F297033

General Info

Members Datasets Scaffolds Average Seq Length
193 109 193 360

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100043092|Ga0075429_1000430922
Length 392
Sequence LKIEPARLSAPSCFIIPPMLSFETLIRFAVFTLGLLAVILTLSSAIATFVLPRAARSQLNRIVFGLLRRVIGFLLRFAKSYNRRDSIMAYYGPLGMLLLLPAWYLLILLGYAAMYWALGAGDLFDVFRLSGSSLFTLGFELSKTPVVTALAFSEAMLGLMLVGLLIAYLPTMYSAFARREQVVNLLEVRAGSPPSALEMLLRFHRNHGLDKLSDYWKTWEAWFADVEESHTTLPALIFFRSPRAENSWVTAAGTVLDAASITLSSIEIPYEVSAALCIRAGFLAFRRIANYFDLPTPQDPHYPSTQICVARHEFDEVLDQLTAAGLPVKADREQAWKDFAGWRVNYDRALILLCGLVMAPPATWSSDRLSPFVLPPLMIFNKRKLLEKQENL

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
22 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
23 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
35 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
36 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
37 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
40 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
41 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
53 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
54 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
55 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
56 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
57 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
58 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
59 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
65 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
66 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
72 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
73 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
74 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
75 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
76 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
77 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
80 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
81 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
84 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
85 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
86 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
87 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
88 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
89 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
90 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
91 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
92 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
93 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
94 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
97 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
98 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
99 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
104 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
105 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
106 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
107 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
108 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
109 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 3.11
Rhizosphere 95.85
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2512913 2162886006 Unclassified 4527
