F297695

General Info

Members Datasets Scaffolds Average Seq Length
193 140 386 107

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0537644|Ga0496105_0537644_103_513
Length 136
Sequence VTYTQLCLVAVTVSVVLDVAVLRTRLLSRKAFWISYAIMVFFQLLTNGWLTGRGVVRYDGAAILGGPDPVAFGEWRVLYAPVEDLAFGFALILQTLSWWVYWGRRGVQRRPPRSRTRRGVPAGGLPPGPDGSGERG

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
42 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
49 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
52 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
55 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
89 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
90 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
91 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
94 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
95 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
96 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
99 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
100 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
101 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
102 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
103 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
104 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
110 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
111 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
112 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
113 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
121 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
127 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
128 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
129 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
130 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
131 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
132 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
140 2643221679 Angustibacter sp. Root456 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.89
Metatranscriptomes 2.59
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.22
Rhizosphere 91.19
Stem 0
Stem Tuber 0
Unclassified 6.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0537644 3300048908 Unclassified 914
2 Ga0070658_10011733 3300005327 Bacteria 7029
3 Ga0070683_100329631 3300005329 Bacteria 1453
4 Ga0070666_10010975 3300005335 Bacteria 5678
5 Ga0070680_100056523 3300005336 Bacteria 3207
6 Ga0070661_100027951 3300005344 Bacteria 4065
7 Ga0070692_10387096 3300005345 Bacteria 879
8 Ga0070668_100008942 3300005347 Bacteria 7436
9 Ga0070671_100001939 3300005355 Bacteria 15867
10 Ga0070659_100078501 3300005366 Bacteria 2634
11 Ga0070667_100049031 3300005367 Bacteria 3556
12 Ga0070714_100507154 3300005435 Bacteria 1151
13 Ga0070713_100069106 3300005436 Bacteria 2978
14 Ga0070705_100042042 3300005440 Bacteria 2610
15 Ga0070681_10086789 3300005458 Bacteria 3082
16 Ga0070706_101702374 3300005467 Bacteria 574
17 Ga0070679_100322284 3300005530 Bacteria 1494
18 Ga0070679_100916006 3300005530 Bacteria 820
19 Ga0070684_100004200 3300005535 Bacteria 10911
20 Ga0070684_100219330 3300005535 Bacteria 1735
21 Ga0070684_100462946 3300005535 Bacteria 1172
22 Ga0070686_101147862 3300005544 Bacteria 643
23 Ga0070693_100037966 3300005547 Bacteria 2689
24 Ga0070665_100000914 3300005548 Bacteria 37867
25 Ga0068855_100411792 3300005563 Bacteria 1480
26 Ga0068855_100466983 3300005563 Bacteria 1375
27 Ga0070664_100103236 3300005564 Bacteria 2482
