F297759

General Info

Members Datasets Scaffolds Average Seq Length
193 143 386 261

Family's Representative Sequence

Representative Sequence 3300049576|Ga0501040_0332109|Ga0501040_0332109_21_899
Length 292
Sequence LTYQDVLRYLGGEDEGREPTPVEDTMSHTWDPDRYLAYADERGRPFVDLLARVPAENPRVVVDLGCGPGTLTALLAARWPSADVTGVDSSPEMIEAARAVDGIHWEVGDLRDWARPDPLALREPVDVLVSNATLQWVPEHLELMPGLLDRLQPGGWLAFQVPGNFDEPSHTTRTDLAARAPYAEHVRDARVPASHDPDVYARVLLDLGCEVDAWETTYLHVLTGEDPVFDWVSGTGARPTLQALPDDLRPLFEDEFKKLLREAYPADTAGRVVLPFRRIFVVARKPQGVPVP

Samples

Sample ID Description Type Environment
1 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
2 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
3 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
4 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
5 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
6 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
7 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
8 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
15 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
20 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
31 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
36 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
49 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
50 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
51 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
52 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
58 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
59 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
60 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
61 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
62 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
63 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
64 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
65 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
66 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
67 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
68 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
69 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
71 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
72 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
73 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
74 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
75 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
83 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
84 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
85 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
86 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
89 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
90 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
95 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
96 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
97 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
98 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
99 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
100 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
101 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
102 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
103 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
104 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
105 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
106 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
107 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
108 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
109 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
114 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
118 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
122 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
123 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
124 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
131 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
132 2643221617 Nocardioides sp. Root79 Isolate Unclassified
133 2643221620 Nocardioides sp. Root240 Isolate Unclassified
134 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
135 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
136 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
137 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
138 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
139 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
140 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
141 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
142 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
143 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root

