F295229

General Info

Members Datasets Scaffolds Average Seq Length
192 141 384 141

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100269442|Ga0070711_1002694422
Length 150
Sequence MLAFKRLLLVTALTPGDTMFAGKRPANLGYESGRLAPCKRTPNCVSSQTDPKDEEHYIAPIAAKGDAIAAIRKAVESMPRTTVVKAEPGYLYAEFKSKLMGFVDDVEFLHDPAKGVVHVRSASRLGRRDFGVNRERVERLRALIERRVQG

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
9 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
24 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
38 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
73 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
85 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
86 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
87 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
88 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
89 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
90 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
91 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
94 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
97 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
98 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
99 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
100 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
107 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
108 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
109 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
110 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
111 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
112 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
113 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
114 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
119 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
120 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
123 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
124 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
125 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
126 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
128 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
129 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
130 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
135 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
141 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 18.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100269442 3300005439 Bacteria 1343
2 Ga0065707_10532361 3300005295 Unclassified 734
3 Ga0070683_100862727 3300005329 Unclassified 868
4 Ga0070692_10068495 3300005345 Bacteria 1886
5 Ga0070669_100012164 3300005353 Bacteria 6108
6 Ga0070703_10076338 3300005406 Bacteria 1131
7 Ga0070714_100290236 3300005435 Bacteria 1522
8 Ga0070701_10599593 3300005438 Bacteria 729
9 Ga0070701_10844419 3300005438 Unclassified 628
10 Ga0070705_100018422 3300005440 Bacteria 3660
11 Ga0070705_100063976 3300005440 Bacteria 2196
12 Ga0070705_100160382 3300005440 Bacteria 1503
13 Ga0070700_100004767 3300005441 Bacteria 7114
14 Ga0070694_100063880 3300005444 Bacteria 2519
15 Ga0070694_100182328 3300005444 Bacteria 1554
16 Ga0070694_100483386 3300005444 Bacteria 983
17 Ga0070708_100695515 3300005445 Bacteria 957
18 Ga0070708_100782743 3300005445 Unclassified 897
19 Ga0070662_100455599 3300005457 Bacteria 1062
20 Ga0070681_10110478 3300005458 Bacteria 2689
21 Ga0068867_100012583 3300005459 Bacteria 5983
22 Ga0070707_100556461 3300005468 Bacteria 1109
23 Ga0070697_100759332 3300005536 Unclassified 857
24 Ga0068853_101780713 3300005539 Unclassified 597
25 Ga0070695_100057114 3300005545 Bacteria 2521
26 Ga0070695_100087818 3300005545 Bacteria 2069
27 Ga0070695_100719163 3300005545 Bacteria 794
28 Ga0070695_101168739 3300005545 Unclassified 632