28 Ga0070664_100610739 3300005564 Bacteria 1012
29 Ga0068857_101077077 3300005577 Bacteria 775
30 Ga0068856_100004071 3300005614 Bacteria 14629
31 Ga0068856_100048209 3300005614 Bacteria 4197
32 Ga0070702_100000113 3300005615 Bacteria 24389
33 Ga0068852_100639064 3300005616 Bacteria 1071
34 Ga0068852_101015753 3300005616 Bacteria 848
35 Ga0068866_10059873 3300005718 Bacteria 1972
36 Ga0068863_100001414 3300005841 Bacteria 23780
37 Ga0068860_100000043 3300005843 Bacteria 225862
38 Ga0068860_100360021 3300005843 Bacteria 1433
39 Ga0081540_1002572 3300005983 Bacteria 14727
40 Ga0070717_10200937 3300006028 Bacteria 1746
41 Ga0070717_10826690 3300006028 Bacteria 843
42 Ga0070717_10935681 3300006028 Bacteria 789
43 Ga0070716_101457274 3300006173 Bacteria 558
44 Ga0075428_100012357 3300006844 Bacteria 9500
45 Ga0075430_100008561 3300006846 Bacteria 8629
46 Ga0075430_101657149 3300006846 Bacteria 525
47 Ga0075431_100007272 3300006847 Bacteria 11022
48 Ga0075429_100000238 3300006880 Bacteria 37822
49 Ga0075429_101320693 3300006880 Bacteria 629
50 Ga0068865_100172677 3300006881 Bacteria 1658
51 Ga0111539_10278520 3300009094 Bacteria 1946
52 Ga0114129_10004574 3300009147 Bacteria 19512
53 Ga0114129_10618257 3300009147 Bacteria 1402
54 Ga0114129_12284517 3300009147 Unclassified 649
55 Ga0105237_12713308 3300009545 Unclassified 506
56 Ga0105238_12539880 3300009551 Bacteria 548
57 Ga0105249_10115745 3300009553 Bacteria 2541
58 Ga0105239_10336290 3300010375 Bacteria 1704
59 Ga0105239_10396882 3300010375 Bacteria 1561
60 Ga0157370_10230912 3300013104 Bacteria 1713
61 Ga0157369_10136957 3300013105 Bacteria 2592
62 Ga0157369_10154787 3300013105 Bacteria 2422
63 Ga0157369_10755632 3300013105 Bacteria 1000
64 Ga0157374_12114466 3300013296 Bacteria 590
65 Ga0157378_10041393 3300013297 Bacteria 4086
66 Ga0163162_10527655 3300013306 Bacteria 1310
67 Ga0157372_11784926 3300013307 Bacteria 707
68 Ga0157375_10264778 3300013308 Bacteria 1881
69 Ga0157375_10625421 3300013308 Bacteria 1234
70 Ga0157379_10008462 3300014968 Bacteria 8948
71 Ga0157376_11969624 3300014969 Bacteria 622
72 Ga0163161_10752586 3300017792 Bacteria 815
73 Ga0163161_10835985 3300017792 Unclassified 776
74 Ga0206356_10793208 3300020070 Bacteria 1555
75 Ga0206354_10035513 3300020081 Bacteria 656
76 Ga0206353_11224189 3300020082 Bacteria 2139
77 Ga0206353_11588572 3300020082 Bacteria 1020
78 Ga0206353_11819483 3300020082 Bacteria 564
79 Ga0207642_10148487 3300025899 Bacteria 1245
80 Ga0207680_10067566 3300025903 Bacteria 2202
81 Ga0207699_11035706 3300025906 Unclassified 607
82 Ga0207705_10178390 3300025909 Bacteria 1602
83 Ga0207707_10180817 3300025912 Bacteria 1841
84 Ga0207695_10145200 3300025913 Bacteria 2317
85 Ga0207695_10613519 3300025913 Bacteria 969
86 Ga0207671_10067826 3300025914 Bacteria 2657
87 Ga0207671_11486300 3300025914 Unclassified 523
88 Ga0207657_10762275 3300025919 Bacteria 749
89 Ga0207649_10319625 3300025920 Bacteria 1140
90 Ga0207652_10295398 3300025921 Bacteria 1462
91 Ga0207694_10709956 3300025924 Bacteria 848
92 Ga0207694_11721041 3300025924 Bacteria 527
93 Ga0207664_10197068 3300025929 Bacteria 1737
94 Ga0207644_10649318 3300025931 Bacteria 878
95 Ga0207690_10101869 3300025932 Bacteria 2052
96 Ga0207709_10202199 3300025935 Bacteria 1420
97 Ga0207669_10396429 3300025937 Bacteria 1080
98 Ga0207661_10004959 3300025944 Bacteria 9336
99 Ga0207661_10008942 3300025944 Bacteria 7172
100 Ga0207661_10498741 3300025944 Bacteria 1112
101 Ga0207679_10564323 3300025945 Bacteria 1023
102 Ga0207667_10037434 3300025949 Bacteria 5185
