F296396
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 192 | 170 | 384 | 266 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2671180195|2671840347 |
| Length | 311 |
| Sequence | FRPGRPRASRRPTVGLAPAGTALAFEHVGMTFPDGSEVLRDLSLTVGTHDIVALVGASGSGKSTLLRIAAGLTPPTSGTVSAGPGSPALIFQDPTLLPWRTVAGNVGLFAELDGVPRAQRAGLVADALALTGLSDYERHRPRALSGGMRMRVSLARALTARPALFLLDEPFGALDEITRQRLGDELVRLHLREGFAGLFVTHSVVEAVALARRVGVLSARSGRLVAEVEIPFDYPRTETLRYDAAFGRVARTVSEALKDSFSDHHPNTPGAPGTPSHPNTPDHPGAPGPPGAEHQPGSAGPAGIDDLAGVE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 6 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 9 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 10 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 17 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 18 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 20 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 21 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 22 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 25 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 26 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 27 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 28 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 29 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 30 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 31 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 32 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 33 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 35 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 36 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 37 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 38 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 39 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 40 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 59 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 60 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 61 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 62 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 63 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 64 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 65 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 66 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 67 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 68 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 69 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 70 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 71 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 72 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 73 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 74 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 75 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 76 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 77 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 78 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 79 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 80 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 81 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 82 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 83 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 84 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 85 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 86 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 87 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 88 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 