2 SwRhRL2b_contig_2474596 2162886007 Bacteria 5119
3 Ga0065704_10000758 3300005289 Bacteria 19872
4 Ga0065704_10108663 3300005289 Bacteria 2023
5 Ga0065707_10000645 3300005295 Bacteria 23027
6 Ga0065707_10085031 3300005295 Bacteria 6518
7 Ga0065707_10095292 3300005295 Bacteria 3389
8 Ga0070674_100023204 3300005356 Bacteria 4012
9 Ga0070705_100099352 3300005440 Bacteria 1834
10 Ga0070705_100105087 3300005440 Bacteria 1792
11 Ga0070708_100013808 3300005445 Bacteria 6630
12 Ga0068867_100244376 3300005459 Bacteria 1457
13 Ga0070706_100015805 3300005467 Bacteria 6969
14 Ga0070706_100050408 3300005467 Bacteria 3842
15 Ga0070706_100076371 3300005467 Bacteria 3100
16 Ga0070707_100016414 3300005468 Bacteria 6947
17 Ga0070707_100224709 3300005468 Bacteria 1828
18 Ga0070698_100043606 3300005471 Bacteria 4598
19 Ga0070699_100033892 3300005518 Unclassified 4412
20 Ga0070697_100220424 3300005536 Unclassified 1617
21 Ga0070695_100126131 3300005545 Bacteria 1758
22 Ga0070696_100020134 3300005546 Bacteria 4524
23 Ga0070704_100188588 3300005549 Bacteria 1655
24 Ga0070704_100257349 3300005549 Bacteria 1436
25 Ga0068855_100238745 3300005563 Bacteria 2032
26 Ga0068854_100218123 3300005578 Unclassified 1508
27 Ga0068859_100046995 3300005617 Bacteria 4335
28 Ga0068859_100361202 3300005617 Bacteria 1547
29 Ga0068870_10078866 3300005840 Unclassified 1815
30 Ga0068862_100042034 3300005844 Bacteria 3891
31 Ga0068862_100140817 3300005844 Unclassified 2141
32 Ga0081539_10008035 3300005985 Bacteria 9348
33 Ga0081539_10008422 3300005985 Bacteria 8998
34 Ga0081539_10019380 3300005985 Bacteria 4660
35 Ga0070717_10012796 3300006028 Bacteria 6406
36 Ga0075428_100014223 3300006844 Bacteria 8852
37 Ga0075430_100022519 3300006846 Bacteria 5362
38 Ga0075431_100011518 3300006847 Bacteria 8919
39 Ga0075431_100045603 3300006847 Bacteria 4520
40 Ga0075431_100108499 3300006847 Bacteria 2865
41 Ga0075433_10135100 3300006852 Unclassified 2192
42 Ga0075429_100005893 3300006880 Bacteria 10577
43 Ga0075429_100043092 3300006880 Bacteria 3927
44 Ga0075429_100086370 3300006880 Unclassified 2734
45 Ga0097620_100046996 3300006931 Bacteria 4335
46 Ga0097620_100361210 3300006931 Bacteria 1547
47 Ga0111539_10025472 3300009094 Bacteria 7253
48 Ga0111539_10414270 3300009094 Bacteria 1569
49 Ga0105245_10001008 3300009098 Bacteria 25583
50 Ga0114129_10010727 3300009147 Bacteria 13063
51 Ga0114129_10019056 3300009147 Bacteria 9775
52 Ga0114129_10019894 3300009147 Bacteria 9554
53 Ga0114129_10022249 3300009147 Bacteria 9000
54 Ga0114129_10028626 3300009147 Bacteria 7894
55 Ga0114129_10066511 3300009147 Bacteria 5028
56 Ga0114129_10100300 3300009147 Bacteria 4006
57 Ga0114129_10173098 3300009147 Unclassified 2942
58 Ga0114129_10219524 3300009147 Bacteria 2565
59 Ga0114129_10231930 3300009147 Bacteria 2486
60 Ga0105243_10002890 3300009148 Bacteria 14235
61 Ga0105243_10008165 3300009148 Bacteria 8039
62 Ga0105242_10021388 3300009176 Bacteria 5078
63 Ga0105242_10116030 3300009176 Bacteria 2290
64 Ga0105248_10151495 3300009177 Bacteria 2616
65 Ga0105246_10169831 3300011119 Bacteria 1669
66 Ga0157378_10004015 3300013297 Bacteria 13000
67 Ga0157378_10165739 3300013297 Bacteria 2070
68 Ga0157375_10072738 3300013308 Bacteria 3455
69 Ga0157380_10159022 3300014326 Bacteria 1962
