F297577

General Info

Members Datasets Scaffolds Average Seq Length
193 140 188 290

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0024957|Ga0466967_0024957_3766_4800
Length 344
Sequence VRHHVLLSIAGIHRIQGGTAHYSGKCEQERLVEESRVPWTIVPVSAGRGLRMGFEGFRLAQLEVGEVSLRVRHGGCGPPLVLLHGYPQTHMMWGQVATELAEDFTVVVPDLRGYGDSTKPAAVPDHKSYSKRAMVGDVIGLMNHFGFDSFDVAGHDRGGRVAYRLALDHPQVVRRLSVLDIIPTAEVWARADQRFALGYWHWPLLAQPYPIPETLIAPDPEWFFFDAQFGGVMRSFQPEAVADYIRCARDGSVIHAICEDYRAGATYDRLLDEQDRAAGRKITCPTQVLWGAQGALAAWYDPLDIWRDWAYDVTGQALDSGHFLAEEKPHETLSALHRFHTDHR

Samples

Sample ID Description Type Environment
1 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
2 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
3 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
4 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
5 2920879853 Kocuria salina CV6 Isolate Unclassified
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
28 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
43 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
44 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
56 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
92 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
93 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
94 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
95 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
96 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
98 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
103 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
106 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
107 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
108 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
109 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
110 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
111 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
112 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
113 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
114 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
115 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
116 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
117 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
120 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
121 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
122 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
123 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
126 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
127 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
128 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
129 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
130 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
131 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
132 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
133 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
134 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
135 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
136 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
137 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
138 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
139 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
140 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0
Isolates 2.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.74
Nodule 0
Rhizoplane 1.04
Rhizosphere 77.72
Stem 0
Stem Tuber 0
Unclassified 14.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10028134 3300003203 Bacteria 2145
2 Ga0070658_10027205 3300005327 Bacteria 4591
3 Ga0070658_10139200 3300005327 Bacteria 2027
4 Ga0070689_100073298 3300005340 Bacteria 2677
5 Ga0070689_100221821 3300005340 Bacteria 1551
6 Ga0070687_100044466 3300005343 Bacteria 2262
7 Ga0070668_100009090 3300005347 Bacteria 7379
8 Ga0070669_100395940 3300005353 Bacteria 1129
9 Ga0070671_100021084 3300005355 Bacteria 5320
10 Ga0070667_100004986 3300005367 Bacteria 11127
11 Ga0070667_100384066 3300005367 Bacteria 1276
12 Ga0070709_10136727 3300005434 Bacteria 1679
13 Ga0070713_100138252 3300005436 Unclassified 2155