89 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 90 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 91 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 92 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 93 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 94 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 95 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 96 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 97 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 98 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 139 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 140 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 141 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 142 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 143 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 144 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 146 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 147 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 148 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 155 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 158 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 159 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 160 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 161 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 162 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 163 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 164 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 165 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 166 | 2870782633 | Pseudonocardia eucalypti DSM 45351 | Isolate | Unclassified |
| 167 | 2932398195 | Dietzia sp. 2505 | Isolate | Rhizosphere |
| 168 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 169 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 170 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.71 |
| Metatranscriptomes | 0.52 |
| Isolates | 6.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.12 |
| Nodule | 3.65 |
| Rhizoplane | 3.65 |
| Rhizosphere | 83.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10010610 | 3300003316 | Bacteria | 2798 |
| 2 | rootH2_10271582 | 3300003320 | Bacteria | 1227 |
| 3 | rootH1_10018206 | 3300003323 | Bacteria | 1801 |
| 4 | Ga0070683_100050728 | 3300005329 | Bacteria | 3842 |
| 5 | Ga0068868_100088080 | 3300005338 | Bacteria | 2498 |
| 6 | Ga0070709_10015634 | 3300005434 | Bacteria | 4321 |
| 7 | Ga0070714_100717726 | 3300005435 | Bacteria | 965 |
| 8 | Ga0070713_100006616 | 3300005436 | Bacteria | 8057 |
| 9 | Ga0070710_10020506 | 3300005437 | Bacteria | 3430 |
| 10 | Ga0070681_10178933 | 3300005458 | Bacteria | 2042 |
| 11 | Ga0070706_100014405 | 3300005467 | Bacteria | 7307 |
| 12 | Ga0070698_100042599 | 3300005471 | Bacteria | 4657 |
| 13 | Ga0070698_100069300 | 3300005471 | Bacteria | 3541 |
| 14 | Ga0070679_100102147 | 3300005530 | Bacteria | 2853 |
| 15 | Ga0070684_100011463 | 3300005535 | Bacteria | 7061 |
| 16 | Ga0070697_100488365 | 3300005536 | Bacteria | 1076 |
| 17 | Ga0068855_100105181 | 3300005563 | Bacteria | 3245 |
| 18 | Ga0081538_10003002 | 3300005981 | Bacteria | 16069 |
| 19 | Ga0081538_10010751 | 3300005981 | Bacteria | 7484 |
| 20 | Ga0070717_10348381 | 3300006028 | Bacteria | 1324 |
| 21 | Ga0075365_10051671 | 3300006038 | Bacteria | 2716 |
| 22 | Ga0075368_10090225 | 3300006042 | Bacteria | 1253 |
| 23 | Ga0075364_10092452 | 3300006051 | Bacteria | 2008 |
| 24 | Ga0070715_10174095 | 3300006163 | Bacteria | 1074 |