29 Ga0070695_101187753 3300005545 Bacteria 627
30 Ga0070696_100181362 3300005546 Unclassified 1562
31 Ga0070696_100618837 3300005546 Unclassified 875
32 Ga0070704_100000579 3300005549 Bacteria 17589
33 Ga0070704_100053478 3300005549 Bacteria 2854
34 Ga0070702_100077867 3300005615 Bacteria 1977
35 Ga0068859_100074128 3300005617 Bacteria 3442
36 Ga0068864_101026501 3300005618 Bacteria 819
37 Ga0068861_100016135 3300005719 Bacteria 5278
38 Ga0068862_100039848 3300005844 Bacteria 3992
39 Ga0068862_100060374 3300005844 Bacteria 3257
40 Ga0068862_100255209 3300005844 Unclassified 1599
41 Ga0068862_101324290 3300005844 Unclassified 722
42 Ga0070715_10382156 3300006163 Unclassified 778
43 Ga0070716_100022149 3300006173 Bacteria 3355
44 Ga0070716_100039407 3300006173 Bacteria 2622
45 Ga0070716_100237202 3300006173 Unclassified 1235
46 Ga0070716_101666068 3300006173 Unclassified 525
47 Ga0075428_100031285 3300006844 Bacteria 5885
48 Ga0075428_100498623 3300006844 Bacteria 1303
49 Ga0075431_100005878 3300006847 Bacteria 12147
50 Ga0075433_11586380 3300006852 Bacteria 565
51 Ga0075434_100170094 3300006871 Bacteria 2199
52 Ga0075429_100002905 3300006880 Bacteria 14530
53 Ga0068865_100125914 3300006881 Bacteria 1912
54 Ga0075436_100065314 3300006914 Bacteria 2516
55 Ga0097620_100074129 3300006931 Bacteria 3442
56 Ga0099794_10071007 3300007265 Bacteria 1705
57 Ga0099794_10072774 3300007265 Bacteria 1685
58 Ga0099795_10021359 3300007788 Bacteria 2122
59 Ga0111539_10388774 3300009094 Bacteria 1624
60 Ga0111539_10472377 3300009094 Bacteria 1460
61 Ga0111539_10648643 3300009094 Bacteria 1229
62 Ga0111539_10981632 3300009094 Bacteria 982
63 Ga0111539_11101125 3300009094 Bacteria 923
64 Ga0114129_10027903 3300009147 Bacteria 7994
65 Ga0114129_10361533 3300009147 Bacteria 1920
66 Ga0114129_10505376 3300009147 Bacteria 1578
67 Ga0114129_10696235 3300009147 Bacteria 1306
68 Ga0105243_10107853 3300009148 Bacteria 2324
69 Ga0105243_10108874 3300009148 Bacteria 2314
70 Ga0105248_12309612 3300009177 Unclassified 612
71 Ga0105237_10045067 3300009545 Bacteria 4440
72 Ga0105249_10025435 3300009553 Bacteria 5329
73 Ga0099796_10133184 3300010159 Bacteria 965
74 Ga0157369_10609442 3300013105 Bacteria 1127
75 Ga0157372_10150430 3300013307 Bacteria 2686
76 Ga0157380_10061477 3300014326 Bacteria 3006
77 Ga0157377_10840689 3300014745 Bacteria 681
78 Ga0207653_10062651 3300025885 Bacteria 1257
79 Ga0207642_10729468 3300025899 Unclassified 626
80 Ga0207685_10276066 3300025905 Unclassified 823
81 Ga0207643_10236192 3300025908 Bacteria 1122
82 Ga0207660_10400108 3300025917 Bacteria 1106
83 Ga0207662_10393402 3300025918 Unclassified 938
84 Ga0207662_10456231 3300025918 Unclassified 875
85 Ga0207646_10279883 3300025922 Bacteria 1508
86 Ga0207646_10704663 3300025922 Bacteria 903
87 Ga0207646_10784179 3300025922 Unclassified 849
88 Ga0207681_10050000 3300025923 Bacteria 2827
89 Ga0207664_10109942 3300025929 Unclassified 2291
90 Ga0207706_10422633 3300025933 Bacteria 1154
91 Ga0207709_10041299 3300025935 Bacteria 2767
92 Ga0207709_10286688 3300025935 Bacteria 1218
93 Ga0207709_10625738 3300025935 Unclassified 855
94 Ga0207670_10116867 3300025936 Bacteria 1932
95 Ga0207704_10290042 3300025938 Bacteria 1248
96 Ga0207665_10018654 3300025939 Bacteria 4557
97 Ga0207665_10082347 3300025939 Bacteria 2217
98 Ga0207665_10416753 3300025939 Unclassified 1025
99 Ga0207691_10095598 3300025940 Bacteria 2657
100 Ga0207689_10034975 3300025942 Bacteria 4174
101 Ga0207661_10221660 3300025944 Bacteria 1672
102 Ga0207712_10217783 3300025961 Bacteria 1525
103 Ga0207668_10070488 3300025972 Bacteria 2493
104 Ga0207708_10020173 3300026075 Bacteria 5026
105 Ga0207648_10020453 3300026089 Bacteria 5959
106 Ga0207648_11440417 3300026089 Bacteria 647
107 Ga0207675_100005283 3300026118 Bacteria 12420