14 Ga0070694_100093114 3300005444 Bacteria 2118
15 Ga0070678_100335574 3300005456 Bacteria 1295
16 Ga0070685_10012616 3300005466 Bacteria 4443
17 Ga0070706_100075755 3300005467 Bacteria 3114
18 Ga0070707_100525889 3300005468 Bacteria 1145
19 Ga0070698_100082469 3300005471 Bacteria 3208
20 Ga0070699_100173703 3300005518 Bacteria 1910
21 Ga0070672_100359987 3300005543 Bacteria 1242
22 Ga0070665_100026050 3300005548 Bacteria 5889
23 Ga0068855_100063472 3300005563 Bacteria 4311
24 Ga0068855_100084997 3300005563 Bacteria 3662
25 Ga0068859_100006386 3300005617 Bacteria 11960
26 Ga0068864_100036914 3300005618 Bacteria 4167
27 Ga0068864_100182573 3300005618 Bacteria 1919
28 Ga0068861_100028260 3300005719 Bacteria 4092
29 Ga0068863_100040569 3300005841 Bacteria 4426
30 Ga0068863_100634374 3300005841 Bacteria 1059
31 Ga0068860_100000109 3300005843 Bacteria 132169
32 Ga0068860_100064829 3300005843 Bacteria 3469
33 Ga0068862_100003711 3300005844 Bacteria 13037
34 Ga0068862_100012855 3300005844 Bacteria 6924
35 Ga0081540_1018728 3300005983 Bacteria 4236
36 Ga0081539_10005158 3300005985 Bacteria 13590
37 Ga0075365_10039262 3300006038 Bacteria 3082
38 Ga0075365_10141417 3300006038 Bacteria 1670
39 Ga0075364_10015761 3300006051 Bacteria 4692
40 Ga0070715_10003656 3300006163 Bacteria 4939
41 Ga0070712_100132646 3300006175 Bacteria 1890
42 Ga0075428_100019485 3300006844 Bacteria 7508
43 Ga0075430_100015661 3300006846 Bacteria 6458
44 Ga0075430_100023496 3300006846 Bacteria 5248
45 Ga0075430_100169169 3300006846 Bacteria 1818
46 Ga0075431_100019887 3300006847 Bacteria 6855
47 Ga0075433_10161432 3300006852 Bacteria 1995
48 Ga0075434_100102687 3300006871 Bacteria 2867
49 Ga0075429_100025352 3300006880 Bacteria 5147
50 Ga0097620_100006386 3300006931 Bacteria 11960
51 Ga0075435_100142859 3300007076 Bacteria 2009
52 Ga0105240_10002243 3300009093 Bacteria 31398
53 Ga0105240_10028840 3300009093 Bacteria 7239
54 Ga0105240_10245187 3300009093 Bacteria 2075
55 Ga0111539_10124127 3300009094 Bacteria 3026
56 Ga0111539_11119089 3300009094 Bacteria 915
57 Ga0105247_10268581 3300009101 Bacteria 1172
58 Ga0114129_10000668 3300009147 Bacteria 43072
59 Ga0114129_10050080 3300009147 Bacteria 5868
60 Ga0105242_10062865 3300009176 Bacteria 3056
61 Ga0105238_10013241 3300009551 Bacteria 8322
62 Ga0105238_10111630 3300009551 Bacteria 2714
63 Ga0105238_10114442 3300009551 Bacteria 2677
64 Ga0105249_10225298 3300009553 Bacteria 1847
65 Ga0105249_10334251 3300009553 Bacteria 1530
66 Ga0163162_10325634 3300013306 Bacteria 1669
67 Ga0163163_10029704 3300014325 Bacteria 5261
68 Ga0213872_10141888 3300021361 Bacteria 1054
69 Ga0213874_10038286 3300021377 Bacteria 1423
70 Ga0213876_10001621 3300021384 Bacteria 13752
71 Ga0213876_10013714 3300021384 Bacteria 4294
72 Ga0213875_10009634 3300021388 Bacteria 4884
73 Ga0213875_10042705 3300021388 Bacteria 2129
74 Ga0213871_10000333 3300021441 Bacteria 6053
75 Ga0209257_1000791 3300025304 Bacteria 46307
76 Ga0207656_10019945 3300025321 Bacteria 2657
77 Ga0207685_10016236 3300025905 Bacteria 2379
78 Ga0207684_10339653 3300025910 Bacteria 1293
79 Ga0207707_10272069 3300025912 Bacteria 1468
80 Ga0207695_10000595 3300025913 Bacteria 72573
81 Ga0207695_10015012 3300025913 Bacteria 9138
82 Ga0207695_10022534 3300025913 Bacteria 7146
83 Ga0207695_10208296 3300025913 Bacteria 1867
84 Ga0207657_10190692 3300025919 Bacteria 1654
85 Ga0207681_10384413 3300025923 Bacteria 1130
86 Ga0207694_10003294 3300025924 Bacteria 12849
87 Ga0207694_10022473 3300025924 Bacteria 4785
88 Ga0207700_10047616 3300025928 Bacteria 3179
89 Ga0207644_10027756 3300025931 Bacteria 3913
90 Ga0207686_10084761 3300025934 Bacteria 2077
91 Ga0207670_10192994 3300025936 Bacteria 1542
92 Ga0207691_10310372 3300025940 Bacteria 1354
93 Ga0207679_10305564 3300025945 Bacteria 1373
94 Ga0207667_10043106 3300025949 Bacteria 4789
95 Ga0207667_10055307 3300025949 Bacteria 4172
96 Ga0207668_10004969 3300025972 Bacteria 7824
97 Ga0207668_10111473 3300025972 Bacteria 2054
98 Ga0207658_10024393 3300025986 Bacteria 4231
99 Ga0207703_10071298 3300026035 Bacteria 2870
100 Ga0207708_10082246 3300026075 Bacteria 2475
101 Ga0207641_10021340 3300026088 Bacteria 5323
