |
| 175 | nmdc:mga09592_49855_c1 | 3300050508 | Bacteria | 3530 |
| 176 | nmdc:mga0qj67_51136_c1 | 3300050509 | Bacteria | 3267 |
| 177 | nmdc:mga06r32_29491_c1 | 3300050510 | Bacteria | 5143 |
| 178 | nmdc:mga06r32_900_c1 | 3300050510 | Bacteria | 3502 |
| 179 | nmdc:mga0n895_457840_c1 | 3300050512 | Bacteria | 1288 |
| 180 | Ga0501082_0376949 | 3300060353 | Bacteria | 1238 |
| 181 | Ga0466962_0020253 | 3300061719 | Bacteria | 3197 |
| 182 | 2644098335 | 2643221617 | Bacteria | 5139111 |
| 183 | 2644118938 | 2643221620 | Bacteria | 5134593 |
| 184 | 2676474017 | 2675903058 | Bacteria | 6822861 |
| 185 | 2739362370 | 2738543034 | Bacteria | 6084756 |
| 186 | 2774394703 | 2773857762 | Bacteria | 5971770 |
| 187 | 2809194453 | 2808606439 | Bacteria | 5952208 |
| 188 | 2812349202 | 2811994878 | Bacteria | 5992952 |
| 189 | 2827628906 | 2827628540 | Bacteria | 6858585 |
| 190 | 2873316651 | 2873314349 | Bacteria | 8512634 |
| 191 | 2891973087 | 2891968417 | Bacteria | 5821697 |
| 192 | 2984577442 | 2984576629 | Bacteria | 4248407 |
| 193 | 2990259602 | 2990256926 | Bacteria | 4252839 |
| 194 | Ga0501040_0332109 | |||
| 195 | Ga0070661_100319883 | |||
| 196 | Ga0070659_100159728 | |||
| 197 | Ga0070709_10000307 | |||
| 198 | Ga0070714_100000177 | |||
| 199 | Ga0070714_100004302 | |||
| 200 | Ga0070714_100017714 | |||
| 201 | Ga0070713_100008876 | |||
| 202 | Ga0070713_100009966 | |||
| 203 | Ga0070713_100061836 | |||
| 204 | Ga0070713_100236089 | |||
| 205 | Ga0070710_10004352 | |||
| 206 | Ga0070711_100006333 | |||
| 207 | Ga0070711_100583713 | |||
| 208 | Ga0070706_100017087 | |||
| 209 | Ga0070698_100000475 | |||
| 210 | Ga0070679_100052320 | |||
| 211 | Ga0068855_100793597 | |||
| 212 | Ga0068857_100465360 | |||
| 213 | Ga0081538_10108652 | |||
| 214 | Ga0081540_1002856 | |||
| 215 | Ga0070717_10014735 | |||
| 216 | Ga0070717_10017097 | |||
| 217 | Ga0070717_10027607 | |||
| 218 | Ga0070717_10237032 | |||
| 219 | Ga0075365_10148413 | |||
| 220 | Ga0075363_100043472 | |||
| 221 | Ga0070715_10069078 | |||
| 222 | Ga0070716_100002016 | |||
| 223 | Ga0070712_100033594 | |||
| 224 | Ga0075428_100048092 | |||
| 225 | Ga0075428_100281545 | |||
| 226 | Ga0075430_100002300 | |||
| 227 | Ga0075430_100195754 | |||
| 228 | Ga0075431_100009044 | |||
| 229 | Ga0075431_100097300 | |||
| 230 | Ga0075431_100133957 | |||
| 231 | Ga0075433_10022907 | |||
| 232 | Ga0075434_100462146 | |||
| 233 | Ga0075429_100005140 | |||
| 234 | Ga0075429_100060333 | |||
| 235 | Ga0075435_100095290 | |||
| 236 | Ga0114129_10021581 | |||
| 237 | Ga0105248_10530081 | |||
| 238 | Ga0157369_10118531 | |||
| 239 | Ga0157369_10427073 | |||
| 240 | Ga0163161_10453053 | |||
| 241 | Ga0206356_10717618 | |||
| 242 | Ga0206353_10595818 | |||
| 243 | Ga0213875_10000469 | |||
| 244 | Ga0207692_10000173 | |||
| 245 | Ga0207699_10001935 | |||
| 246 | Ga0207684_10008983 | |||
| 247 | Ga0207693_10010057 | |||
| 248 | Ga0207663_10027834 | |||
| 249 | Ga0207663_10200629 | |||
| 250 | Ga0207700_10000291 | |||
| 251 | Ga0207700_10004937 | |||