Type Distribution

Type Percentage (%)
Metagenomes 92.75
Metatranscriptomes 1.04
Isolates 6.22

Biome Distribution

Category Percentage (%)
Aerial Root 1.04
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 1.55
Rhizosphere 89.64
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501040_0332109 3300049576 Bacteria 1088
2 Ga0070661_100319883 3300005344 Bacteria 1212
3 Ga0070659_100159728 3300005366 Bacteria 1842
4 Ga0070709_10000307 3300005434 Bacteria 31007
5 Ga0070714_100000177 3300005435 Bacteria 51633
6 Ga0070714_100004302 3300005435 Bacteria 10732
7 Ga0070714_100017714 3300005435 Bacteria 5776
8 Ga0070713_100008876 3300005436 Bacteria 7157
9 Ga0070713_100009966 3300005436 Bacteria 6844
10 Ga0070713_100061836 3300005436 Bacteria 3134
11 Ga0070713_100236089 3300005436 Unclassified 1664
12 Ga0070710_10004352 3300005437 Bacteria 6710
13 Ga0070711_100006333 3300005439 Bacteria 7127
14 Ga0070711_100583713 3300005439 Bacteria 931
15 Ga0070706_100017087 3300005467 Bacteria 6702
16 Ga0070698_100000475 3300005471 Bacteria 42531
17 Ga0070679_100052320 3300005530 Bacteria 4069
18 Ga0068855_100793597 3300005563 Bacteria 1007
19 Ga0068857_100465360 3300005577 Bacteria 1184
20 Ga0081538_10108652 3300005981 Bacteria 1369
21 Ga0081540_1002856 3300005983 Bacteria 13989
22 Ga0070717_10014735 3300006028 Bacteria 6015
23 Ga0070717_10017097 3300006028 Bacteria 5635
24 Ga0070717_10027607 3300006028 Bacteria 4538
25 Ga0070717_10237032 3300006028 Bacteria 1608
26 Ga0075365_10148413 3300006038 Bacteria 1630
27 Ga0075363_100043472 3300006048 Bacteria 2377
28 Ga0070715_10069078 3300006163 Bacteria 1573
29 Ga0070716_100002016 3300006173 Bacteria 9280
30 Ga0070712_100033594 3300006175 Bacteria 3472
31 Ga0075428_100048092 3300006844 Bacteria 4682
32 Ga0075428_100281545 3300006844 Bacteria 1789
33 Ga0075430_100002300 3300006846 Bacteria 15849
34 Ga0075430_100195754 3300006846 Bacteria 1679
35 Ga0075431_100009044 3300006847 Bacteria 9988
36 Ga0075431_100097300 3300006847 Bacteria 3039
37 Ga0075431_100133957 3300006847 Bacteria 2554
38 Ga0075433_10022907 3300006852 Bacteria 5249
39 Ga0075434_100462146 3300006871 Bacteria 1290
40 Ga0075429_100005140 3300006880 Bacteria 11251
41 Ga0075429_100060333 3300006880 Bacteria 3304
42 Ga0075435_100095290 3300007076 Bacteria 2461
43 Ga0114129_10021581 3300009147 Bacteria 9141
44 Ga0105248_10530081 3300009177 Bacteria 1328
45 Ga0157369_10118531 3300013105 Bacteria 2810
46 Ga0157369_10427073 3300013105 Bacteria 1374
47 Ga0163161_10453053 3300017792 Bacteria 1037
48 Ga0206356_10717618 3300020070 Bacteria 1356
49 Ga0206353_10595818 3300020082 Bacteria 1554
50 Ga0213875_10000469 3300021388 Bacteria 34620
51 Ga0207692_10000173 3300025898 Bacteria 20587
52 Ga0207699_10001935 3300025906 Bacteria 9753
53 Ga0207684_10008983 3300025910 Bacteria 8860
54 Ga0207693_10010057 3300025915 Bacteria 7684
55 Ga0207663_10027834 3300025916 Bacteria 3300
56 Ga0207663_10200629 3300025916 Bacteria 1439
57 Ga0207700_10000291 3300025928 Bacteria 29714
58 Ga0207700_10004937 3300025928 Bacteria 7925
59 Ga0207700_10043116 3300025928 Bacteria 3312
60 Ga0207700_10064327 3300025928 Bacteria 2793
61 Ga0207700_10095276 3300025928 Bacteria 2361
62 Ga0207664_10000163 3300025929 Bacteria 53290
63 Ga0207664_10001030 3300025929 Bacteria 18668
64 Ga0207664_10005944 3300025929 Bacteria 8353
65 Ga0207664_10103649 3300025929 Bacteria 2354
66 Ga0207664_10109508 3300025929 Bacteria 2295