102 Ga0207641_10495245 3300026088 Bacteria 1186
103 Ga0207676_10047317 3300026095 Bacteria 3333
104 Ga0207676_10180254 3300026095 Bacteria 1849
105 Ga0207675_100039218 3300026118 Bacteria 4421
106 Ga0207675_100071659 3300026118 Bacteria 3240
107 Ga0207683_10381061 3300026121 Bacteria 1296
108 Ga0207698_10429943 3300026142 Bacteria 1269
109 Ga0207428_10029740 3300027907 Bacteria 4523
110 Ga0268265_10004941 3300028380 Bacteria 9166
111 Ga0268265_10363167 3300028380 Bacteria 1326
112 Ga0268264_10000002 3300028381 Bacteria 1153045
113 Ga0268264_10017183 3300028381 Bacteria 5925
114 Ga0307511_10020097 3300030521 Bacteria 6335
115 Ga0265327_10001716 3300031251 Bacteria 26056
116 Ga0307513_10029056 3300031456 Bacteria 6309
117 Ga0316578_10087100 3300031728 Bacteria 1862
118 Ga0307410_10053284 3300031852 Bacteria 2737
119 Ga0307412_10458454 3300031911 Unclassified 1052
120 Ga0307409_100277383 3300031995 Unclassified 1547
121 Ga0307416_100094370 3300032002 Bacteria 2580
122 Ga0307416_100150711 3300032002 Bacteria 2132
123 Ga0373936_0001758 3300035113 Bacteria 7953
124 Ga0373931_0267774 3300035691 Bacteria 1045
125 Ga0316582_0083690 3300036647 Bacteria 2088
126 Ga0395899_0000260 3300037312 Bacteria 69458
127 Ga0395900_0000008 3300037418 Bacteria 480459
128 Ga0395900_0092690 3300037418 Bacteria 3104
129 Ga0395898_0008559 3300037466 Bacteria 10801
130 Ga0395905_0102437 3300037471 Bacteria 2687
131 Ga0436364_0353347 3300037853 Bacteria 8432
132 Ga0436364_0721884 3300037853 Bacteria 30178
133 Ga0436364_1016047 3300037853 Bacteria 2901
134 Ga0436364_1020802 3300037853 Bacteria 1298
135 Ga0395901_0000008 3300038443 Bacteria 495962
136 Ga0395901_0195856 3300038443 Bacteria 2119
137 Ga0436365_0211498 3300039437 Bacteria 2238
138 Ga0436365_0598388 3300039437 Bacteria 965
139 Ga0436365_0661566 3300039437 Bacteria 2091
140 Ga0436365_0710952 3300039437 Bacteria 17696
141 Ga0436365_1185201 3300039437 Bacteria 22930
142 Ga0436365_1391788 3300039437 Bacteria 11323
143 Ga0436360_0878399 3300039438 Bacteria 5665
144 Ga0436363_0650506 3300039450 Bacteria 1168
145 Ga0436363_0955331 3300039450 Bacteria 2492
146 Ga0436363_1269314 3300039450 Bacteria 2080
147 Ga0436363_1338275 3300039450 Bacteria 4355
148 Ga0436362_0216455 3300039453 Bacteria 1596
149 Ga0436362_1302284 3300039453 Bacteria 2070
150 Ga0439451_019791 3300042009 Bacteria 1356
151 Ga0439454_002681 3300042011 Bacteria 1907
152 Ga0466966_0006287 3300044684 Bacteria 7859
153 Ga0466963_0068826 3300044694 Bacteria 2378
154 Ga0466957_0127736 3300044842 Bacteria 1625
155 Ga0466959_0054076 3300045049 Bacteria 2934
156 Ga0466958_0098607 3300045836 Bacteria 1814
157 Ga0466967_0024957 3300045976 Bacteria 4922
158 Ga0466967_0076013 3300045976 Bacteria 3020
159 Ga0466967_0293687 3300045976 Bacteria 1562
160 Ga0495650_0019219 3300046471 Bacteria 3374
161 Ga0495645_0221957 3300046543 Bacteria 1271
162 Ga0496114_0466295 3300048917 Bacteria 1118
163 Ga0496115_0000497 3300048918 Bacteria 30999
164 Ga0496121_0002343 3300048924 Bacteria 29238
165 Ga0496126_0032624 3300048929 Bacteria 4905
166 Ga0501040_0039154 3300049576 Bacteria 3224
167 Ga0501047_0550389 3300049581 Unclassified 978
168 nmdc:mga00v17_29524_c1 3300050491 Bacteria 3219
169 nmdc:mga0k408_150358_c1 3300050493 Bacteria 1386
170 nmdc:mga06z11_7976_c1 3300050494 Bacteria 4388
171 nmdc:mga05p37_61423_c1 3300050507 Bacteria 4626
172 nmdc:mga05p37_641040_c1 3300050507 Bacteria 1192
173 nmdc:mga09592_201179_c1 3300050508 Bacteria 1725
174 nmdc:mga09592_20135_c1 3300050508 Bacteria 5484
175 nmdc:mga0qj67_12011_c1 3300050509 Bacteria 6508
176 nmdc:mga08y16_33877_c1 3300050511 Bacteria 5366
177 nmdc:mga0a205_179616_c1 3300050515 Bacteria 2011
178 nmdc:mga0a205_64590_c1 3300050515 Bacteria 3536
179 Ga0495655_0124606 3300053083 Bacteria 788
180 Ga0500641_0012447 3300053096 Bacteria 3107
181 Ga0500595_006707 3300053119 Bacteria 4857
182 Ga0500616_0004940 3300053153 Bacteria 9258
183 Ga0500616_0014093 3300053153 Bacteria 4608
184 Ga0500616_0074465 3300053153 Bacteria 1721
185 Ga0500622_0011603 3300053156 Bacteria 4793
186 Ga0501084_0412119 3300054114 Bacteria 1142
187 Ga0466962_0010571 3300061719 Bacteria 4438
188 Ga0530510_0237309 3300061734 Bacteria 1357