| 25 | Ga0070716_100040113 | 3300006173 | Bacteria | 2603 |
| 26 | Ga0075428_100024075 | 3300006844 | Bacteria | 6737 |
| 27 | Ga0075430_100007757 | 3300006846 | Bacteria | 9069 |
| 28 | Ga0075433_10034042 | 3300006852 | Bacteria | 4373 |
| 29 | Ga0075434_100009732 | 3300006871 | Bacteria | 8985 |
| 30 | Ga0075429_100019527 | 3300006880 | Bacteria | 5872 |
| 31 | Ga0075436_100008099 | 3300006914 | Bacteria | 7195 |
| 32 | Ga0075436_100016618 | 3300006914 | Bacteria | 5036 |
| 33 | Ga0075435_100062848 | 3300007076 | Bacteria | 3014 |
| 34 | Ga0111539_10150163 | 3300009094 | Bacteria | 2727 |
| 35 | Ga0114129_10026570 | 3300009147 | Bacteria | 8198 |
| 36 | Ga0114129_10031320 | 3300009147 | Bacteria | 7519 |
| 37 | Ga0105243_10039518 | 3300009148 | Bacteria | 3678 |
| 38 | Ga0157378_10030711 | 3300013297 | Bacteria | 4744 |
| 39 | Ga0157375_10363749 | 3300013308 | Bacteria | 1613 |
| 40 | Ga0154015_1042232 | 3300020610 | Bacteria | 1074 |
| 41 | Ga0213872_10010045 | 3300021361 | Bacteria | 4517 |
| 42 | Ga0213876_10011337 | 3300021384 | Bacteria | 4761 |
| 43 | Ga0213875_10009534 | 3300021388 | Bacteria | 4916 |
| 44 | Ga0209051_1002680 | 3300025303 | Bacteria | 12438 |
| 45 | Ga0207692_10013115 | 3300025898 | Bacteria | 3586 |
| 46 | Ga0207685_10139323 | 3300025905 | Bacteria | 1086 |
| 47 | Ga0207699_10035469 | 3300025906 | Bacteria | 2838 |
| 48 | Ga0207684_10212996 | 3300025910 | Bacteria | 1666 |
| 49 | Ga0207707_10074339 | 3300025912 | Bacteria | 2964 |
| 50 | Ga0207693_10015350 | 3300025915 | Bacteria | 6146 |
| 51 | Ga0207662_10127529 | 3300025918 | Bacteria | 1601 |
| 52 | Ga0207652_10074840 | 3300025921 | Bacteria | 2949 |
| 53 | Ga0207646_10581182 | 3300025922 | Bacteria | 1006 |
| 54 | Ga0207700_10330646 | 3300025928 | Bacteria | 1323 |
| 55 | Ga0207664_10619968 | 3300025929 | Bacteria | 972 |
| 56 | Ga0207709_10008403 | 3300025935 | Bacteria | 5712 |
| 57 | Ga0207704_10394983 | 3300025938 | Bacteria | 1090 |
| 58 | Ga0207665_10030836 | 3300025939 | Bacteria | 3545 |
| 59 | Ga0207665_10055410 | 3300025939 | Bacteria | 2675 |
| 60 | Ga0207661_10415943 | 3300025944 | Bacteria | 1221 |
| 61 | Ga0207658_10024429 | 3300025986 | Bacteria | 4229 |
| 62 | Ga0207677_10263756 | 3300026023 | Bacteria | 1405 |
| 63 | Ga0265334_10075087 | 3300028573 | Bacteria | 1253 |
| 64 | Ga0307408_100253031 | 3300031548 | Bacteria | 1454 |
| 65 | Ga0307413_10001926 | 3300031824 | Bacteria | 8229 |
| 66 | Ga0307410_10006473 | 3300031852 | Bacteria | 6326 |
| 67 | Ga0307412_10021482 | 3300031911 | Bacteria | 3944 |
| 68 | Ga0307409_100005696 | 3300031995 | Bacteria | 7216 |
| 69 | Ga0307409_100049247 | 3300031995 | Bacteria | 3211 |
| 70 | Ga0307416_100000876 | 3300032002 | Bacteria | 15846 |
| 71 | Ga0307416_100115576 | 3300032002 | Bacteria | 2376 |
| 72 | Ga0307414_10071971 | 3300032004 | Bacteria | 2496 |
| 73 | Ga0307411_10070014 | 3300032005 | Bacteria | 2372 |
| 74 | Ga0307415_100000679 | 3300032126 | Bacteria | 15107 |
| 75 | Ga0307415_100000690 | 3300032126 | Bacteria | 14997 |
| 76 | Ga0307415_100024722 | 3300032126 | Bacteria | 3757 |
| 77 | Ga0307415_100249400 | 3300032126 | Bacteria | 1441 |
| 78 | Ga0373926_0006042 | 3300035083 | Bacteria | 4009 |
| 79 | Ga0373934_0010050 | 3300035086 | Bacteria | 3552 |
| 80 | Ga0373944_0053344 | 3300035089 | Bacteria | 1279 |
| 81 | Ga0373936_0018861 | 3300035113 | Bacteria | 2668 |
| 82 | Ga0373945_0149074 | 3300035116 | Bacteria | 947 |
| 83 | Ga0373954_0099714 | 3300035118 | Bacteria | 1400 |
| 84 | Ga0373946_0163469 | 3300035171 | Bacteria | 1047 |