67 Ga0207665_10002384 3300025939 Bacteria 12690
68 Ga0207677_10066352 3300026023 Bacteria 2523
69 Ga0207678_10576596 3300026067 Bacteria 985
70 Ga0207674_10027856 3300026116 Bacteria 5969
71 Ga0207698_10402063 3300026142 Bacteria 1309
72 Ga0265337_1000015 3300028556 Bacteria 80871
73 Ga0265326_10000453 3300028558 Bacteria 16127
74 Ga0265319_1001068 3300028563 Bacteria 17089
75 Ga0265334_10000278 3300028573 Bacteria 28820
76 Ga0265323_10005723 3300028653 Bacteria 5268
77 Ga0265336_10000833 3300028666 Bacteria 16072
78 Ga0265338_10000767 3300028800 Bacteria 54778
79 Ga0265338_10008616 3300028800 Bacteria 12336
80 Ga0265338_10037090 3300028800 Bacteria 4647
81 Ga0265338_10082568 3300028800 Bacteria 2690
82 Ga0265324_10001791 3300029957 Bacteria 11726
83 Ga0265332_10002335 3300031238 Bacteria 9677
84 Ga0265320_10000498 3300031240 Bacteria 30619
85 Ga0265340_10001538 3300031247 Bacteria 13244
86 Ga0265316_10079070 3300031344 Bacteria 2523
87 Ga0265313_10018523 3300031595 Bacteria 3905
88 Ga0265314_10002535 3300031711 Bacteria 18582
89 Ga0265342_10001186 3300031712 Bacteria 24747
90 Ga0307413_10319310 3300031824 Bacteria 1186
91 Ga0307410_10223733 3300031852 Bacteria 1449
92 Ga0307410_10544649 3300031852 Bacteria 961
93 Ga0307409_100159249 3300031995 Bacteria 1972
94 Ga0307409_100379898 3300031995 Bacteria 1343
95 Ga0316214_1002061 3300033545 Bacteria 2444
96 Ga0373926_0044001 3300035083 Bacteria 1599
97 Ga0373934_0018531 3300035086 Bacteria 2664
98 Ga0373934_0031444 3300035086 Bacteria 2078
99 Ga0373923_0067613 3300035111 Bacteria 1529
100 Ga0373956_0014976 3300035119 Bacteria 3243
101 Ga0373946_0283489 3300035171 Unclassified 816
102 Ga0373955_0019423 3300035172 Bacteria 3396
103 Ga0373924_0043296 3300035410 Bacteria 1849
104 Ga0373935_0003132 3300035692 Bacteria 9547
105 Ga0373933_0194845 3300035724 Bacteria 1295
106 Ga0373947_0000009 3300035725 Bacteria 172751
107 Ga0373937_0160232 3300036401 Bacteria 2109
108 Ga0373937_0206911 3300036401 Bacteria 1845
109 Ga0436364_0841734 3300037853 Bacteria 2256
110 Ga0436364_1327441 3300037853 Bacteria 2537
111 Ga0436364_1518594 3300037853 Bacteria 37293
112 Ga0395901_0351038 3300038443 Bacteria 1522
113 Ga0466972_0071257 3300044658 Bacteria 1658
114 Ga0466972_0152425 3300044658 Bacteria 1086
115 Ga0466965_0028746 3300044683 Bacteria 2702
116 Ga0466961_0029084 3300044693 Bacteria 3553
117 Ga0466961_0177624 3300044693 Bacteria 1322
118 Ga0466964_0072063 3300044706 Bacteria 1463
119 Ga0466971_0006954 3300044719 Bacteria 4921
120 Ga0466970_0077283 3300044765 Bacteria 1794
121 Ga0466957_0009419 3300044842 Bacteria 5577
122 Ga0466960_0085434 3300044901 Bacteria 1598
123 Ga0466959_0219347 3300045049 Bacteria 1320
124 Ga0466967_0141677 3300045976 Bacteria 2240
125 Ga0466967_0173070 3300045976 Bacteria 2032
126 Ga0466967_0427562 3300045976 Bacteria 1292
127 Ga0495592_0132647 3300046454 Bacteria 1741
128 Ga0495651_0007951 3300046462 Bacteria 8128
129 Ga0495651_0211689 3300046462 Bacteria 1348
130 Ga0495608_0013756 3300046511 Bacteria 5614
131 Ga0495630_0166922 3300046517 Bacteria 1676
132 Ga0495652_0038726 3300046529 Bacteria 4128
133 Ga0495587_0123753 3300046536 Bacteria 1480
134 Ga0495667_0026831 3300046559 Bacteria 3881
135 Ga0495657_0033226 3300046675 Bacteria 3593
136 Ga0495623_0046440 3300046679 Bacteria 2756
137 Ga0495623_0193259 3300046679 Bacteria 1174
138 Ga0495604_0032897 3300047317 Bacteria 4107
139 Ga0495604_0067280 3300047317 Bacteria 2723