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0267774 Ga0373931_0267774_17_772 244
2 3300039450 Ga0436363_0650506 Ga0436363_0650506_238_987 244
3 3300039450 Ga0436363_1269314 Ga0436363_1269314_289_1083 244
4 3300053083 Ga0495655_0124606 Ga0495655_0124606_16_753 244
5 3300009094 Ga0111539_11119089 Ga0111539_111190891 247
6 iso_pu_bacteria 2920879853 2920880153 272
7 3300005843 Ga0068860_100000109 Ga0068860_10000010940 274
8 3300006163 Ga0070715_10003656 Ga0070715_100036567 274
9 3300025905 Ga0207685_10016236 Ga0207685_100162362 274
10 3300028381 Ga0268264_10000002 Ga0268264_10000002591 274
11 3300049581 Ga0501047_0550389 Ga0501047_0550389_30_926 274
12 3300061734 Ga0530510_0237309 Ga0530510_0237309_447_1307 274
13 3300005340 Ga0070689_100221821 Ga0070689_1002218212 275
14 3300009094 Ga0111539_10124127 Ga0111539_101241272 275
15 3300005347 Ga0070668_100009090 Ga0070668_1000090905 276
16 3300005719 Ga0068861_100028260 Ga0068861_1000282602 276
17 3300005844 Ga0068862_100012855 Ga0068862_1000128553 276
18 3300025972 Ga0207668_10004969 Ga0207668_100049693 276
19 3300028380 Ga0268265_10004941 Ga0268265_100049413 276
20 3300032002 Ga0307416_100094370 Ga0307416_1000943703 277
21 3300005618 Ga0068864_100182573 Ga0068864_1001825732 280
22 3300005841 Ga0068863_100634374 Ga0068863_1006343742 280
23 3300009101 Ga0105247_10268581 Ga0105247_102685811 280
24 3300009176 Ga0105242_10062865 Ga0105242_100628652 280
25 3300025934 Ga0207686_10084761 Ga0207686_100847612 280
26 3300026088 Ga0207641_10495245 Ga0207641_104952452 280
27 3300026095 Ga0207676_10180254 Ga0207676_101802542 280
28 iso_pu_bacteria 2643221598 2643998371 280
29 iso_pu_bacteria 2643221614 2644086770 280
30 iso_pu_bacteria 2643221661 2644341724 280
31 iso_pu_bacteria 2643221666 2644368011 280
32 3300009093 Ga0105240_10002243 Ga0105240_1000224325 281
33 3300014325 Ga0163163_10029704 Ga0163163_100297046 281
34 3300025304 Ga0209257_1000791 Ga0209257_100079111 281
35 3300025913 Ga0207695_10000595 Ga0207695_1000059547 281
36 3300025913 Ga0207695_10022534 Ga0207695_100225344 281
37 3300025919 Ga0207657_10190692 Ga0207657_101906922 281
38 3300005563 Ga0068855_100063472 Ga0068855_1000634724 282
39 3300005985 Ga0081539_10005158 Ga0081539_1000515815 282
40 3300006038 Ga0075365_10039262 Ga0075365_100392624 282
41 3300006051 Ga0075364_10015761 Ga0075364_100157614 282
42 3300006846 Ga0075430_100023496 Ga0075430_1000234962 282
43 3300009093 Ga0105240_10245187 Ga0105240_102451872 282
44 3300025913 Ga0207695_10208296 Ga0207695_102082962 282
45 3300025949 Ga0207667_10055307 Ga0207667_100553072 282
46 3300027907 Ga0207428_10029740 Ga0207428_100297404 282
47 3300037418 Ga0395900_0092690 Ga0395900_0092690_1132_2007 282
48 3300038443 Ga0395901_0195856 Ga0395901_0195856_552_1427 282
49 3300046543 Ga0495645_0221957 Ga0495645_0221957_323_1198 282
50 3300050491 nmdc:mga00v17_29524_c1 nmdc:mga00v17_29524_c1_921_1778 282