103 Ga0207667_10930850 3300025949 Bacteria 859
104 Ga0207668_10089410 3300025972 Bacteria 2258
105 Ga0207668_10104079 3300025972 Bacteria 2115
106 Ga0207658_10275737 3300025986 Bacteria 1439
107 Ga0207677_10761955 3300026023 Bacteria 864
108 Ga0207703_11739491 3300026035 Bacteria 599
109 Ga0207678_10310278 3300026067 Bacteria 1356
110 Ga0207702_10007850 3300026078 Bacteria 9051
111 Ga0207641_10003424 3300026088 Bacteria 14059
112 Ga0207676_10231013 3300026095 Bacteria 1654
113 Ga0207698_10252510 3300026142 Bacteria 1615
114 Ga0207698_10575764 3300026142 Bacteria 1107
115 Ga0268266_10001243 3300028379 Bacteria 31174
116 Ga0268264_10000027 3300028381 Bacteria 440852
117 Ga0307508_10098665 3300031616 Bacteria 2515
118 Ga0307508_10116144 3300031616 Bacteria 2278
119 Ga0316576_10003147 3300031727 Bacteria 9620
120 Ga0316578_10026303 3300031728 Bacteria 3281
121 Ga0307413_11578092 3300031824 Bacteria 582
122 Ga0307406_10272678 3300031901 Bacteria 1286
123 Ga0307406_10903114 3300031901 Bacteria 752
124 Ga0307407_10855391 3300031903 Unclassified 695
125 Ga0307416_100705205 3300032002 Bacteria 1099
126 Ga0307414_11959142 3300032004 Bacteria 547
127 Ga0307411_11943426 3300032005 Bacteria 548
128 Ga0307415_100209199 3300032126 Bacteria 1555
129 Ga0395898_1362872 3300037466 Bacteria 638
130 Ga0395901_1368777 3300038443 Bacteria 667
131 Ga0451797_0351516 3300041453 Bacteria 1224
132 Ga0451800_1550943 3300041459 Bacteria 865
133 Ga0451835_0842849 3300041492 Bacteria 651
134 Ga0451853_2477869 3300041512 Bacteria 733
135 Ga0466969_0282907 3300044656 Bacteria 751
136 Ga0466972_0500876 3300044658 Unclassified 572
137 Ga0466961_0066732 3300044693 Bacteria 2285
138 Ga0466961_0092536 3300044693 Bacteria 1908
139 Ga0466963_0017263 3300044694 Bacteria 4497
140 Ga0466963_0093475 3300044694 Bacteria 2050
141 Ga0466963_0337901 3300044694 Bacteria 1060
142 Ga0466964_0198583 3300044706 Bacteria 961
143 Ga0466964_0658787 3300044706 Bacteria 580
144 Ga0466970_0039377 3300044765 Bacteria 2508
145 Ga0466957_0047000 3300044842 Bacteria 2621
146 Ga0466957_0070411 3300044842 Bacteria 2161
147 Ga0466957_0236426 3300044842 Bacteria 1211
148 Ga0466957_0302292 3300044842 Bacteria 1075
149 Ga0466960_0012016 3300044901 Bacteria 3643
150 Ga0466958_0009713 3300045836 Bacteria 5368
151 Ga0466958_0039450 3300045836 Bacteria 2838
152 Ga0466967_0005034 3300045976 Bacteria 9056
153 Ga0466967_0106483 3300045976 Bacteria 2570
154 Ga0466967_0317827 3300045976 Bacteria 1501
155 Ga0466967_0968513 3300045976 Bacteria 847
156 Ga0466967_1757891 3300045976 Bacteria 617
157 Ga0495594_0080572 3300046499 Bacteria 1817
158 Ga0495630_0438656 3300046517 Bacteria 1001
159 Ga0495658_1095645 3300046683 Bacteria 508
160 Ga0496105_0872770 3300048908 Bacteria 680
161 Ga0496107_0724615 3300048910 Bacteria 731
162 Ga0496109_0547458 3300048912 Bacteria 1092
163 Ga0496109_1156496 3300048912 Bacteria 711
164 Ga0496110_1395283 3300048913 Bacteria 610
165 Ga0496112_0163388 3300048915 Bacteria 2193
166 Ga0496113_0162335 3300048916 Bacteria 1767
167 Ga0496113_0676171 3300048916 Bacteria 825
168 Ga0496114_0368888 3300048917 Unclassified 1270
169 Ga0501031_0088995 3300049568 Bacteria 2013
170 Ga0501039_0421612 3300049575 Bacteria 1048
171 Ga0501042_0090685 3300049578 Bacteria 2194
172 Ga0501046_0690519 3300049580 Bacteria 720
173 Ga0501047_0016341 3300049581 Bacteria 7083
174 Ga0501068_0514156 3300049584 Bacteria 777
175 Ga0501069_0376254 3300049585 Bacteria 839
176 Ga0501070_0040684 3300049586 Bacteria 3876