70 Ga0157379_10104128 3300014968 Bacteria 2547
71 Ga0207684_10064408 3300025910 Bacteria 3112
72 Ga0207684_10083208 3300025910 Bacteria 2725
73 Ga0207662_10016068 3300025918 Bacteria 4219
74 Ga0207646_10002398 3300025922 Bacteria 22110
75 Ga0207687_10004228 3300025927 Bacteria 9599
76 Ga0207706_10235551 3300025933 Bacteria 1601
77 Ga0207686_10087007 3300025934 Bacteria 2054
78 Ga0207709_10025198 3300025935 Bacteria 3404
79 Ga0207640_10077967 3300025981 Bacteria 2254
80 Ga0207708_10062990 3300026075 Bacteria 2833
81 Ga0207648_10019538 3300026089 Bacteria 6115
82 Ga0207675_100033967 3300026118 Bacteria 4753
83 Ga0265319_1001213 3300028563 Bacteria 15907
84 Ga0265334_10008086 3300028573 Bacteria 4485
85 Ga0265336_10002467 3300028666 Bacteria 7597
86 Ga0265336_10005681 3300028666 Bacteria 4575
87 Ga0265338_10045858 3300028800 Bacteria 4014
88 Ga0265338_10153001 3300028800 Unclassified 1790
89 Ga0265324_10017424 3300029957 Bacteria 2612
90 Ga0265332_10089466 3300031238 Bacteria 1303
91 Ga0265328_10081481 3300031239 Bacteria 1193
92 Ga0265320_10005877 3300031240 Bacteria 7811
93 Ga0265329_10006336 3300031242 Bacteria 4702
94 Ga0265340_10001704 3300031247 Bacteria 12618
95 Ga0265340_10016062 3300031247 Bacteria 3881
96 Ga0265339_10109377 3300031249 Bacteria 1431
97 Ga0265316_10037284 3300031344 Bacteria 3926
98 Ga0307408_100088364 3300031548 Unclassified 2334
99 Ga0316575_10021535 3300031665 Bacteria 2482
100 Ga0316575_10047283 3300031665 Bacteria 1710
101 Ga0316579_10017800 3300031691 Unclassified 3120
102 Ga0265314_10059716 3300031711 Bacteria 2607
103 Ga0316576_10022744 3300031727 Bacteria 4357
104 Ga0316576_10029492 3300031727 Unclassified 3879
105 Ga0316576_10051797 3300031727 Bacteria 2988
106 Ga0316576_10171274 3300031727 Bacteria 1639
107 Ga0316578_10091450 3300031728 Bacteria 1817
108 Ga0307405_10074855 3300031731 Bacteria 2191
109 Ga0316577_10003242 3300031733 Bacteria 8184
110 Ga0307407_10022058 3300031903 Bacteria 3296
111 Ga0307412_10066363 3300031911 Bacteria 2446
112 Ga0307416_100023958 3300032002 Bacteria 4443
113 Ga0307416_100094714 3300032002 Bacteria 2576
114 Ga0307416_100455351 3300032002 Bacteria 1333
115 Ga0307415_100006637 3300032126 Bacteria 6262
116 Ga0307415_100171477 3300032126 Bacteria 1692
117 Ga0316583_10049766 3300032133 Bacteria 1476
118 Ga0316585_10003421 3300032137 Bacteria 4371
119 Ga0316580_10018736 3300032139 Bacteria 2131
120 Ga0316580_10021874 3300032139 Bacteria 1973
121 Ga0316574_0002191 3300035398 Bacteria 9694
122 Ga0316574_0062293 3300035398 Bacteria 2344
123 Ga0316574_0064016 3300035398 Bacteria 2313
124 Ga0316582_0004597 3300036647 Bacteria 6993
125 Ga0316582_0028363 3300036647 Unclassified 3391
126 Ga0316582_0129400 3300036647 Bacteria 1694
127 Ga0316584_0004181 3300036712 Bacteria 9533
128 Ga0316584_0043857 3300036712 Bacteria 3335
129 Ga0316584_0256393 3300036712 Bacteria 1276
130 Ga0395899_0238710 3300037312 Bacteria 1252
131 Ga0400490_33143 3300038726 Bacteria 1960
132 Ga0439466_0031765 3300041411 Bacteria 1804
133 Ga0451577_0001808 3300042876 Bacteria 27367
134 Ga0451577_0127558 3300042876 Bacteria 2280
135 Ga0451577_0183857 3300042876 Bacteria 1885
136 Ga0466969_0110245 3300044656 Unclassified 1289
137 Ga0453683_0000747 3300044673 Bacteria 32801