51 3300050508 nmdc:mga09592_20135_c1 nmdc:mga09592_20135_c1_799_1656 282
52 3300050511 nmdc:mga08y16_33877_c1 nmdc:mga08y16_33877_c1_3658_4515 282
53 3300053156 Ga0500622_0011603 Ga0500622_0011603_1572_2477 282
54 3300005340 Ga0070689_100073298 Ga0070689_1000732983 283
55 3300005343 Ga0070687_100044466 Ga0070687_1000444663 283
56 3300005367 Ga0070667_100384066 Ga0070667_1003840662 283
57 3300005434 Ga0070709_10136727 Ga0070709_101367271 283
58 3300005436 Ga0070713_100138252 Ga0070713_1001382523 283
59 3300005444 Ga0070694_100093114 Ga0070694_1000931142 283
60 3300005456 Ga0070678_100335574 Ga0070678_1003355742 283
61 3300005466 Ga0070685_10012616 Ga0070685_100126162 283
62 3300005467 Ga0070706_100075755 Ga0070706_1000757552 283
63 3300005468 Ga0070707_100525889 Ga0070707_1005258891 283
64 3300005471 Ga0070698_100082469 Ga0070698_1000824692 283
65 3300005518 Ga0070699_100173703 Ga0070699_1001737032 283
66 3300005543 Ga0070672_100359987 Ga0070672_1003599872 283
67 3300005563 Ga0068855_100084997 Ga0068855_1000849975 283
68 3300006175 Ga0070712_100132646 Ga0070712_1001326463 283
69 3300006844 Ga0075428_100019485 Ga0075428_1000194856 283
70 3300006846 Ga0075430_100015661 Ga0075430_1000156614 283
71 3300006846 Ga0075430_100169169 Ga0075430_1001691692 283
72 3300006847 Ga0075431_100019887 Ga0075431_1000198875 283
73 3300006852 Ga0075433_10161432 Ga0075433_101614322 283
74 3300006871 Ga0075434_100102687 Ga0075434_1001026872 283
75 3300006880 Ga0075429_100025352 Ga0075429_1000253522 283
76 3300007076 Ga0075435_100142859 Ga0075435_1001428592 283
77 3300009093 Ga0105240_10028840 Ga0105240_100288405 283
78 3300009147 Ga0114129_10000668 Ga0114129_1000066828 283
79 3300009147 Ga0114129_10050080 Ga0114129_100500805 283
80 3300009551 Ga0105238_10111630 Ga0105238_101116301 283
81 3300009553 Ga0105249_10225298 Ga0105249_102252982 283
82 3300013306 Ga0163162_10325634 Ga0163162_103256342 283
83 3300021361 Ga0213872_10141888 Ga0213872_101418881 283
84 3300021377 Ga0213874_10038286 Ga0213874_100382861 283
85 3300021384 Ga0213876_10001621 Ga0213876_100016219 283
86 3300021384 Ga0213876_10013714 Ga0213876_100137142 283
87 3300021388 Ga0213875_10009634 Ga0213875_100096345 283
88 3300021388 Ga0213875_10042705 Ga0213875_100427052 283
89 3300021441 Ga0213871_10000333 Ga0213871_100003333 283
90 3300025321 Ga0207656_10019945 Ga0207656_100199453 283
91 3300025910 Ga0207684_10339653 Ga0207684_103396532 283
92 3300025912 Ga0207707_10272069 Ga0207707_102720692 283
93 3300025913 Ga0207695_10015012 Ga0207695_100150124 283
94 3300025928 Ga0207700_10047616 Ga0207700_100476162 283
95 3300025936 Ga0207670_10192994 Ga0207670_101929942 283
96 3300025940 Ga0207691_10310372 Ga0207691_103103722 283
97 3300025949 Ga0207667_10043106 Ga0207667_100431063 283
98 3300025972 Ga0207668_10111473 Ga0207668_101114732 283
99 3300026075 Ga0207708_10082246 Ga0207708_100822462 283
100 3300026118 Ga0207675_100071659 Ga0207675_1000716591 283