177 Ga0501073_0220646 3300049589 Bacteria 1310
178 Ga0501079_1259905 3300049741 Unclassified 582
179 nmdc:mga05p37_1458874_c1 3300050507 Unclassified 684
180 nmdc:mga05p37_1803308_c1 3300050507 Bacteria 590
181 nmdc:mga05p37_26874_c1 3300050507 Bacteria 6208
182 nmdc:mga09592_39203_c1 3300050508 Bacteria 3979
183 nmdc:mga09592_733165_c1 3300050508 Bacteria 839
184 nmdc:mga0qj67_10626_c1 3300050509 Bacteria 6879
185 nmdc:mga0qj67_24104_c1 3300050509 Bacteria 4688
186 nmdc:mga0qj67_750646_c1 3300050509 Bacteria 774
187 nmdc:mga06r32_31013_c1 3300050510 Bacteria 5019
188 Ga0501084_0156361 3300054114 Bacteria 1923
189 Ga0501084_1085126 3300054114 Unclassified 672
190 Ga0466962_0082543 3300061719 Bacteria 1537
191 Ga0466962_0213401 3300061719 Bacteria 944
192 Ga0530510_0177305 3300061734 Bacteria 1580
193 2644446165 2643221679 Bacteria 3839507
194 Ga0496105_0537644
195 Ga0070658_10011733
196 Ga0070683_100329631
197 Ga0070666_10010975
198 Ga0070680_100056523
199 Ga0070661_100027951
200 Ga0070692_10387096
201 Ga0070668_100008942
202 Ga0070671_100001939
203 Ga0070659_100078501
204 Ga0070667_100049031
205 Ga0070714_100507154
206 Ga0070713_100069106
207 Ga0070705_100042042
208 Ga0070681_10086789
209 Ga0070706_101702374
210 Ga0070679_100322284
211 Ga0070679_100916006
212 Ga0070684_100004200
213 Ga0070684_100219330
214 Ga0070684_100462946
215 Ga0070686_101147862
216 Ga0070693_100037966
217 Ga0070665_100000914
218 Ga0068855_100411792
219 Ga0068855_100466983
220 Ga0070664_100103236
221 Ga0070664_100610739
222 Ga0068857_101077077
223 Ga0068856_100004071
224 Ga0068856_100048209
225 Ga0070702_100000113
226 Ga0068852_100639064
227 Ga0068852_101015753
228 Ga0068866_10059873
229 Ga0068863_100001414
230 Ga0068860_100000043
231 Ga0068860_100360021
232 Ga0081540_1002572
233 Ga0070717_10200937
234 Ga0070717_10826690
235 Ga0070717_10935681
236 Ga0070716_101457274
237 Ga0075428_100012357
238 Ga0075430_100008561
239 Ga0075430_101657149
240 Ga0075431_100007272
241 Ga0075429_100000238
242 Ga0075429_101320693
243 Ga0068865_100172677
244 Ga0111539_10278520
245 Ga0114129_10004574
246 Ga0114129_10618257
247 Ga0114129_12284517
248 Ga0105237_12713308
249 Ga0105238_12539880
250 Ga0105249_10115745
251 Ga0105239_10336290
252 Ga0105239_10396882
253 Ga0157370_10230912
254 Ga0157369_10136957
255 Ga0157369_10154787
256 Ga0157369_10755632
257 Ga0157374_12114466
258 Ga0157378_10041393
259 Ga0163162_10527655
260 Ga0157372_11784926
261 Ga0157375_10264778
262 Ga0157375_10625421
263 Ga0157379_10008462
264 Ga0157376_11969624
265 Ga0163161_10752586
266 Ga0163161_10835985
267 Ga0206356_10793208
268 Ga0206354_10035513
269 Ga0206353_11224189
270 Ga0206353_11588572
271 Ga0206353_11819483
272 Ga0207642_10148487
273 Ga0207680_10067566
274 Ga0207699_11035706
275 Ga0207705_10178390
276 Ga0207707_10180817
277 Ga0207695_10145200
278 Ga0207695_10613519
279 Ga0207671_10067826
280 Ga0207671_11486300
281 Ga0207657_10762275
282 Ga0207649_10319625
283 Ga0207652_10295398
284 Ga0207694_10709956
285 Ga0207694_11721041
286 Ga0207664_10197068
287 Ga0207644_10649318
288 Ga0207690_10101869
289 Ga0207709_10202199
290 Ga0207669_10396429
291 Ga0207661_10004959
292 Ga0207661_10008942
293 Ga0207661_10498741
294 Ga0207679_10564323
295 Ga0207667_10037434
296 Ga0207667_10930850
297 Ga0207668_10089410
298 Ga0207668_10104079
299 Ga0207658_10275737
300 Ga0207677_10761955
301 Ga0207703_11739491
302 Ga0207678_10310278
303 Ga0207702_10007850
304 Ga0207641_10003424
305 Ga0207676_10231013
306 Ga0207698_10252510
307 Ga0207698_10575764
