F296396

General Info

Members Datasets Scaffolds Average Seq Length
192 170 384 266

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2671180195|2671840347
Length 311
Sequence FRPGRPRASRRPTVGLAPAGTALAFEHVGMTFPDGSEVLRDLSLTVGTHDIVALVGASGSGKSTLLRIAAGLTPPTSGTVSAGPGSPALIFQDPTLLPWRTVAGNVGLFAELDGVPRAQRAGLVADALALTGLSDYERHRPRALSGGMRMRVSLARALTARPALFLLDEPFGALDEITRQRLGDELVRLHLREGFAGLFVTHSVVEAVALARRVGVLSARSGRLVAEVEIPFDYPRTETLRYDAAFGRVARTVSEALKDSFSDHHPNTPGAPGTPSHPNTPDHPGAPGPPGAEHQPGSAGPAGIDDLAGVE

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
17 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
18 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
19 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
20 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
21 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
22 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
25 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
26 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
34 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
35 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
36 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
37 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
38 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
39 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
40 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
59 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
60 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
61 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
64 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
65 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
66 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
67 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
68 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
69 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
70 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
71 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
72 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
73 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
74 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
75 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
76 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
77 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
78 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
89 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
90 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
91 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
92 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
96 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
99 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
100 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
101 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
102 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
103 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
104 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
108 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
109 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
110 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
111 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
118 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
119 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
120 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
121 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
124 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
128 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
129 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
130 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
131 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
145 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
146 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
147 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
148 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
149 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
150 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
153 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
156 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
157 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
158 2671180195 Frankia sp. CcI49 Isolate Nodule
159 2506783011 Frankia datiscae Dg1 Isolate Nodule
160 2619618881 Frankia sp. ACN1ag Isolate Unclassified
161 2619619003 Frankia sp. CpI1-P Isolate Nodule
162 2687453737 Frankia sp. BMG5.36 Isolate Nodule
163 2773857922 Frankia sp. CcI49 Isolate Nodule