| 85 | Ga0373931_0003376 | 3300035691 | Bacteria | 7161 |
| 86 | Ga0373927_0114074 | 3300035695 | Bacteria | 1761 |
| 87 | Ga0373933_0289400 | 3300035724 | Bacteria | 1059 |
| 88 | Ga0373947_0092295 | 3300035725 | Bacteria | 1890 |
| 89 | Ga0373925_0041393 | 3300037068 | Bacteria | 3415 |
| 90 | Ga0373925_0104366 | 3300037068 | Bacteria | 2182 |
| 91 | Ga0395899_0183350 | 3300037312 | Bacteria | 1468 |
| 92 | Ga0395900_0059304 | 3300037418 | Bacteria | 3940 |
| 93 | Ga0395898_0024296 | 3300037466 | Bacteria | 6112 |
| 94 | Ga0395898_0304991 | 3300037466 | Bacteria | 1519 |
| 95 | Ga0395898_0403812 | 3300037466 | Bacteria | 1303 |
| 96 | Ga0395905_0012302 | 3300037471 | Bacteria | 8238 |
| 97 | Ga0395905_0063732 | 3300037471 | Bacteria | 3449 |
| 98 | Ga0436364_1291252 | 3300037853 | Bacteria | 3644 |
| 99 | Ga0436364_1381482 | 3300037853 | Bacteria | 1818 |
| 100 | Ga0395901_0003095 | 3300038443 | Bacteria | 16736 |
| 101 | Ga0436365_1201352 | 3300039437 | Bacteria | 37607 |
| 102 | Ga0436361_0568665 | 3300039447 | Bacteria | 5804 |
| 103 | Ga0436362_0583182 | 3300039453 | Bacteria | 1402 |
| 104 | Ga0439448_0024860 | 3300042005 | Bacteria | 1876 |
| 105 | Ga0439455_0037500 | 3300042012 | Bacteria | 1229 |
| 106 | Ga0450903_000165 | 3300042138 | Bacteria | 14521 |
| 107 | Ga0439458_0002260 | 3300042157 | Bacteria | 4741 |
| 108 | Ga0466963_0156887 | 3300044694 | Bacteria | 1583 |
| 109 | Ga0466960_0038116 | 3300044901 | Bacteria | 2258 |
| 110 | Ga0466967_0069779 | 3300045976 | Bacteria | 3142 |
| 111 | Ga0495592_0271357 | 3300046454 | Bacteria | 1113 |
| 112 | Ga0495629_0067242 | 3300046459 | Bacteria | 2501 |
| 113 | Ga0495638_0031581 | 3300046460 | Bacteria | 3402 |
| 114 | Ga0495651_0196735 | 3300046462 | Bacteria | 1414 |
| 115 | Ga0495580_0007090 | 3300046472 | Bacteria | 9031 |
| 116 | Ga0495582_0024669 | 3300046473 | Bacteria | 3291 |
| 117 | Ga0495605_0096544 | 3300046474 | Bacteria | 1363 |
| 118 | Ga0495639_0008336 | 3300046475 | Bacteria | 4446 |
| 119 | Ga0495662_0024614 | 3300046476 | Bacteria | 2905 |
| 120 | Ga0495585_0089250 | 3300046492 | Bacteria | 1662 |
| 121 | Ga0495594_0049014 | 3300046499 | Bacteria | 2321 |
| 122 | Ga0495608_0402162 | 3300046511 | Bacteria | 837 |
| 123 | Ga0495618_0022193 | 3300046514 | Bacteria | 3919 |
| 124 | Ga0495618_0100716 | 3300046514 | Bacteria | 1849 |
| 125 | Ga0495628_0006591 | 3300046516 | Bacteria | 10133 |
| 126 | Ga0495630_0036438 | 3300046517 | Bacteria | 3677 |
| 127 | Ga0495631_0009539 | 3300046518 | Bacteria | 4845 |
| 128 | Ga0495666_0023817 | 3300046526 | Bacteria | 3028 |
| 129 | Ga0495652_0095084 | 3300046529 | Bacteria | 2429 |
| 130 | Ga0495665_0112105 | 3300046531 | Bacteria | 1430 |
| 131 | Ga0495640_0030012 | 3300046533 | Bacteria | 3897 |
| 132 | Ga0495586_0242752 | 3300046535 | Bacteria | 1027 |
| 133 | Ga0495645_0136749 | 3300046543 | Bacteria | 1713 |
| 134 | Ga0495634_0043450 | 3300046642 | Bacteria | 3045 |
| 135 | Ga0495634_0045672 | 3300046642 | Bacteria | 2960 |
| 136 | Ga0495611_0026930 | 3300046648 | Bacteria | 2510 |
| 137 | Ga0495635_0088770 | 3300046663 | Bacteria | 2115 |
| 138 | Ga0495657_0000807 | 3300046675 | Bacteria | 27787 |
| 139 | Ga0495646_0020272 | 3300046680 | Bacteria | 4207 |
| 140 | Ga0495647_0015774 | 3300046681 | Bacteria | 2651 |
| 141 | Ga0495658_0023308 | 3300046683 | Bacteria | 3285 |
| 142 | Ga0495613_0005895 | 3300046689 | Bacteria | 9172 |
| 143 | Ga0495613_0132526 | 3300046689 | Bacteria | 1784 |
| 144 | Ga0495624_0035811 | 3300046690 | Bacteria | 3203 |
| 145 | Ga0495589_0058838 | 3300046794 | Bacteria | 1889 |