138 Ga0453683_0023044 3300044673 Unclassified 3968
139 Ga0453683_0074775 3300044673 Unclassified 2121
140 Ga0453683_0229380 3300044673 Unclassified 1182
141 Ga0466963_0125838 3300044694 Bacteria 1767
142 Ga0453684_0000627 3300044712 Bacteria 128570
143 Ga0453684_0004360 3300044712 Bacteria 30021
144 Ga0453684_0008588 3300044712 Bacteria 18220
145 Ga0453684_0011202 3300044712 Bacteria 15097
146 Ga0453684_0024006 3300044712 Bacteria 8938
147 Ga0453684_0056805 3300044712 Bacteria 5074
148 Ga0453684_0096802 3300044712 Bacteria 3624
149 Ga0453684_0101565 3300044712 Unclassified 3518
150 Ga0453684_0119456 3300044712 Unclassified 3186
151 Ga0453684_0122789 3300044712 Bacteria 3132
152 Ga0453684_0124241 3300044712 Unclassified 3109
153 Ga0453684_0125375 3300044712 Bacteria 3092
154 Ga0453684_0140093 3300044712 Bacteria 2890
155 Ga0453684_0156690 3300044712 Bacteria 2699
156 Ga0453684_0210553 3300044712 Bacteria 2260
157 Ga0453684_0624223 3300044712 Bacteria 1179
158 Ga0466968_0029439 3300044735 Bacteria 2271
159 Ga0466960_0102560 3300044901 Bacteria 1476
160 Ga0466959_0002368 3300045049 Bacteria 12023
161 Ga0451576_0014889 3300045051 Bacteria 8641
162 Ga0451576_0023183 3300045051 Bacteria 6725
163 Ga0451576_0170677 3300045051 Bacteria 2270
164 Ga0451576_0183136 3300045051 Bacteria 2187
165 Ga0451576_0314420 3300045051 Bacteria 1639
166 Ga0451576_0355959 3300045051 Bacteria 1533
167 Ga0451576_0457239 3300045051 Unclassified 1340
168 Ga0466958_0024539 3300045836 Bacteria 3548
169 Ga0495676_0003534 3300047321 Bacteria 14161
170 Ga0496100_0067131 3300048903 Bacteria 2381
171 Ga0496101_0021704 3300048904 Bacteria 4413
172 Ga0496105_0002255 3300048908 Bacteria 13974
173 Ga0496107_0089974 3300048910 Bacteria 2242
174 Ga0496109_0314748 3300048912 Unclassified 1477
175 Ga0496111_0130097 3300048914 Bacteria 1862
176 Ga0501034_0274842 3300049571 Bacteria 1625
177 Ga0501080_0140819 3300049742 Bacteria 2230
178 Ga0501045_0303333 3300049824 Bacteria 1189
179 nmdc:mga0yw44_207775_c1 3300050492 Unclassified 1294
180 nmdc:mga05p37_10017_c1 3300050507 Bacteria 11250
181 nmdc:mga05p37_11265_c1 3300050507 Bacteria 10635
182 nmdc:mga05p37_204283_c1 3300050507 Bacteria 2391
183 nmdc:mga05p37_20432_c1 3300050507 Bacteria 8010
184 nmdc:mga05p37_24165_c1 3300050507 Bacteria 7383
185 nmdc:mga05p37_262481_c1 3300050507 Unclassified 2066
186 nmdc:mga05p37_567153_c1 3300050507 Unclassified 1289
187 nmdc:mga05p37_94679_c1 3300050507 Bacteria 3679
188 nmdc:mga05p37_9917_c1 3300050507 Bacteria 11303
189 nmdc:mga09592_16265_c1 3300050508 Bacteria 6081
190 nmdc:mga09592_168199_c1 3300050508 Unclassified 1895
191 nmdc:mga06r32_184913_c1 3300050510 Bacteria 2070
192 nmdc:mga06r32_88368_c1 3300050510 Bacteria 3025
193 nmdc:mga0a205_166638_c1 3300050515 Unclassified 2099

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005468 Ga0070707_100224709 Ga0070707_1002247092 319
2 3300037312 Ga0395899_0238710 Ga0395899_0238710_125_1099 320
3 3300044712 Ga0453684_0119456 Ga0453684_0119456_1387_2442 322
4 3300009147 Ga0114129_10022249 Ga0114129_100222495 323
5 3300045051 Ga0451576_0355959 Ga0451576_0355959_10_1002 323
6 3300050507 nmdc:mga05p37_24165_c1 nmdc:mga05p37_24165_c1_772_1842 323
7 3300049571 Ga0501034_0274842 Ga0501034_0274842_265_1380 326