164 2773857933 Frankia sp. BMG5.30 Isolate Nodule
165 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
166 2870782633 Pseudonocardia eucalypti DSM 45351 Isolate Unclassified
167 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
168 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
169 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
170 8054920844 Frankia tisae Agncl-8 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.71
Metatranscriptomes 0.52
Isolates 6.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.12
Nodule 3.65
Rhizoplane 3.65
Rhizosphere 83.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10010610 3300003316 Bacteria 2798
2 rootH2_10271582 3300003320 Bacteria 1227
3 rootH1_10018206 3300003323 Bacteria 1801
4 Ga0070683_100050728 3300005329 Bacteria 3842
5 Ga0068868_100088080 3300005338 Bacteria 2498
6 Ga0070709_10015634 3300005434 Bacteria 4321
7 Ga0070714_100717726 3300005435 Bacteria 965
8 Ga0070713_100006616 3300005436 Bacteria 8057
9 Ga0070710_10020506 3300005437 Bacteria 3430
10 Ga0070681_10178933 3300005458 Bacteria 2042
11 Ga0070706_100014405 3300005467 Bacteria 7307
12 Ga0070698_100042599 3300005471 Bacteria 4657
13 Ga0070698_100069300 3300005471 Bacteria 3541
14 Ga0070679_100102147 3300005530 Bacteria 2853
15 Ga0070684_100011463 3300005535 Bacteria 7061
16 Ga0070697_100488365 3300005536 Bacteria 1076
17 Ga0068855_100105181 3300005563 Bacteria 3245
18 Ga0081538_10003002 3300005981 Bacteria 16069
19 Ga0081538_10010751 3300005981 Bacteria 7484
20 Ga0070717_10348381 3300006028 Bacteria 1324
21 Ga0075365_10051671 3300006038 Bacteria 2716
22 Ga0075368_10090225 3300006042 Bacteria 1253
23 Ga0075364_10092452 3300006051 Bacteria 2008
24 Ga0070715_10174095 3300006163 Bacteria 1074
25 Ga0070716_100040113 3300006173 Bacteria 2603
26 Ga0075428_100024075 3300006844 Bacteria 6737
27 Ga0075430_100007757 3300006846 Bacteria 9069
28 Ga0075433_10034042 3300006852 Bacteria 4373
29 Ga0075434_100009732 3300006871 Bacteria 8985
30 Ga0075429_100019527 3300006880 Bacteria 5872
31 Ga0075436_100008099 3300006914 Bacteria 7195
32 Ga0075436_100016618 3300006914 Bacteria 5036
33 Ga0075435_100062848 3300007076 Bacteria 3014
34 Ga0111539_10150163 3300009094 Bacteria 2727
35 Ga0114129_10026570 3300009147 Bacteria 8198
36 Ga0114129_10031320 3300009147 Bacteria 7519
37 Ga0105243_10039518 3300009148 Bacteria 3678
38 Ga0157378_10030711 3300013297 Bacteria 4744
39 Ga0157375_10363749 3300013308 Bacteria 1613
40 Ga0154015_1042232 3300020610 Bacteria 1074
41 Ga0213872_10010045 3300021361 Bacteria 4517
42 Ga0213876_10011337 3300021384 Bacteria 4761
43 Ga0213875_10009534 3300021388 Bacteria 4916
44 Ga0209051_1002680 3300025303 Bacteria 12438
45 Ga0207692_10013115 3300025898 Bacteria 3586
46 Ga0207685_10139323 3300025905 Bacteria 1086
47 Ga0207699_10035469 3300025906 Bacteria 2838
48 Ga0207684_10212996 3300025910 Bacteria 1666
49 Ga0207707_10074339 3300025912 Bacteria 2964
50 Ga0207693_10015350 3300025915 Bacteria 6146
51 Ga0207662_10127529 3300025918 Bacteria 1601
52 Ga0207652_10074840 3300025921 Bacteria 2949
53 Ga0207646_10581182 3300025922 Bacteria 1006
54 Ga0207700_10330646 3300025928 Bacteria 1323
55 Ga0207664_10619968 3300025929 Bacteria 972
56 Ga0207709_10008403 3300025935 Bacteria 5712
57 Ga0207704_10394983 3300025938 Bacteria 1090
58 Ga0207665_10030836 3300025939 Bacteria 3545
59 Ga0207665_10055410 3300025939 Bacteria 2675
60 Ga0207661_10415943 3300025944 Bacteria 1221
61 Ga0207658_10024429 3300025986 Bacteria 4229
62 Ga0207677_10263756 3300026023 Bacteria 1405
63 Ga0265334_10075087 3300028573 Bacteria 1253
64 Ga0307408_100253031 3300031548 Bacteria 1454
65 Ga0307413_10001926 3300031824 Bacteria 8229
66 Ga0307410_10006473 3300031852 Bacteria 6326
67 Ga0307412_10021482 3300031911 Bacteria 3944
68 Ga0307409_100005696 3300031995 Bacteria 7216
69 Ga0307409_100049247 3300031995 Bacteria 3211
70 Ga0307416_100000876 3300032002 Bacteria 15846
71 Ga0307416_100115576 3300032002 Bacteria 2376
72 Ga0307414_10071971 3300032004 Bacteria 2496
73 Ga0307411_10070014 3300032005 Bacteria 2372
74 Ga0307415_100000679 3300032126 Bacteria 15107
75 Ga0307415_100000690 3300032126 Bacteria 14997
76 Ga0307415_100024722 3300032126 Bacteria 3757
77 Ga0307415_100249400 3300032126 Bacteria 1441
78 Ga0373926_0006042 3300035083 Bacteria 4009
79 Ga0373934_0010050 3300035086 Bacteria 3552
80 Ga0373944_0053344 3300035089 Bacteria 1279
81 Ga0373936_0018861 3300035113 Bacteria 2668
82 Ga0373945_0149074 3300035116 Bacteria 947
83 Ga0373954_0099714 3300035118 Bacteria 1400
84 Ga0373946_0163469 3300035171 Bacteria 1047
85 Ga0373931_0003376 3300035691 Bacteria 7161