| 146 | Ga0495600_0366085 | 3300046809 | Bacteria | 901 |
| 147 | Ga0495581_0047513 | 3300047315 | Bacteria | 2480 |
| 148 | Ga0495604_0028163 | 3300047317 | Bacteria | 4469 |
| 149 | Ga0495636_0076389 | 3300047318 | Bacteria | 1436 |
| 150 | Ga0495674_0020355 | 3300047319 | Bacteria | 6143 |
| 151 | Ga0495676_0015092 | 3300047321 | Bacteria | 6896 |
| 152 | Ga0495676_0016123 | 3300047321 | Bacteria | 6638 |
| 153 | Ga0495676_0085176 | 3300047321 | Bacteria | 2382 |
| 154 | Ga0495680_0000876 | 3300047322 | Bacteria | 33428 |
| 155 | Ga0495685_017091 | 3300047447 | Bacteria | 2481 |
| 156 | Ga0495684_0041304 | 3300047471 | Bacteria | 3534 |
| 157 | Ga0495593_0074951 | 3300047673 | Bacteria | 1754 |
| 158 | Ga0496100_0085781 | 3300048903 | Bacteria | 2137 |
| 159 | Ga0496101_0002466 | 3300048904 | Bacteria | 11366 |
| 160 | Ga0496104_0450429 | 3300048907 | Bacteria | 1199 |
| 161 | Ga0496109_0203823 | 3300048912 | Bacteria | 1860 |
| 162 | Ga0496111_0079051 | 3300048914 | Bacteria | 2399 |
| 163 | Ga0496115_0011514 | 3300048918 | Bacteria | 6631 |
| 164 | Ga0496115_0131727 | 3300048918 | Bacteria | 2061 |
| 165 | Ga0501069_0029386 | 3300049585 | Bacteria | 3016 |
| 166 | Ga0501071_0411952 | 3300049587 | Bacteria | 1032 |
| 167 | nmdc:mga00v17_41890_c1 | 3300050491 | Bacteria | 2752 |
| 168 | nmdc:mga0yw44_149825_c1 | 3300050492 | Bacteria | 1521 |
| 169 | nmdc:mga05p37_11655_c1 | 3300050507 | Bacteria | 10478 |
| 170 | nmdc:mga09592_17686_c1 | 3300050508 | Bacteria | 5843 |
| 171 | nmdc:mga0qj67_242065_c1 | 3300050509 | Bacteria | 1464 |
| 172 | nmdc:mga06r32_55567_c1 | 3300050510 | Bacteria | 3798 |
| 173 | nmdc:mga0rr50_10157_c1 | 3300050513 | Bacteria | 5960 |
| 174 | nmdc:mga08x19_23486_c1 | 3300050514 | Bacteria | 3825 |
| 175 | nmdc:mga0a205_29040_c1 | 3300050515 | Bacteria | 5291 |
| 176 | Ga0495601_0022608 | 3300053077 | Bacteria | 3862 |
| 177 | Ga0495601_0035637 | 3300053077 | Bacteria | 3107 |
| 178 | Ga0495612_0013912 | 3300053078 | Bacteria | 3242 |
| 179 | Ga0495619_0004317 | 3300053085 | Bacteria | 9071 |
| 180 | 2671840347 | 2671180195 | Bacteria | 9757215 |
| 181 | 2506864602 | 2506783011 | Bacteria | 5323186 |
| 182 | 2619855985 | 2619618881 | Bacteria | 7521104 |
| 183 | 2620350924 | 2619619003 | Bacteria | 7619552 |
| 184 | 2689957485 | 2687453737 | Bacteria | 11203906 |
| 185 | 2774858503 | 2773857922 | Bacteria | 9757215 |
| 186 | 2774905108 | 2773857933 | Bacteria | 5818019 |
| 187 | 2786673589 | 2786546132 | Bacteria | 10419719 |
| 188 | 2870789855 | 2870782633 | Bacteria | 9624083 |
| 189 | 2932401353 | 2932398195 | Bacteria | 3847976 |
| 190 | 2954691414 | 2954682443 | Bacteria | 9862841 |
| 191 | 8033688987 | 8033684223 | Bacteria | 6906479 |
| 192 | 8054924971 | 8054920844 | Bacteria | 7068637 |
| 193 | rootH1_10010610 | |||
| 194 | rootH2_10271582 | |||
| 195 | rootH1_10018206 | |||
| 196 | Ga0070683_100050728 | |||
| 197 | Ga0068868_100088080 | |||
| 198 | Ga0070709_10015634 | |||
| 199 | Ga0070714_100717726 | |||
| 200 | Ga0070713_100006616 | |||
| 201 | Ga0070710_10020506 | |||
| 202 | Ga0070681_10178933 | |||
| 203 | Ga0070706_100014405 | |||
| 204 | Ga0070698_100042599 | |||
| 205 | Ga0070698_100069300 | |||
| 206 | Ga0070679_100102147 | |||
| 207 | Ga0070684_100011463 | |||
| 208 | Ga0070697_100488365 | |||
| 209 | Ga0068855_100105181 | |||
| 210 | Ga0081538_10003002 | |||
| 211 | Ga0081538_10010751 | |||
| 212 | Ga0070717_10348381 | |||
| 213 | Ga0075365_10051671 | |||
| 214 | Ga0075368_10090225 | |||
| 215 | Ga0075364_10092452 | |||
| 216 | Ga0070715_10174095 | |||