8 3300050507 nmdc:mga05p37_567153_c1 nmdc:mga05p37_567153_c1_26_1006 326
9 3300044901 Ga0466960_0102560 Ga0466960_0102560_248_1327 327
10 3300005440 Ga0070705_100105087 Ga0070705_1001050872 328
11 3300044673 Ga0453683_0023044 Ga0453683_0023044_21_1028 329
12 3300038726 Ga0400490_33143 Ga0400490_33143_709_1818 330
13 3300009094 Ga0111539_10414270 Ga0111539_104142702 333
14 3300005467 Ga0070706_100076371 Ga0070706_1000763713 335
15 3300025910 Ga0207684_10064408 Ga0207684_100644082 335
16 3300049742 Ga0501080_0140819 Ga0501080_0140819_826_1941 335
17 3300044712 Ga0453684_0056805 Ga0453684_0056805_1994_3073 337
18 3300049824 Ga0501045_0303333 Ga0501045_0303333_16_1086 337
19 3300044712 Ga0453684_0210553 Ga0453684_0210553_961_2070 338
20 3300031665 Ga0316575_10021535 Ga0316575_100215352 339
21 3300031691 Ga0316579_10017800 Ga0316579_100178002 339
22 3300031727 Ga0316576_10029492 Ga0316576_100294924 339
23 3300031728 Ga0316578_10091450 Ga0316578_100914502 339
24 3300031733 Ga0316577_10003242 Ga0316577_100032424 339
25 3300032137 Ga0316585_10003421 Ga0316585_100034214 339
26 3300035398 Ga0316574_0002191 Ga0316574_0002191_4454_5533 339
27 3300036647 Ga0316582_0004597 Ga0316582_0004597_4957_6036 339
28 3300036712 Ga0316584_0004181 Ga0316584_0004181_3076_4155 339
29 3300005467 Ga0070706_100050408 Ga0070706_1000504083 340
30 3300035398 Ga0316574_0064016 Ga0316574_0064016_104_1141 340
31 3300044673 Ga0453683_0074775 Ga0453683_0074775_780_1892 341
32 3300044712 Ga0453684_0125375 Ga0453684_0125375_513_1625 341
33 3300045051 Ga0451576_0314420 Ga0451576_0314420_87_1199 341
34 3300006847 Ga0075431_100108499 Ga0075431_1001084992 342
35 3300009147 Ga0114129_10010727 Ga0114129_100107277 342
36 3300009147 Ga0114129_10028626 Ga0114129_100286262 342
37 3300050507 nmdc:mga05p37_11265_c1 nmdc:mga05p37_11265_c1_6206_7297 342
38 3300050507 nmdc:mga05p37_94679_c1 nmdc:mga05p37_94679_c1_1611_2816 342
39 3300050510 nmdc:mga06r32_88368_c1 nmdc:mga06r32_88368_c1_701_1906 342
40 3300005445 Ga0070708_100013808 Ga0070708_1000138087 343
41 3300005467 Ga0070706_100015805 Ga0070706_1000158057 343
42 3300005468 Ga0070707_100016414 Ga0070707_1000164147 343
43 3300005471 Ga0070698_100043606 Ga0070698_1000436063 343
44 3300005536 Ga0070697_100220424 Ga0070697_1002204241 343
45 3300006028 Ga0070717_10012796 Ga0070717_100127967 343
46 3300025910 Ga0207684_10083208 Ga0207684_100832083 343
47 3300025922 Ga0207646_10002398 Ga0207646_1000239818 343
48 3300044656 Ga0466969_0110245 Ga0466969_0110245_29_1180 343
49 3300044735 Ga0466968_0029439 Ga0466968_0029439_28_1167 343
50 3300005546 Ga0070696_100020134 Ga0070696_1000201343 345
51 3300005549 Ga0070704_100257349 Ga0070704_1002573491 345
52 3300009176 Ga0105242_10116030 Ga0105242_101160302 345
53 3300013297 Ga0157378_10165739 Ga0157378_101657392 345
54 3300025934 Ga0207686_10087007 Ga0207686_100870072 345
55 3300031727 Ga0316576_10022744 Ga0316576_100227444 345
56 3300032133 Ga0316583_10049766 Ga0316583_100497661 345
57 3300032139 Ga0316580_10018736 Ga0316580_100187362 345
58 3300035398 Ga0316574_0062293 Ga0316574_0062293_834_1940 345
59 3300036647 Ga0316582_0028363 Ga0316582_0028363_1800_2906 345
60 3300042876 Ga0451577_0183857 Ga0451577_0183857_535_1575 345
61 3300044712 Ga0453684_0096802 Ga0453684_0096802_2336_3376 345