86 Ga0373927_0114074 3300035695 Bacteria 1761
87 Ga0373933_0289400 3300035724 Bacteria 1059
88 Ga0373947_0092295 3300035725 Bacteria 1890
89 Ga0373925_0041393 3300037068 Bacteria 3415
90 Ga0373925_0104366 3300037068 Bacteria 2182
91 Ga0395899_0183350 3300037312 Bacteria 1468
92 Ga0395900_0059304 3300037418 Bacteria 3940
93 Ga0395898_0024296 3300037466 Bacteria 6112
94 Ga0395898_0304991 3300037466 Bacteria 1519
95 Ga0395898_0403812 3300037466 Bacteria 1303
96 Ga0395905_0012302 3300037471 Bacteria 8238
97 Ga0395905_0063732 3300037471 Bacteria 3449
98 Ga0436364_1291252 3300037853 Bacteria 3644
99 Ga0436364_1381482 3300037853 Bacteria 1818
100 Ga0395901_0003095 3300038443 Bacteria 16736
101 Ga0436365_1201352 3300039437 Bacteria 37607
102 Ga0436361_0568665 3300039447 Bacteria 5804
103 Ga0436362_0583182 3300039453 Bacteria 1402
104 Ga0439448_0024860 3300042005 Bacteria 1876
105 Ga0439455_0037500 3300042012 Bacteria 1229
106 Ga0450903_000165 3300042138 Bacteria 14521
107 Ga0439458_0002260 3300042157 Bacteria 4741
108 Ga0466963_0156887 3300044694 Bacteria 1583
109 Ga0466960_0038116 3300044901 Bacteria 2258
110 Ga0466967_0069779 3300045976 Bacteria 3142
111 Ga0495592_0271357 3300046454 Bacteria 1113
112 Ga0495629_0067242 3300046459 Bacteria 2501
113 Ga0495638_0031581 3300046460 Bacteria 3402
114 Ga0495651_0196735 3300046462 Bacteria 1414
115 Ga0495580_0007090 3300046472 Bacteria 9031
116 Ga0495582_0024669 3300046473 Bacteria 3291
117 Ga0495605_0096544 3300046474 Bacteria 1363
118 Ga0495639_0008336 3300046475 Bacteria 4446
119 Ga0495662_0024614 3300046476 Bacteria 2905
120 Ga0495585_0089250 3300046492 Bacteria 1662
121 Ga0495594_0049014 3300046499 Bacteria 2321
122 Ga0495608_0402162 3300046511 Bacteria 837
123 Ga0495618_0022193 3300046514 Bacteria 3919
124 Ga0495618_0100716 3300046514 Bacteria 1849
125 Ga0495628_0006591 3300046516 Bacteria 10133
126 Ga0495630_0036438 3300046517 Bacteria 3677
127 Ga0495631_0009539 3300046518 Bacteria 4845
128 Ga0495666_0023817 3300046526 Bacteria 3028
129 Ga0495652_0095084 3300046529 Bacteria 2429
130 Ga0495665_0112105 3300046531 Bacteria 1430
131 Ga0495640_0030012 3300046533 Bacteria 3897
132 Ga0495586_0242752 3300046535 Bacteria 1027
133 Ga0495645_0136749 3300046543 Bacteria 1713
134 Ga0495634_0043450 3300046642 Bacteria 3045
135 Ga0495634_0045672 3300046642 Bacteria 2960
136 Ga0495611_0026930 3300046648 Bacteria 2510
137 Ga0495635_0088770 3300046663 Bacteria 2115
138 Ga0495657_0000807 3300046675 Bacteria 27787
139 Ga0495646_0020272 3300046680 Bacteria 4207
140 Ga0495647_0015774 3300046681 Bacteria 2651
141 Ga0495658_0023308 3300046683 Bacteria 3285
142 Ga0495613_0005895 3300046689 Bacteria 9172
143 Ga0495613_0132526 3300046689 Bacteria 1784
144 Ga0495624_0035811 3300046690 Bacteria 3203
145 Ga0495589_0058838 3300046794 Bacteria 1889
146 Ga0495600_0366085 3300046809 Bacteria 901
147 Ga0495581_0047513 3300047315 Bacteria 2480
148 Ga0495604_0028163 3300047317 Bacteria 4469
149 Ga0495636_0076389 3300047318 Bacteria 1436
150 Ga0495674_0020355 3300047319 Bacteria 6143
151 Ga0495676_0015092 3300047321 Bacteria 6896
152 Ga0495676_0016123 3300047321 Bacteria 6638
153 Ga0495676_0085176 3300047321 Bacteria 2382
154 Ga0495680_0000876 3300047322 Bacteria 33428
155 Ga0495685_017091 3300047447 Bacteria 2481
156 Ga0495684_0041304 3300047471 Bacteria 3534
157 Ga0495593_0074951 3300047673 Bacteria 1754
158 Ga0496100_0085781 3300048903 Bacteria 2137
159 Ga0496101_0002466 3300048904 Bacteria 11366
160 Ga0496104_0450429 3300048907 Bacteria 1199
161 Ga0496109_0203823 3300048912 Bacteria 1860
162 Ga0496111_0079051 3300048914 Bacteria 2399
163 Ga0496115_0011514 3300048918 Bacteria 6631
164 Ga0496115_0131727 3300048918 Bacteria 2061
165 Ga0501069_0029386 3300049585 Bacteria 3016
166 Ga0501071_0411952 3300049587 Bacteria 1032
167 nmdc:mga00v17_41890_c1 3300050491 Bacteria 2752
168 nmdc:mga0yw44_149825_c1 3300050492 Bacteria 1521
169 nmdc:mga05p37_11655_c1 3300050507 Bacteria 10478
170 nmdc:mga09592_17686_c1 3300050508 Bacteria 5843
171 nmdc:mga0qj67_242065_c1 3300050509 Bacteria 1464
172 nmdc:mga06r32_55567_c1 3300050510 Bacteria 3798
173 nmdc:mga0rr50_10157_c1 3300050513 Bacteria 5960
174 nmdc:mga08x19_23486_c1 3300050514 Bacteria 3825
175 nmdc:mga0a205_29040_c1 3300050515 Bacteria 5291
176 Ga0495601_0022608 3300053077 Bacteria 3862
177 Ga0495601_0035637 3300053077 Bacteria 3107
178 Ga0495612_0013912 3300053078 Bacteria 3242
179 Ga0495619_0004317 3300053085 Bacteria 9071
180 2671840347 2671180195 Bacteria 9757215
181 2506864602 2506783011 Bacteria 5323186
182 2619855985 2619618881 Bacteria 7521104
183 2620350924 2619619003 Bacteria 7619552
184 2689957485 2687453737 Bacteria 11203906