| 252 | Ga0207700_10043116 | |||
| 253 | Ga0207700_10064327 | |||
| 254 | Ga0207700_10095276 | |||
| 255 | Ga0207664_10000163 | |||
| 256 | Ga0207664_10001030 | |||
| 257 | Ga0207664_10005944 | |||
| 258 | Ga0207664_10103649 | |||
| 259 | Ga0207664_10109508 | |||
| 260 | Ga0207665_10002384 | |||
| 261 | Ga0207677_10066352 | |||
| 262 | Ga0207678_10576596 | |||
| 263 | Ga0207674_10027856 | |||
| 264 | Ga0207698_10402063 | |||
| 265 | Ga0265337_1000015 | |||
| 266 | Ga0265326_10000453 | |||
| 267 | Ga0265319_1001068 | |||
| 268 | Ga0265334_10000278 | |||
| 269 | Ga0265323_10005723 | |||
| 270 | Ga0265336_10000833 | |||
| 271 | Ga0265338_10000767 | |||
| 272 | Ga0265338_10008616 | |||
| 273 | Ga0265338_10037090 | |||
| 274 | Ga0265338_10082568 | |||
| 275 | Ga0265324_10001791 | |||
| 276 | Ga0265332_10002335 | |||
| 277 | Ga0265320_10000498 | |||
| 278 | Ga0265340_10001538 | |||
| 279 | Ga0265316_10079070 | |||
| 280 | Ga0265313_10018523 | |||
| 281 | Ga0265314_10002535 | |||
| 282 | Ga0265342_10001186 | |||
| 283 | Ga0307413_10319310 | |||
| 284 | Ga0307410_10223733 | |||
| 285 | Ga0307410_10544649 | |||
| 286 | Ga0307409_100159249 | |||
| 287 | Ga0307409_100379898 | |||
| 288 | Ga0316214_1002061 | |||
| 289 | Ga0373926_0044001 | |||
| 290 | Ga0373934_0018531 | |||
| 291 | Ga0373934_0031444 | |||
| 292 | Ga0373923_0067613 | |||
| 293 | Ga0373956_0014976 | |||
| 294 | Ga0373946_0283489 | |||
| 295 | Ga0373955_0019423 | |||
| 296 | Ga0373924_0043296 | |||
| 297 | Ga0373935_0003132 | |||
| 298 | Ga0373933_0194845 | |||
| 299 | Ga0373947_0000009 | |||
| 300 | Ga0373937_0160232 | |||
| 301 | Ga0373937_0206911 | |||
| 302 | Ga0436364_0841734 | |||
| 303 | Ga0436364_1327441 | |||
| 304 | Ga0436364_1518594 | |||
| 305 | Ga0395901_0351038 | |||
| 306 | Ga0466972_0071257 | |||
| 307 | Ga0466972_0152425 | |||
| 308 | Ga0466965_0028746 | |||
| 309 | Ga0466961_0029084 | |||
| 310 | Ga0466961_0177624 | |||
| 311 | Ga0466964_0072063 | |||
| 312 | Ga0466971_0006954 | |||
| 313 | Ga0466970_0077283 | |||
| 314 | Ga0466957_0009419 | |||
| 315 | Ga0466960_0085434 | |||
| 316 | Ga0466959_0219347 | |||
| 317 | Ga0466967_0141677 | |||
| 318 | Ga0466967_0173070 | |||
| 319 | Ga0466967_0427562 | |||
| 320 | Ga0495592_0132647 | |||
| 321 | Ga0495651_0007951 | |||
| 322 | Ga0495651_0211689 | |||
| 323 | Ga0495608_0013756 | |||
| 324 | Ga0495630_0166922 | |||
| 325 | Ga0495652_0038726 | |||
| 326 | Ga0495587_0123753 | |||
| 327 | Ga0495667_0026831 | |||
| 328 | Ga0495657_0033226 | |||
| 329 | Ga0495623_0046440 | |||
| 330 | Ga0495623_0193259 | |||
| 331 | Ga0495604_0032897 | |||
| 332 | Ga0495604_0067280 | |||
| 333 | Ga0495674_0800983 | |||
| 334 | Ga0495680_0017370 | |||
| 335 | Ga0495680_0308643 | |||
| 336 | Ga0495675_0040323 | |||
| 337 | Ga0495684_0054208 | |||
| 338 | Ga0495602_0137749 | |||
| 339 | Ga0496104_0509396 | |||
| 340 | Ga0496110_0400368 | |||
| 341 | Ga0496114_0274778 | |||
| 342 | Ga0496126_0317089 | |||
| 343 | Ga0501031_0133441 | |||
| 344 | Ga0501031_0184783 | |||
| 345 | Ga0501032_0263624 | |||