62 3300048910 Ga0496107_0089974 Ga0496107_0089974_568_1734 345
63 3300044673 Ga0453683_0000747 Ga0453683_0000747_11567_12682 347
64 3300044694 Ga0466963_0125838 Ga0466963_0125838_385_1506 347
65 3300045051 Ga0451576_0170677 Ga0451576_0170677_866_1981 347
66 3300045836 Ga0466958_0024539 Ga0466958_0024539_822_1943 347
67 3300031665 Ga0316575_10047283 Ga0316575_100472832 350
68 3300036712 Ga0316584_0043857 Ga0316584_0043857_999_2105 350
69 3300044712 Ga0453684_0008588 Ga0453684_0008588_3732_4793 350
70 3300032139 Ga0316580_10021874 Ga0316580_100218741 351
71 3300036647 Ga0316582_0129400 Ga0316582_0129400_244_1365 351
72 3300044712 Ga0453684_0011202 Ga0453684_0011202_1585_2658 354
73 3300045049 Ga0466959_0002368 Ga0466959_0002368_10758_11855 354
74 3300005985 Ga0081539_10008035 Ga0081539_100080355 355
75 3300031249 Ga0265339_10109377 Ga0265339_101093772 355
76 3300005840 Ga0068870_10078866 Ga0068870_100788662 356
77 3300028666 Ga0265336_10005681 Ga0265336_100056813 356
78 3300028800 Ga0265338_10153001 Ga0265338_101530012 356
79 3300050507 nmdc:mga05p37_262481_c1 nmdc:mga05p37_262481_c1_869_1945 356
80 3300028563 Ga0265319_1001213 Ga0265319_10012133 357
81 3300028573 Ga0265334_10008086 Ga0265334_100080865 357
82 3300028666 Ga0265336_10002467 Ga0265336_100024673 357
83 3300028800 Ga0265338_10045858 Ga0265338_100458582 357
84 3300029957 Ga0265324_10017424 Ga0265324_100174243 357
85 3300031238 Ga0265332_10089466 Ga0265332_100894661 357
86 3300031239 Ga0265328_10081481 Ga0265328_100814811 357
87 3300031240 Ga0265320_10005877 Ga0265320_100058776 357
88 3300031242 Ga0265329_10006336 Ga0265329_100063364 357
89 3300031247 Ga0265340_10001704 Ga0265340_100017045 357
90 3300031247 Ga0265340_10016062 Ga0265340_100160622 357
91 3300031344 Ga0265316_10037284 Ga0265316_100372844 357
92 3300031711 Ga0265314_10059716 Ga0265314_100597163 357
93 3300031727 Ga0316576_10171274 Ga0316576_101712742 358
94 3300009147 Ga0114129_10231930 Ga0114129_102319302 360
95 3300031727 Ga0316576_10051797 Ga0316576_100517973 360
96 3300036712 Ga0316584_0256393 Ga0316584_0256393_44_1159 360
97 3300044673 Ga0453683_0229380 Ga0453683_0229380_25_1131 360
98 3300045051 Ga0451576_0183136 Ga0451576_0183136_731_1831 360
99 3300005844 Ga0068862_100140817 Ga0068862_1001408172 361
100 3300005985 Ga0081539_10019380 Ga0081539_100193803 361
101 3300042876 Ga0451577_0001808 Ga0451577_0001808_25426_26574 361
102 3300044712 Ga0453684_0000627 Ga0453684_0000627_98116_99210 361
103 3300044712 Ga0453684_0004360 Ga0453684_0004360_15163_16311 361
104 3300005356 Ga0070674_100023204 Ga0070674_1000232043 362
105 3300005578 Ga0068854_100218123 Ga0068854_1002181232 362
106 3300009148 Ga0105243_10002890 Ga0105243_1000289011 362
107 3300009176 Ga0105242_10021388 Ga0105242_100213886 362
108 3300009177 Ga0105248_10151495 Ga0105248_101514953 362
109 3300013297 Ga0157378_10004015 Ga0157378_100040158 362
110 3300013308 Ga0157375_10072738 Ga0157375_100727384 362
111 3300014968 Ga0157379_10104128 Ga0157379_101041283 362
112 3300025918 Ga0207662_10016068 Ga0207662_100160684 362
113 3300025933 Ga0207706_10235551 Ga0207706_102355512 362
114 3300025935 Ga0207709_10025198 Ga0207709_100251983 362
115 3300025981 Ga0207640_10077967 Ga0207640_100779672 362
116 3300026075 Ga0207708_10062990 Ga0207708_100629902 362