185 2774858503 2773857922 Bacteria 9757215
186 2774905108 2773857933 Bacteria 5818019
187 2786673589 2786546132 Bacteria 10419719
188 2870789855 2870782633 Bacteria 9624083
189 2932401353 2932398195 Bacteria 3847976
190 2954691414 2954682443 Bacteria 9862841
191 8033688987 8033684223 Bacteria 6906479
192 8054924971 8054920844 Bacteria 7068637
193 rootH1_10010610
194 rootH2_10271582
195 rootH1_10018206
196 Ga0070683_100050728
197 Ga0068868_100088080
198 Ga0070709_10015634
199 Ga0070714_100717726
200 Ga0070713_100006616
201 Ga0070710_10020506
202 Ga0070681_10178933
203 Ga0070706_100014405
204 Ga0070698_100042599
205 Ga0070698_100069300
206 Ga0070679_100102147
207 Ga0070684_100011463
208 Ga0070697_100488365
209 Ga0068855_100105181
210 Ga0081538_10003002
211 Ga0081538_10010751
212 Ga0070717_10348381
213 Ga0075365_10051671
214 Ga0075368_10090225
215 Ga0075364_10092452
216 Ga0070715_10174095
217 Ga0070716_100040113
218 Ga0075428_100024075
219 Ga0075430_100007757
220 Ga0075433_10034042
221 Ga0075434_100009732
222 Ga0075429_100019527
223 Ga0075436_100008099
224 Ga0075436_100016618
225 Ga0075435_100062848
226 Ga0111539_10150163
227 Ga0114129_10026570
228 Ga0114129_10031320
229 Ga0105243_10039518
230 Ga0157378_10030711
231 Ga0157375_10363749
232 Ga0154015_1042232
233 Ga0213872_10010045
234 Ga0213876_10011337
235 Ga0213875_10009534
236 Ga0209051_1002680
237 Ga0207692_10013115
238 Ga0207685_10139323
239 Ga0207699_10035469
240 Ga0207684_10212996
241 Ga0207707_10074339
242 Ga0207693_10015350
243 Ga0207662_10127529
244 Ga0207652_10074840
245 Ga0207646_10581182
246 Ga0207700_10330646
247 Ga0207664_10619968
248 Ga0207709_10008403
249 Ga0207704_10394983
250 Ga0207665_10030836
251 Ga0207665_10055410
252 Ga0207661_10415943
253 Ga0207658_10024429
254 Ga0207677_10263756
255 Ga0265334_10075087
256 Ga0307408_100253031
257 Ga0307413_10001926
258 Ga0307410_10006473
259 Ga0307412_10021482
260 Ga0307409_100005696
261 Ga0307409_100049247
262 Ga0307416_100000876
263 Ga0307416_100115576
264 Ga0307414_10071971
265 Ga0307411_10070014
266 Ga0307415_100000679
267 Ga0307415_100000690
268 Ga0307415_100024722
269 Ga0307415_100249400
270 Ga0373926_0006042
271 Ga0373934_0010050
272 Ga0373944_0053344
273 Ga0373936_0018861
274 Ga0373945_0149074
275 Ga0373954_0099714
276 Ga0373946_0163469
277 Ga0373931_0003376
278 Ga0373927_0114074
279 Ga0373933_0289400
280 Ga0373947_0092295
281 Ga0373925_0041393
282 Ga0373925_0104366
283 Ga0395899_0183350
284 Ga0395900_0059304
285 Ga0395898_0024296
286 Ga0395898_0304991
287 Ga0395898_0403812
288 Ga0395905_0012302
289 Ga0395905_0063732
290 Ga0436364_1291252
291 Ga0436364_1381482
292 Ga0395901_0003095
293 Ga0436365_1201352
294 Ga0436361_0568665
295 Ga0436362_0583182
296 Ga0439448_0024860
297 Ga0439455_0037500
298 Ga0450903_000165
299 Ga0439458_0002260
300 Ga0466963_0156887
301 Ga0466960_0038116
302 Ga0466967_0069779
303 Ga0495592_0271357
304 Ga0495629_0067242
305 Ga0495638_0031581
306 Ga0495651_0196735
307 Ga0495580_0007090
308 Ga0495582_0024669
309 Ga0495605_0096544
310 Ga0495639_0008336
311 Ga0495662_0024614
312 Ga0495585_0089250
313 Ga0495594_0049014
314 Ga0495608_0402162
315 Ga0495618_0022193
316 Ga0495618_0100716
317 Ga0495628_0006591
318 Ga0495630_0036438
319 Ga0495631_0009539
320 Ga0495666_0023817
321 Ga0495652_0095084
322 Ga0495665_0112105
323 Ga0495640_0030012
324 Ga0495586_0242752
325 Ga0495645_0136749
326 Ga0495634_0043450
327 Ga0495634_0045672
328 Ga0495611_0026930
329 Ga0495635_0088770
330 Ga0495657_0000807
331 Ga0495646_0020272
332 Ga0495647_0015774
333 Ga0495658_0023308
334 Ga0495613_0005895
335 Ga0495613_0132526
336 Ga0495624_0035811
337 Ga0495589_0058838
338 Ga0495600_0366085
339 Ga0495581_0047513
340 Ga0495604_0028163
341 Ga0495636_0076389
342 Ga0495674_0020355
343 Ga0495676_0015092
344 Ga0495676_0016123
345 Ga0495676_0085176
346 Ga0495680_0000876
347 Ga0495685_017091
348 Ga0495684_0041304
349 Ga0495593_0074951
350 Ga0496100_0085781
351 Ga0496101_0002466
352 Ga0496104_0450429
353 Ga0496109_0203823
354 Ga0496111_0079051
355 Ga0496115_0011514
356 Ga0496115_0131727
357 Ga0501069_0029386
358 Ga0501071_0411952
359 nmdc:mga00v17_41890_c1
360 nmdc:mga0yw44_149825_c1
361 nmdc:mga05p37_11655_c1
362 nmdc:mga09592_17686_c1
363 nmdc:mga0qj67_242065_c1
364 nmdc:mga06r32_55567_c1
365 nmdc:mga0rr50_10157_c1
366 nmdc:mga08x19_23486_c1
367 nmdc:mga0a205_29040_c1
368 Ga0495601_0022608
369 Ga0495601_0035637
370 Ga0495612_0013912
371 Ga0495619_0004317
372 2671840347
373 2506864602
374 2619855985
375 2620350924
376 2689957485
377 2774858503
378 2774905108
379 2786673589
380 2870789855
381 2932401353
382 2954691414
383 8033688987
384 8054924971