140 Ga0495674_0800983 3300047319 Bacteria 733
141 Ga0495680_0017370 3300047322 Bacteria 6146
142 Ga0495680_0308643 3300047322 Bacteria 1109
143 Ga0495675_0040323 3300047444 Bacteria 2975
144 Ga0495684_0054208 3300047471 Bacteria 3059
145 Ga0495602_0137749 3300048088 Bacteria 1936
146 Ga0496104_0509396 3300048907 Bacteria 1115
147 Ga0496110_0400368 3300048913 Bacteria 1251
148 Ga0496114_0274778 3300048917 Bacteria 1485
149 Ga0496126_0317089 3300048929 Bacteria 1282
150 Ga0501031_0133441 3300049568 Bacteria 1622
151 Ga0501031_0184783 3300049568 Bacteria 1361
152 Ga0501032_0263624 3300049569 Bacteria 1117
153 Ga0501032_0294747 3300049569 Bacteria 1049
154 Ga0501036_0635960 3300049572 Bacteria 884
155 Ga0501037_0117674 3300049573 Bacteria 1912
156 Ga0501039_0050194 3300049575 Bacteria 3227
157 Ga0501041_0012696 3300049577 Bacteria 4991
158 Ga0501041_0049961 3300049577 Bacteria 2548
159 Ga0501042_0021534 3300049578 Bacteria 4495
160 Ga0501042_0136881 3300049578 Bacteria 1766
161 Ga0501042_0281480 3300049578 Bacteria 1201
162 Ga0501043_0353722 3300049579 Bacteria 1116
163 Ga0501048_0065004 3300049582 Bacteria 2580
164 Ga0501067_0030439 3300049583 Bacteria 2993
165 Ga0501068_0245933 3300049584 Bacteria 1139
166 Ga0501069_0079449 3300049585 Bacteria 1846
167 Ga0501071_0251997 3300049587 Bacteria 1333
168 Ga0501071_0659898 3300049587 Bacteria 805
169 Ga0501076_0045622 3300049592 Bacteria 3460
170 Ga0501035_0431726 3300049822 Bacteria 1092
171 Ga0501045_0049243 3300049824 Bacteria 3072
172 Ga0501045_0479146 3300049824 Bacteria 925
173 nmdc:mga05p37_52418_c1 3300050507 Bacteria 5017
174 nmdc:mga09592_28408_c1 3300050508 Bacteria 4647
175 nmdc:mga09592_49855_c1 3300050508 Bacteria 3530
176 nmdc:mga0qj67_51136_c1 3300050509 Bacteria 3267
177 nmdc:mga06r32_29491_c1 3300050510 Bacteria 5143
178 nmdc:mga06r32_900_c1 3300050510 Bacteria 3502
179 nmdc:mga0n895_457840_c1 3300050512 Bacteria 1288
180 Ga0501082_0376949 3300060353 Bacteria 1238
181 Ga0466962_0020253 3300061719 Bacteria 3197
182 2644098335 2643221617 Bacteria 5139111
183 2644118938 2643221620 Bacteria 5134593
184 2676474017 2675903058 Bacteria 6822861
185 2739362370 2738543034 Bacteria 6084756
186 2774394703 2773857762 Bacteria 5971770
187 2809194453 2808606439 Bacteria 5952208
188 2812349202 2811994878 Bacteria 5992952
189 2827628906 2827628540 Bacteria 6858585
190 2873316651 2873314349 Bacteria 8512634
191 2891973087 2891968417 Bacteria 5821697
192 2984577442 2984576629 Bacteria 4248407
193 2990259602 2990256926 Bacteria 4252839
194 Ga0501040_0332109
195 Ga0070661_100319883
196 Ga0070659_100159728
197 Ga0070709_10000307
198 Ga0070714_100000177
199 Ga0070714_100004302
200 Ga0070714_100017714
201 Ga0070713_100008876
202 Ga0070713_100009966
203 Ga0070713_100061836
204 Ga0070713_100236089
205 Ga0070710_10004352
206 Ga0070711_100006333
207 Ga0070711_100583713
208 Ga0070706_100017087
209 Ga0070698_100000475
210 Ga0070679_100052320
211 Ga0068855_100793597
212 Ga0068857_100465360
213 Ga0081538_10108652
214 Ga0081540_1002856
215 Ga0070717_10014735
216 Ga0070717_10017097
217 Ga0070717_10027607
218 Ga0070717_10237032
219 Ga0075365_10148413
220 Ga0075363_100043472
221 Ga0070715_10069078
222 Ga0070716_100002016
223 Ga0070712_100033594
224 Ga0075428_100048092
225 Ga0075428_100281545
226 Ga0075430_100002300
227 Ga0075430_100195754
228 Ga0075431_100009044
229 Ga0075431_100097300
230 Ga0075431_100133957
231 Ga0075433_10022907