101 3300026121 Ga0207683_10381061 Ga0207683_103810612 283
102 3300037853 Ga0436364_0353347 Ga0436364_0353347_7358_8254 283
103 3300037853 Ga0436364_0721884 Ga0436364_0721884_20195_21058 283
104 3300037853 Ga0436364_1020802 Ga0436364_1020802_311_1201 283
105 3300039437 Ga0436365_0211498 Ga0436365_0211498_1281_2180 283
106 3300039437 Ga0436365_0598388 Ga0436365_0598388_42_905 283
107 3300039437 Ga0436365_0661566 Ga0436365_0661566_972_1847 283
108 3300039437 Ga0436365_0710952 Ga0436365_0710952_386_1291 283
109 3300039437 Ga0436365_1185201 Ga0436365_1185201_3235_4092 283
110 3300039437 Ga0436365_1391788 Ga0436365_1391788_10296_11192 283
111 3300039438 Ga0436360_0878399 Ga0436360_0878399_909_1775 283
112 3300039450 Ga0436363_1338275 Ga0436363_1338275_3283_4173 283
113 3300039453 Ga0436362_0216455 Ga0436362_0216455_646_1509 283
114 3300039453 Ga0436362_1302284 Ga0436362_1302284_183_1043 283
115 3300042009 Ga0439451_019791 Ga0439451_019791_48_911 283
116 3300042011 Ga0439454_002681 Ga0439454_002681_734_1597 283
117 3300045976 Ga0466967_0076013 Ga0466967_0076013_809_1672 283
118 3300045976 Ga0466967_0293687 Ga0466967_0293687_264_1151 283
119 3300048918 Ga0496115_0000497 Ga0496115_0000497_17160_18020 283
120 3300050493 nmdc:mga0k408_150358_c1 nmdc:mga0k408_150358_c1_112_1011 283
121 3300050507 nmdc:mga05p37_61423_c1 nmdc:mga05p37_61423_c1_2915_3778 283
122 3300050507 nmdc:mga05p37_641040_c1 nmdc:mga05p37_641040_c1_200_1057 283
123 3300050508 nmdc:mga09592_201179_c1 nmdc:mga09592_201179_c1_417_1274 283
124 3300050509 nmdc:mga0qj67_12011_c1 nmdc:mga0qj67_12011_c1_2527_3441 283
125 3300050515 nmdc:mga0a205_179616_c1 nmdc:mga0a205_179616_c1_1115_1972 283
126 3300050515 nmdc:mga0a205_64590_c1 nmdc:mga0a205_64590_c1_2438_3301 283
127 3300053153 Ga0500616_0004940 Ga0500616_0004940_7913_8812 283
128 3300053153 Ga0500616_0014093 Ga0500616_0014093_2780_3679 283
129 3300053153 Ga0500616_0074465 Ga0500616_0074465_776_1675 283
130 3300003203 JGI25406J46586_10028134 JGI25406J46586_100281342 284
131 3300005327 Ga0070658_10027205 Ga0070658_100272053 284
132 3300005327 Ga0070658_10139200 Ga0070658_101392002 284
133 3300005353 Ga0070669_100395940 Ga0070669_1003959401 284
134 3300005355 Ga0070671_100021084 Ga0070671_1000210845 284
135 3300005367 Ga0070667_100004986 Ga0070667_1000049867 284
136 3300005548 Ga0070665_100026050 Ga0070665_1000260503 284
137 3300005617 Ga0068859_100006386 Ga0068859_10000638612 284
138 3300005618 Ga0068864_100036914 Ga0068864_1000369146 284
139 3300005841 Ga0068863_100040569 Ga0068863_1000405693 284
140 3300005843 Ga0068860_100064829 Ga0068860_1000648295 284
141 3300005844 Ga0068862_100003711 Ga0068862_1000037112 284
142 3300005983 Ga0081540_1018728 Ga0081540_10187283 284
143 3300006038 Ga0075365_10141417 Ga0075365_101414173 284
144 3300006931 Ga0097620_100006386 Ga0097620_1000063862 284
145 3300009551 Ga0105238_10013241 Ga0105238_100132419 284
146 3300009551 Ga0105238_10114442 Ga0105238_101144424 284