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

39

172

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awn-assembly2.cif.gz_C crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.9275 26 222
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9179 9 224
5lj9-assembly3.cif.gz_C structure of the e. coli macb abc domain (c2221) 0.9153 9 227
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9145 10 219
5xu1-assembly1.cif.gz_B structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9123 9 222
ID Description Score Start End Superfamily
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9476 11 70 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9292 8 226 3.40.50.300
af_P0AAI1_7_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9166 8 226 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9165 9 224 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9164 10 228 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A3B9UWZ2-F1-model_v4 Macrolide ABC transporter ATP-binding protein 0.9792 80 162 GO:0005524
GO:0016887
AF-A0A382FBJ4-F1-model_v4 ABC transporter domain-containing protein 0.9668 80 222 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A529HGG3-F1-model_v4 ATP-binding cassette domain-containing protein 0.965 80 227 GO:0005524
GO:0006865
GO:0016887
AF-A0A7C0XLY7-F1-model_v4 Molybdate/tungstate import ATP-binding protein WtpC (EC 7.3.2.6) 0.9641 80 224 GO:0005524
GO:0016887
GO:0022857
GO:0043190
AF-B4RHS1-F1-model_v4 ABC transporter, ATP-binding protein 0.9585 9 255 GO:0005524
GO:0016887

Map