| 346 | Ga0501032_0294747 | |||
| 347 | Ga0501036_0635960 | |||
| 348 | Ga0501037_0117674 | |||
| 349 | Ga0501039_0050194 | |||
| 350 | Ga0501041_0012696 | |||
| 351 | Ga0501041_0049961 | |||
| 352 | Ga0501042_0021534 | |||
| 353 | Ga0501042_0136881 | |||
| 354 | Ga0501042_0281480 | |||
| 355 | Ga0501043_0353722 | |||
| 356 | Ga0501048_0065004 | |||
| 357 | Ga0501067_0030439 | |||
| 358 | Ga0501068_0245933 | |||
| 359 | Ga0501069_0079449 | |||
| 360 | Ga0501071_0251997 | |||
| 361 | Ga0501071_0659898 | |||
| 362 | Ga0501076_0045622 | |||
| 363 | Ga0501035_0431726 | |||
| 364 | Ga0501045_0049243 | |||
| 365 | Ga0501045_0479146 | |||
| 366 | nmdc:mga05p37_52418_c1 | |||
| 367 | nmdc:mga09592_28408_c1 | |||
| 368 | nmdc:mga09592_49855_c1 | |||
| 369 | nmdc:mga0qj67_51136_c1 | |||
| 370 | nmdc:mga06r32_29491_c1 | |||
| 371 | nmdc:mga06r32_900_c1 | |||
| 372 | nmdc:mga0n895_457840_c1 | |||
| 373 | Ga0501082_0376949 | |||
| 374 | Ga0466962_0020253 | |||
| 375 | 2644098335 | |||
| 376 | 2644118938 | |||
| 377 | 2676474017 | |||
| 378 | 2739362370 | |||
| 379 | 2774394703 | |||
| 380 | 2809194453 | |||
| 381 | 2812349202 | |||
| 382 | 2827628906 | |||
| 383 | 2873316651 | |||
| 384 | 2891973087 | |||
| 385 | 2984577442 | |||
| 386 | 2990259602 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p35-assembly1.cif.gz_B | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9145 | 13 | 257 |
| 2p35-assembly1.cif.gz_B | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.9037 | 13 | 257 |
| 2p35-assembly1.cif.gz_A | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.8818 | 5 | 257 |
| 2p35-assembly1.cif.gz_A | crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens | 0.875 | 5 | 257 |
| 3ccf-assembly1.cif.gz_A | crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution | 0.8463 | 20 | 257 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2p35B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.9033 | 13 | 257 | 3.40.50.150 |
| 2p35B01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8877 | 13 | 257 | 3.40.50.150 |
| af_Q54LU3_44_217_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8638 | 3 | 130 | 3.40.50.150 |
| af_O13871_19_175_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8567 | 18 | 138 | 3.40.50.150 |
| af_K7KE15_1_124_3.40.50.150 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 | 0.8464 | 18 | 130 | 3.40.50.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H5R591-F1-model_v4 | Trans-aconitate 2-methyltransferase | 0.9458 | 1 | 255 |
GO:0030798
GO:0032259 |
| AF-A0A0M8QYU1-F1-model_v4 | deleted | 0.9455 | 1 | 256 |
|
| AF-A0A838SIL8-F1-model_v4 | Trans-aconitate 2-methyltransferase (EC 2.1.1.144) | 0.9416 | 1 | 262 |
GO:0005737
GO:0030798 GO:0032259 |
| AF-A0A6B2YDR2-F1-model_v4 | Trans-aconitate 2-methyltransferase (EC 2.1.1.144) | 0.9392 | 1 | 257 |
GO:0005737
GO:0009058 GO:0030798 GO:0032259 |
| AF-A0A3N0D798-F1-model_v4 | Trans-aconitate 2-methyltransferase (EC 2.1.1.144) | 0.9391 | 1 | 257 |
GO:0005737
GO:0009058 GO:0030798 GO:0032259 |