232 Ga0075434_100462146
233 Ga0075429_100005140
234 Ga0075429_100060333
235 Ga0075435_100095290
236 Ga0114129_10021581
237 Ga0105248_10530081
238 Ga0157369_10118531
239 Ga0157369_10427073
240 Ga0163161_10453053
241 Ga0206356_10717618
242 Ga0206353_10595818
243 Ga0213875_10000469
244 Ga0207692_10000173
245 Ga0207699_10001935
246 Ga0207684_10008983
247 Ga0207693_10010057
248 Ga0207663_10027834
249 Ga0207663_10200629
250 Ga0207700_10000291
251 Ga0207700_10004937
252 Ga0207700_10043116
253 Ga0207700_10064327
254 Ga0207700_10095276
255 Ga0207664_10000163
256 Ga0207664_10001030
257 Ga0207664_10005944
258 Ga0207664_10103649
259 Ga0207664_10109508
260 Ga0207665_10002384
261 Ga0207677_10066352
262 Ga0207678_10576596
263 Ga0207674_10027856
264 Ga0207698_10402063
265 Ga0265337_1000015
266 Ga0265326_10000453
267 Ga0265319_1001068
268 Ga0265334_10000278
269 Ga0265323_10005723
270 Ga0265336_10000833
271 Ga0265338_10000767
272 Ga0265338_10008616
273 Ga0265338_10037090
274 Ga0265338_10082568
275 Ga0265324_10001791
276 Ga0265332_10002335
277 Ga0265320_10000498
278 Ga0265340_10001538
279 Ga0265316_10079070
280 Ga0265313_10018523
281 Ga0265314_10002535
282 Ga0265342_10001186
283 Ga0307413_10319310
284 Ga0307410_10223733
285 Ga0307410_10544649
286 Ga0307409_100159249
287 Ga0307409_100379898
288 Ga0316214_1002061
289 Ga0373926_0044001
290 Ga0373934_0018531
291 Ga0373934_0031444
292 Ga0373923_0067613
293 Ga0373956_0014976
294 Ga0373946_0283489
295 Ga0373955_0019423
296 Ga0373924_0043296
297 Ga0373935_0003132
298 Ga0373933_0194845
299 Ga0373947_0000009
300 Ga0373937_0160232
301 Ga0373937_0206911
302 Ga0436364_0841734
303 Ga0436364_1327441
304 Ga0436364_1518594
305 Ga0395901_0351038
306 Ga0466972_0071257
307 Ga0466972_0152425
308 Ga0466965_0028746
309 Ga0466961_0029084
310 Ga0466961_0177624
311 Ga0466964_0072063
312 Ga0466971_0006954
313 Ga0466970_0077283
314 Ga0466957_0009419
315 Ga0466960_0085434
316 Ga0466959_0219347
317 Ga0466967_0141677
318 Ga0466967_0173070
319 Ga0466967_0427562
320 Ga0495592_0132647
321 Ga0495651_0007951
322 Ga0495651_0211689
323 Ga0495608_0013756
324 Ga0495630_0166922
325 Ga0495652_0038726
326 Ga0495587_0123753
327 Ga0495667_0026831
328 Ga0495657_0033226
329 Ga0495623_0046440
330 Ga0495623_0193259
331 Ga0495604_0032897
332 Ga0495604_0067280
333 Ga0495674_0800983
334 Ga0495680_0017370
335 Ga0495680_0308643
336 Ga0495675_0040323
337 Ga0495684_0054208
338 Ga0495602_0137749
339 Ga0496104_0509396
340 Ga0496110_0400368
341 Ga0496114_0274778
342 Ga0496126_0317089
343 Ga0501031_0133441
344 Ga0501031_0184783
345 Ga0501032_0263624
346 Ga0501032_0294747
347 Ga0501036_0635960
348 Ga0501037_0117674
349 Ga0501039_0050194
350 Ga0501041_0012696
351 Ga0501041_0049961
352 Ga0501042_0021534
353 Ga0501042_0136881
354 Ga0501042_0281480
355 Ga0501043_0353722
356 Ga0501048_0065004
357 Ga0501067_0030439
358 Ga0501068_0245933
359 Ga0501069_0079449
360 Ga0501071_0251997
361 Ga0501071_0659898
362 Ga0501076_0045622
363 Ga0501035_0431726
364 Ga0501045_0049243
365 Ga0501045_0479146
366 nmdc:mga05p37_52418_c1
367 nmdc:mga09592_28408_c1
368 nmdc:mga09592_49855_c1
369 nmdc:mga0qj67_51136_c1
370 nmdc:mga06r32_29491_c1
371 nmdc:mga06r32_900_c1
372 nmdc:mga0n895_457840_c1
373 Ga0501082_0376949
374 Ga0466962_0020253
375 2644098335
376 2644118938
377 2676474017
378 2739362370
379 2774394703
380 2809194453
381 2812349202
382 2827628906
383 2873316651
384 2891973087
385 2984577442
386 2990259602