| 217 | Ga0070716_100040113 | |||
| 218 | Ga0075428_100024075 | |||
| 219 | Ga0075430_100007757 | |||
| 220 | Ga0075433_10034042 | |||
| 221 | Ga0075434_100009732 | |||
| 222 | Ga0075429_100019527 | |||
| 223 | Ga0075436_100008099 | |||
| 224 | Ga0075436_100016618 | |||
| 225 | Ga0075435_100062848 | |||
| 226 | Ga0111539_10150163 | |||
| 227 | Ga0114129_10026570 | |||
| 228 | Ga0114129_10031320 | |||
| 229 | Ga0105243_10039518 | |||
| 230 | Ga0157378_10030711 | |||
| 231 | Ga0157375_10363749 | |||
| 232 | Ga0154015_1042232 | |||
| 233 | Ga0213872_10010045 | |||
| 234 | Ga0213876_10011337 | |||
| 235 | Ga0213875_10009534 | |||
| 236 | Ga0209051_1002680 | |||
| 237 | Ga0207692_10013115 | |||
| 238 | Ga0207685_10139323 | |||
| 239 | Ga0207699_10035469 | |||
| 240 | Ga0207684_10212996 | |||
| 241 | Ga0207707_10074339 | |||
| 242 | Ga0207693_10015350 | |||
| 243 | Ga0207662_10127529 | |||
| 244 | Ga0207652_10074840 | |||
| 245 | Ga0207646_10581182 | |||
| 246 | Ga0207700_10330646 | |||
| 247 | Ga0207664_10619968 | |||
| 248 | Ga0207709_10008403 | |||
| 249 | Ga0207704_10394983 | |||
| 250 | Ga0207665_10030836 | |||
| 251 | Ga0207665_10055410 | |||
| 252 | Ga0207661_10415943 | |||
| 253 | Ga0207658_10024429 | |||
| 254 | Ga0207677_10263756 | |||
| 255 | Ga0265334_10075087 | |||
| 256 | Ga0307408_100253031 | |||
| 257 | Ga0307413_10001926 | |||
| 258 | Ga0307410_10006473 | |||
| 259 | Ga0307412_10021482 | |||
| 260 | Ga0307409_100005696 | |||
| 261 | Ga0307409_100049247 | |||
| 262 | Ga0307416_100000876 | |||
| 263 | Ga0307416_100115576 | |||
| 264 | Ga0307414_10071971 | |||
| 265 | Ga0307411_10070014 | |||
| 266 | Ga0307415_100000679 | |||
| 267 | Ga0307415_100000690 | |||
| 268 | Ga0307415_100024722 | |||
| 269 | Ga0307415_100249400 | |||
| 270 | Ga0373926_0006042 | |||
| 271 | Ga0373934_0010050 | |||
| 272 | Ga0373944_0053344 | |||
| 273 | Ga0373936_0018861 | |||
| 274 | Ga0373945_0149074 | |||
| 275 | Ga0373954_0099714 | |||
| 276 | Ga0373946_0163469 | |||
| 277 | Ga0373931_0003376 | |||
| 278 | Ga0373927_0114074 | |||
| 279 | Ga0373933_0289400 | |||
| 280 | Ga0373947_0092295 | |||
| 281 | Ga0373925_0041393 | |||
| 282 | Ga0373925_0104366 | |||
| 283 | Ga0395899_0183350 | |||
| 284 | Ga0395900_0059304 | |||
| 285 | Ga0395898_0024296 | |||
| 286 | Ga0395898_0304991 | |||
| 287 | Ga0395898_0403812 | |||
| 288 | Ga0395905_0012302 | |||
| 289 | Ga0395905_0063732 | |||
| 290 | Ga0436364_1291252 | |||
| 291 | Ga0436364_1381482 | |||
| 292 | Ga0395901_0003095 | |||
| 293 | Ga0436365_1201352 | |||
| 294 | Ga0436361_0568665 | |||
| 295 | Ga0436362_0583182 | |||
| 296 | Ga0439448_0024860 | |||
| 297 | Ga0439455_0037500 | |||
| 298 | Ga0450903_000165 | |||
| 299 | Ga0439458_0002260 | |||
| 300 | Ga0466963_0156887 | |||
| 301 | Ga0466960_0038116 | |||
| 302 | Ga0466967_0069779 | |||
| 303 | Ga0495592_0271357 | |||
| 304 | Ga0495629_0067242 | |||
| 305 | Ga0495638_0031581 | |||
| 306 | Ga0495651_0196735 | |||
| 307 | Ga0495580_0007090 | |||
| 308 | Ga0495582_0024669 | |||
| 309 | Ga0495605_0096544 | |||
| 310 | Ga0495639_0008336 | |||
| 311 | Ga0495662_0024614 | |||
| 312 | Ga0495585_0089250 | |||
| 313 | Ga0495594_0049014 | |||
| 314 | Ga0495608_0402162 | |||
| 315 | Ga0495618_0022193 | |||
| 316 | Ga0495618_0100716 | |||
| 317 | Ga0495628_0006591 | |||
| 318 | Ga0495630_0036438 | |||
| 319 | Ga0495631_0009539 | |||
| 320 | Ga0495666_0023817 | |||
| 321 | Ga0495652_0095084 | |||
| 322 | Ga0495665_0112105 | |||
| 323 | Ga0495640_0030012 | |||
| 324 | Ga0495586_0242752 | |||
| 325 | Ga0495645_0136749 | |||