117 3300026089 Ga0207648_10019538 Ga0207648_100195386 362
118 3300048903 Ga0496100_0067131 Ga0496100_0067131_1224_2315 362
119 3300048904 Ga0496101_0021704 Ga0496101_0021704_968_2059 362
120 3300048908 Ga0496105_0002255 Ga0496105_0002255_9742_10833 362
121 3300048912 Ga0496109_0314748 Ga0496109_0314748_245_1336 362
122 3300048914 Ga0496111_0130097 Ga0496111_0130097_121_1212 362
123 3300042876 Ga0451577_0127558 Ga0451577_0127558_465_1556 363
124 3300045051 Ga0451576_0023183 Ga0451576_0023183_5151_6242 363
125 3300011119 Ga0105246_10169831 Ga0105246_101698312 364
126 3300032002 Ga0307416_100023958 Ga0307416_1000239583 364
127 3300032126 Ga0307415_100006637 Ga0307415_1000066376 364
128 3300005459 Ga0068867_100244376 Ga0068867_1002443762 365
129 3300005563 Ga0068855_100238745 Ga0068855_1002387452 366
130 3300005617 Ga0068859_100361202 Ga0068859_1003612022 367
131 3300006931 Ga0097620_100361210 Ga0097620_1003612102 367
132 3300041411 Ga0439466_0031765 Ga0439466_0031765_155_1261 367
133 3300044712 Ga0453684_0140093 Ga0453684_0140093_1771_2874 367
134 3300005518 Ga0070699_100033892 Ga0070699_1000338922 368
135 3300006844 Ga0075428_100014223 Ga0075428_1000142235 368
136 3300006846 Ga0075430_100022519 Ga0075430_1000225193 368
137 3300006847 Ga0075431_100045603 Ga0075431_1000456034 368
138 3300006880 Ga0075429_100005893 Ga0075429_1000058937 368
139 3300009094 Ga0111539_10025472 Ga0111539_100254727 368
140 3300009147 Ga0114129_10019894 Ga0114129_100198947 368
141 3300009147 Ga0114129_10173098 Ga0114129_101730983 368
142 3300044712 Ga0453684_0156690 Ga0453684_0156690_93_1199 368
143 3300050507 nmdc:mga05p37_20432_c1 nmdc:mga05p37_20432_c1_4563_5678 368
144 3300050508 nmdc:mga09592_16265_c1 nmdc:mga09592_16265_c1_1583_2698 368
145 3300050510 nmdc:mga06r32_184913_c1 nmdc:mga06r32_184913_c1_924_2039 368
146 3300005295 Ga0065707_10095292 Ga0065707_100952922 369
147 3300006880 Ga0075429_100086370 Ga0075429_1000863702 369
148 3300009098 Ga0105245_10001008 Ga0105245_1000100815 369
149 3300009147 Ga0114129_10219524 Ga0114129_102195241 369
150 3300025927 Ga0207687_10004228 Ga0207687_100042289 369
151 3300026118 Ga0207675_100033967 Ga0207675_1000339677 369
152 3300031548 Ga0307408_100088364 Ga0307408_1000883643 369
153 3300031731 Ga0307405_10074855 Ga0307405_100748552 369
154 3300031903 Ga0307407_10022058 Ga0307407_100220583 369
155 3300031911 Ga0307412_10066363 Ga0307412_100663631 369
156 3300032002 Ga0307416_100094714 Ga0307416_1000947142 369
157 3300032002 Ga0307416_100455351 Ga0307416_1004553512 369
158 3300032126 Ga0307415_100171477 Ga0307415_1001714772 369
159 3300047321 Ga0495676_0003534 Ga0495676_0003534_4185_5351 369
160 3300050507 nmdc:mga05p37_10017_c1 nmdc:mga05p37_10017_c1_3404_4522 369
161 3300014326 Ga0157380_10159022 Ga0157380_101590221 370
162 3300050492 nmdc:mga0yw44_207775_c1 nmdc:mga0yw44_207775_c1_11_1150 370
163 2162886006 SwRhRL3b_contig_2512913 SwRhRL3b_0791.00001150 371
164 2162886007 SwRhRL2b_contig_2474596 SwRhRL2b_0663.00000900 371
165 3300005289 Ga0065704_10000758 Ga0065704_100007587 371
166 3300005289 Ga0065704_10108663 Ga0065704_101086631 371
167 3300005295 Ga0065707_10000645 Ga0065707_100006455 371
168 3300005295 Ga0065707_10085031 Ga0065707_100850311 371
169 3300005440 Ga0070705_100099352 Ga0070705_1000993521 371