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08242

Methyltransf_12

Methyltransferase domain

62

157

0.96

PF05175

MTS

Methyltransferase small domain

47

104

0.92

PF13649

Methyltransf_25

Methyltransferase domain

61

155

0.88

PF13847

Methyltransf_31

Methyltransferase domain

56

192

0.87

PF08241

Methyltransf_11

Methyltransferase domain

62

159

0.86

PF01728

FtsJ

FtsJ-like methyltransferase

38

144

0.85

PF13489

Methyltransf_23

Methyltransferase domain

35

213

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9145 13 257
2p35-assembly1.cif.gz_B crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.9037 13 257
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.8818 5 257
2p35-assembly1.cif.gz_A crystal structure of trans-aconitate methyltransferase from agrobacterium tumefaciens 0.875 5 257
3ccf-assembly1.cif.gz_A crystal structure of putative methyltransferase (yp_321342.1) from anabaena variabilis atcc 29413 at 1.90 a resolution 0.8463 20 257
ID Description Score Start End Superfamily
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9033 13 257 3.40.50.150
2p35B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8877 13 257 3.40.50.150
af_Q54LU3_44_217_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8638 3 130 3.40.50.150
af_O13871_19_175_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8567 18 138 3.40.50.150
af_K7KE15_1_124_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8464 18 130 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1H5R591-F1-model_v4 Trans-aconitate 2-methyltransferase 0.9458 1 255 GO:0030798
GO:0032259
AF-A0A0M8QYU1-F1-model_v4 deleted 0.9455 1 256
AF-A0A838SIL8-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9416 1 262 GO:0005737
GO:0030798
GO:0032259
AF-A0A6B2YDR2-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9392 1 257 GO:0005737
GO:0009058
GO:0030798
GO:0032259
AF-A0A3N0D798-F1-model_v4 Trans-aconitate 2-methyltransferase (EC 2.1.1.144) 0.9391 1 257 GO:0005737
GO:0009058
GO:0030798
GO:0032259

Map