147 3300009553 Ga0105249_10334251 Ga0105249_103342512 284
148 3300025923 Ga0207681_10384413 Ga0207681_103844131 284
149 3300025924 Ga0207694_10003294 Ga0207694_100032949 284
150 3300025924 Ga0207694_10022473 Ga0207694_100224732 284
151 3300025931 Ga0207644_10027756 Ga0207644_100277566 284
152 3300025945 Ga0207679_10305564 Ga0207679_103055642 284
153 3300025986 Ga0207658_10024393 Ga0207658_100243932 284
154 3300026035 Ga0207703_10071298 Ga0207703_100712982 284
155 3300026088 Ga0207641_10021340 Ga0207641_100213403 284
156 3300026095 Ga0207676_10047317 Ga0207676_100473172 284
157 3300026118 Ga0207675_100039218 Ga0207675_1000392183 284
158 3300026142 Ga0207698_10429943 Ga0207698_104299432 284
159 3300028380 Ga0268265_10363167 Ga0268265_103631672 284
160 3300028381 Ga0268264_10017183 Ga0268264_100171836 284
161 3300030521 Ga0307511_10020097 Ga0307511_100200974 284
162 3300031251 Ga0265327_10001716 Ga0265327_1000171615 284
163 3300031456 Ga0307513_10029056 Ga0307513_100290563 284
164 3300031728 Ga0316578_10087100 Ga0316578_100871002 284
165 3300031852 Ga0307410_10053284 Ga0307410_100532842 284
166 3300031911 Ga0307412_10458454 Ga0307412_104584541 284
167 3300031995 Ga0307409_100277383 Ga0307409_1002773832 284
168 3300032002 Ga0307416_100150711 Ga0307416_1001507112 284
169 3300035113 Ga0373936_0001758 Ga0373936_0001758_4254_5147 284
170 3300036647 Ga0316582_0083690 Ga0316582_0083690_92_1027 284
171 3300037312 Ga0395899_0000260 Ga0395899_0000260_68113_68985 284
172 3300037418 Ga0395900_0000008 Ga0395900_0000008_316066_316938 284
173 3300037466 Ga0395898_0008559 Ga0395898_0008559_5138_6010 284
174 3300037471 Ga0395905_0102437 Ga0395905_0102437_558_1430 284
175 3300037853 Ga0436364_1016047 Ga0436364_1016047_182_1057 284
176 3300038443 Ga0395901_0000008 Ga0395901_0000008_163522_164394 284
177 3300039450 Ga0436363_0955331 Ga0436363_0955331_25_903 284
178 3300044684 Ga0466966_0006287 Ga0466966_0006287_902_1783 284
179 3300044694 Ga0466963_0068826 Ga0466963_0068826_597_1478 284
180 3300044842 Ga0466957_0127736 Ga0466957_0127736_490_1371 284
181 3300045049 Ga0466959_0054076 Ga0466959_0054076_2040_2921 284
182 3300045836 Ga0466958_0098607 Ga0466958_0098607_464_1345 284
183 3300045976 Ga0466967_0024957 Ga0466967_0024957_3766_4800 284
184 3300046471 Ga0495650_0019219 Ga0495650_0019219_1273_2148 284
185 3300048917 Ga0496114_0466295 Ga0496114_0466295_33_890 284
186 3300048924 Ga0496121_0002343 Ga0496121_0002343_27982_28884 284
187 3300048929 Ga0496126_0032624 Ga0496126_0032624_2838_3746 284
188 3300049576 Ga0501040_0039154 Ga0501040_0039154_483_1361 284
189 3300050494 nmdc:mga06z11_7976_c1 nmdc:mga06z11_7976_c1_2988_3893 284
190 3300053096 Ga0500641_0012447 Ga0500641_0012447_364_1230 284
191 3300053119 Ga0500595_006707 Ga0500595_006707_3261_4145 284
192 3300054114 Ga0501084_0412119 Ga0501084_0412119_36_902 284
193 3300061719 Ga0466962_0010571 Ga0466962_0010571_2760_3641 284