308 Ga0268266_10001243
309 Ga0268264_10000027
310 Ga0307508_10098665
311 Ga0307508_10116144
312 Ga0316576_10003147
313 Ga0316578_10026303
314 Ga0307413_11578092
315 Ga0307406_10272678
316 Ga0307406_10903114
317 Ga0307407_10855391
318 Ga0307416_100705205
319 Ga0307414_11959142
320 Ga0307411_11943426
321 Ga0307415_100209199
322 Ga0395898_1362872
323 Ga0395901_1368777
324 Ga0451797_0351516
325 Ga0451800_1550943
326 Ga0451835_0842849
327 Ga0451853_2477869
328 Ga0466969_0282907
329 Ga0466972_0500876
330 Ga0466961_0066732
331 Ga0466961_0092536
332 Ga0466963_0017263
333 Ga0466963_0093475
334 Ga0466963_0337901
335 Ga0466964_0198583
336 Ga0466964_0658787
337 Ga0466970_0039377
338 Ga0466957_0047000
339 Ga0466957_0070411
340 Ga0466957_0236426
341 Ga0466957_0302292
342 Ga0466960_0012016
343 Ga0466958_0009713
344 Ga0466958_0039450
345 Ga0466967_0005034
346 Ga0466967_0106483
347 Ga0466967_0317827
348 Ga0466967_0968513
349 Ga0466967_1757891
350 Ga0495594_0080572
351 Ga0495630_0438656
352 Ga0495658_1095645
353 Ga0496105_0872770
354 Ga0496107_0724615
355 Ga0496109_0547458
356 Ga0496109_1156496
357 Ga0496110_1395283
358 Ga0496112_0163388
359 Ga0496113_0162335
360 Ga0496113_0676171
361 Ga0496114_0368888
362 Ga0501031_0088995
363 Ga0501039_0421612
364 Ga0501042_0090685
365 Ga0501046_0690519
366 Ga0501047_0016341
367 Ga0501068_0514156
368 Ga0501069_0376254
369 Ga0501070_0040684
370 Ga0501073_0220646
371 Ga0501079_1259905
372 nmdc:mga05p37_1458874_c1
373 nmdc:mga05p37_1803308_c1
374 nmdc:mga05p37_26874_c1
375 nmdc:mga09592_39203_c1
376 nmdc:mga09592_733165_c1
377 nmdc:mga0qj67_10626_c1
378 nmdc:mga0qj67_24104_c1
379 nmdc:mga0qj67_750646_c1
380 nmdc:mga06r32_31013_c1
381 Ga0501084_0156361
382 Ga0501084_1085126
383 Ga0466962_0082543
384 Ga0466962_0213401
385 Ga0530510_0177305
386 2644446165

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.4621 22 100
4gd3-assembly1.cif.gz_A structure of e. coli hydrogenase-1 in complex with cytochrome b 0.4548 38 96
7qhm-assembly1.cif.gz_L cytochrome bcc-aa3 supercomplex (respiratory supercomplex iii2/iv2) from corynebacterium glutamicum (stigmatellin and azide bound) 0.4193 22 100
8j7b-assembly1.cif.gz_1 coordinates of cryo-em structure of the arabidopsis thaliana psi in state 2 (psi-st2) 0.3377 37 94
6adq-assembly1.cif.gz_P respiratory complex ciii2civ2sod2 from mycobacterium smegmatis 0.333 36 97
ID Description Score Start End Superfamily
af_P07510_246_353_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4632 1 106 1.20.58.390
4gd3B00 Mainly Alpha;Up-down Bundle;Fumarate Reductase Cytochrome B subunit;Transmembrane di-heme cytochromes, Chain C 0.4551 38 96 1.20.950.20
af_P07510_246_353_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4237 1 106 1.20.58.390
af_A0A2R8RUL8_237_353_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.4137 2 106 1.20.58.390
af_Q98880_236_357_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.3915 1 99 1.20.58.390
ID Description Score Start End GO Terms
AF-A0A6A8MYU8-F1-model_v4 Lycopene cyclase domain-containing protein 0.8224 1 95 GO:0016020
GO:0016117
GO:0016872
GO:0045436
AF-A0A1M5L643-F1-model_v4 Lycopene cyclase domain-containing protein 0.8222 1 101 GO:0016020
GO:0016117
GO:0016872
GO:0045436
AF-A0A3D9ZY90-F1-model_v4 Lycopene cyclase domain-containing protein 0.8181 1 96 GO:0016020
GO:0016117
GO:0016872
GO:0045436
AF-A0A4Q7W4N5-F1-model_v4 deleted 0.8171 1 102
AF-A0A6V8KZ82-F1-model_v4 Lycopene cyclase domain-containing protein 0.8156 1 95 GO:0016020
GO:0016117
GO:0016872
GO:0045436

Map