| 326 | Ga0495634_0043450 | |||
| 327 | Ga0495634_0045672 | |||
| 328 | Ga0495611_0026930 | |||
| 329 | Ga0495635_0088770 | |||
| 330 | Ga0495657_0000807 | |||
| 331 | Ga0495646_0020272 | |||
| 332 | Ga0495647_0015774 | |||
| 333 | Ga0495658_0023308 | |||
| 334 | Ga0495613_0005895 | |||
| 335 | Ga0495613_0132526 | |||
| 336 | Ga0495624_0035811 | |||
| 337 | Ga0495589_0058838 | |||
| 338 | Ga0495600_0366085 | |||
| 339 | Ga0495581_0047513 | |||
| 340 | Ga0495604_0028163 | |||
| 341 | Ga0495636_0076389 | |||
| 342 | Ga0495674_0020355 | |||
| 343 | Ga0495676_0015092 | |||
| 344 | Ga0495676_0016123 | |||
| 345 | Ga0495676_0085176 | |||
| 346 | Ga0495680_0000876 | |||
| 347 | Ga0495685_017091 | |||
| 348 | Ga0495684_0041304 | |||
| 349 | Ga0495593_0074951 | |||
| 350 | Ga0496100_0085781 | |||
| 351 | Ga0496101_0002466 | |||
| 352 | Ga0496104_0450429 | |||
| 353 | Ga0496109_0203823 | |||
| 354 | Ga0496111_0079051 | |||
| 355 | Ga0496115_0011514 | |||
| 356 | Ga0496115_0131727 | |||
| 357 | Ga0501069_0029386 | |||
| 358 | Ga0501071_0411952 | |||
| 359 | nmdc:mga00v17_41890_c1 | |||
| 360 | nmdc:mga0yw44_149825_c1 | |||
| 361 | nmdc:mga05p37_11655_c1 | |||
| 362 | nmdc:mga09592_17686_c1 | |||
| 363 | nmdc:mga0qj67_242065_c1 | |||
| 364 | nmdc:mga06r32_55567_c1 | |||
| 365 | nmdc:mga0rr50_10157_c1 | |||
| 366 | nmdc:mga08x19_23486_c1 | |||
| 367 | nmdc:mga0a205_29040_c1 | |||
| 368 | Ga0495601_0022608 | |||
| 369 | Ga0495601_0035637 | |||
| 370 | Ga0495612_0013912 | |||
| 371 | Ga0495619_0004317 | |||
| 372 | 2671840347 | |||
| 373 | 2506864602 | |||
| 374 | 2619855985 | |||
| 375 | 2620350924 | |||
| 376 | 2689957485 | |||
| 377 | 2774858503 | |||
| 378 | 2774905108 | |||
| 379 | 2786673589 | |||
| 380 | 2870789855 | |||
| 381 | 2932401353 | |||
| 382 | 2954691414 | |||
| 383 | 8033688987 | |||
| 384 | 8054924971 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2awn-assembly2.cif.gz_C | crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) | 0.9275 | 26 | 222 |
| 2pcj-assembly1.cif.gz_B | crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 | 0.9179 | 9 | 224 |
| 5lj9-assembly3.cif.gz_C | structure of the e. coli macb abc domain (c2221) | 0.9153 | 9 | 227 |
| 8tzj-assembly1.cif.gz_A | cryo-em structure of vibrio cholerae ftse/ftsx complex | 0.9145 | 10 | 219 |
| 5xu1-assembly1.cif.gz_B | structure of a non-canonical abc transporter from streptococcus pneumoniae r6 | 0.9123 | 9 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6Q2V7_231_304_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9476 | 11 | 70 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9292 | 8 | 226 | 3.40.50.300 |
| af_P0AAI1_7_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9166 | 8 | 226 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9165 | 9 | 224 | 3.40.50.300 |
| af_O05779_1_226_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9164 | 10 | 228 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B9UWZ2-F1-model_v4 | Macrolide ABC transporter ATP-binding protein | 0.9792 | 80 | 162 |
GO:0005524
GO:0016887 |
| AF-A0A382FBJ4-F1-model_v4 | ABC transporter domain-containing protein | 0.9668 | 80 | 222 |
GO:0005524
GO:0005886 GO:0016887 GO:0022857 |
| AF-A0A529HGG3-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.965 | 80 | 227 |
GO:0005524
GO:0006865 GO:0016887 |
| AF-A0A7C0XLY7-F1-model_v4 | Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) | 0.9641 | 80 | 224 |
GO:0005524
GO:0016887 GO:0022857 GO:0043190 |
| AF-B4RHS1-F1-model_v4 | ABC transporter, ATP-binding protein | 0.9585 | 9 | 255 |
GO:0005524
GO:0016887 |