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

78

205

0.96

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

80

335

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
5swn-assembly1.cif.gz_A crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/fluoroacetate - cocrystallized 0.9739 1 281
3r3z-assembly1.cif.gz_A crystal structure of the fluoroacetate dehalogenase rpa1163 - wt/glycolate 0.972 1 282
3qyj-assembly1.cif.gz_A crystal structure of alr0039, a putative alpha/beta hydrolase from nostoc sp pcc 7120. 0.9716 6 281
5t4t-assembly1.cif.gz_B crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide 0.9708 1 282
6qkw-assembly1.cif.gz_A crystal structure of the fluoroacetate dehalogenase rpa1163 - tyr219phe - fluoroacetate soaked 2hr 0.9706 1 281
ID Description Score Start End Superfamily
3b12A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9678 4 281 3.40.50.1820
3b12A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.951 4 281 3.40.50.1820
4bb0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9359 1 281 3.40.50.1820
4nvrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9296 2 281 3.40.50.1820
4bb0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9295 1 281 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0Q5WVA5-F1-model_v4 Alpha/beta hydrolase 0.9786 9 281 GO:0016787
AF-A0A0S8D6V7-F1-model_v4 AB hydrolase-1 domain-containing protein 0.9755 87 282
AF-A0A849TL76-F1-model_v4 Alpha/beta hydrolase 0.9747 42 280 GO:0016787
AF-A0A5R2N4R4-F1-model_v4 Alpha/beta fold hydrolase 0.974 11 127 GO:0016020
GO:0016787
AF-A0A552F0S2-F1-model_v4 Alpha/beta hydrolase 0.9732 3 282 GO:0016787

Feature Viewer

pLDDT pTM Quality
96.02 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map