170 3300005545 Ga0070695_100126131 Ga0070695_1001261311 371
171 3300005549 Ga0070704_100188588 Ga0070704_1001885881 371
172 3300005617 Ga0068859_100046995 Ga0068859_1000469953 371
173 3300005844 Ga0068862_100042034 Ga0068862_1000420344 371
174 3300005985 Ga0081539_10008422 Ga0081539_100084226 371
175 3300006847 Ga0075431_100011518 Ga0075431_1000115185 371
176 3300006852 Ga0075433_10135100 Ga0075433_101351002 371
177 3300006880 Ga0075429_100043092 Ga0075429_1000430922 371
178 3300006931 Ga0097620_100046996 Ga0097620_1000469963 371
179 3300009147 Ga0114129_10019056 Ga0114129_100190569 371
180 3300009147 Ga0114129_10066511 Ga0114129_100665115 371
181 3300009147 Ga0114129_10100300 Ga0114129_101003003 371
182 3300009148 Ga0105243_10008165 Ga0105243_100081652 371
183 3300044712 Ga0453684_0024006 Ga0453684_0024006_4632_5747 371
184 3300044712 Ga0453684_0101565 Ga0453684_0101565_189_1310 371
185 3300044712 Ga0453684_0122789 Ga0453684_0122789_1460_2575 371
186 3300044712 Ga0453684_0124241 Ga0453684_0124241_1563_2687 371
187 3300044712 Ga0453684_0624223 Ga0453684_0624223_32_1147 371
188 3300045051 Ga0451576_0014889 Ga0451576_0014889_6230_7354 371
189 3300045051 Ga0451576_0457239 Ga0451576_0457239_75_1232 371
190 3300050507 nmdc:mga05p37_204283_c1 nmdc:mga05p37_204283_c1_383_1501 371
191 3300050507 nmdc:mga05p37_9917_c1 nmdc:mga05p37_9917_c1_7541_8665 371
192 3300050508 nmdc:mga09592_168199_c1 nmdc:mga09592_168199_c1_193_1317 371
193 3300050515 nmdc:mga0a205_166638_c1 nmdc:mga0a205_166638_c1_867_1991 371

Structural Annotation

Top 5 Hits

ID Description Score Start End
6m86-assembly1.cif.gz_A crystal structure of inward rectifier kir2.2 force open mutant 0.8072 75 148
3k06-assembly1.cif.gz_A crystal structure of cng mimicking nak mutant, nak-ntpp, k+ complex 0.7679 77 145
8ayp-assembly1.cif.gz_A nak c-di mutant with rb+ and ba2+ 0.7502 77 146
4r7c-assembly2.cif.gz_C-3 crystal structure of cng mimicking nak-etpp mutant cocrystallized with dimethylammonium 0.7359 77 149
4r7c-assembly2.cif.gz_D-3 crystal structure of cng mimicking nak-etpp mutant cocrystallized with dimethylammonium 0.7331 75 150
ID Description Score Start End Superfamily
4r6zB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7276 77 150 1.10.287.70
4ro2A00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7257 77 150 1.10.287.70
4r6zA00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7256 77 150 1.10.287.70
4raiB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7084 75 153 1.10.287.70
af_K7M0A1_556_692_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.659 76 153 1.10.287.70
ID Description Score Start End GO Terms
AF-A0A2E0UP19-F1-model_v4 Two pore domain potassium channel family protein 0.9859 2 352 GO:0016020
AF-A0A522B3H3-F1-model_v4 Two pore domain potassium channel family protein 0.9818 2 343 GO:0016020
GO:0034220
AF-A0A6L7JMF2-F1-model_v4 Two pore domain potassium channel family protein 0.9801 5 354 GO:0016020
AF-A0A7W0P347-F1-model_v4 Two pore domain potassium channel family protein 0.9798 2 355 GO:0016020
AF-A0A7C1IT81-F1-model_v4 Two pore domain potassium channel family protein 0.9784 2 360 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.28 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map