108 Ga0207675_100087388 3300026118 Bacteria 2928
109 Ga0209969_1002690 3300027360 Bacteria 2464
110 Ga0209967_1001691 3300027364 Bacteria 2834
111 Ga0209981_1001482 3300027378 Bacteria 2963
112 Ga0209996_1001733 3300027395 Bacteria 2658
113 Ga0210000_1000464 3300027462 Bacteria 5576
114 Ga0209995_1003360 3300027471 Bacteria 2552
115 Ga0209179_1005323 3300027512 Unclassified 2005
116 Ga0209999_1000818 3300027543 Bacteria 5136
117 Ga0209588_1009826 3300027671 Bacteria 2866
118 Ga0209966_1012303 3300027695 Bacteria 1571
119 Ga0268265_10139350 3300028380 Bacteria 2028
120 Ga0268265_11022593 3300028380 Bacteria 817
121 Ga0307408_100326593 3300031548 Bacteria 1294
122 Ga0307408_100429600 3300031548 Bacteria 1141
123 Ga0316575_10325636 3300031665 Unclassified 652
124 Ga0307405_11617205 3300031731 Unclassified 572
125 Ga0307413_10753341 3300031824 Bacteria 814
126 Ga0307413_11271386 3300031824 Bacteria 643
127 Ga0307406_10605374 3300031901 Bacteria 904
128 Ga0307407_10184034 3300031903 Bacteria 1387
129 Ga0307412_11489161 3300031911 Bacteria 615
130 Ga0307409_101896445 3300031995 Bacteria 625
131 Ga0307416_100937600 3300032002 Bacteria 967
132 Ga0307411_10200020 3300032005 Bacteria 1533
133 Ga0373934_0111455 3300035086 Bacteria 1110
134 Ga0373952_0123469 3300035092 Bacteria 705
135 Ga0373954_0094017 3300035118 Bacteria 1442
136 Ga0373956_0010337 3300035119 Bacteria 3823
137 Ga0373955_0357166 3300035172 Bacteria 885
138 Ga0373961_0124969 3300035241 Bacteria 856
139 Ga0316574_0001113 3300035398 Bacteria 12311
140 Ga0373924_0014903 3300035410 Bacteria 2943
141 Ga0373931_0071896 3300035691 Bacteria 1891
142 Ga0373933_0001756 3300035724 Bacteria 12578
143 Ga0373947_0680289 3300035725 Bacteria 702
144 Ga0373937_0003796 3300036401 Bacteria 12767
145 Ga0373937_0069559 3300036401 Bacteria 3246
146 Ga0373925_0140357 3300037068 Bacteria 1891
147 Ga0439461_0030297 3300041410 Bacteria 1124
148 Ga0439433_0058772 3300041999 Unclassified 915
149 Ga0439441_042302 3300042001 Bacteria 917
150 Ga0439446_0016327 3300042156 Unclassified 2067
151 Ga0439434_0006415 3300042435 Bacteria 3434
152 Ga0439434_0101776 3300042435 Bacteria 926
153 Ga0439435_0001074 3300042436 Bacteria 4848
154 Ga0451577_0062535 3300042876 Bacteria 3320
155 Ga0451577_0190529 3300042876 Bacteria 1850
156 Ga0453684_0781696 3300044712 Unclassified 1031
157 Ga0451576_0033544 3300045051 Bacteria 5457
158 Ga0451576_1009841 3300045051 Bacteria 872
159 Ga0495651_0108013 3300046462 Bacteria 2061
160 Ga0495608_0397404 3300046511 Bacteria 843
161 Ga0495644_0119729 3300046523 Bacteria 1001
162 Ga0495652_0151449 3300046529 Bacteria 1812
163 Ga0495598_0030621 3300046537 Bacteria 1509
164 Ga0495656_0084032 3300046615 Bacteria 1443
165 Ga0495656_0278706 3300046615 Bacteria 852
166 Ga0495635_0551730 3300046663 Bacteria 755
167 Ga0495659_0415249 3300046664 Bacteria 582
168 Ga0495669_0046797 3300046684 Bacteria 1931
169 Ga0495600_0132947 3300046809 Bacteria 1617
170 Ga0495680_0059973 3300047322 Bacteria 2935
171 Ga0501048_0371338 3300049582 Unclassified 1021
172 Ga0501071_0799991 3300049587 Unclassified 727
173 Ga0501072_0368890 3300049588 Bacteria 1140
174 Ga0501072_0565244 3300049588 Unclassified 898
175 Ga0501073_0141921 3300049589 Unclassified 1664
176 Ga0501221_124545 3300049704 Bacteria 662
177 Ga0501080_0352012 3300049742 Unclassified 1330
178 Ga0501045_0392580 3300049824 Bacteria 1033
179 nmdc:mga05p37_4605_c1 3300050507 Bacteria 16122
180 nmdc:mga05p37_569441_c1 3300050507 Bacteria 1285
181 nmdc:mga09592_885251_c1 3300050508 Bacteria 751
182 nmdc:mga09592_940_c1 3300050508 Bacteria 22891
183 nmdc:mga0qj67_139870_c1 3300050509 Bacteria 1963
184 nmdc:mga06r32_196608_c1 3300050510 Bacteria 2004
185 nmdc:mga06r32_62237_c1 3300050510 Bacteria 3595
186 nmdc:mga08y16_2109144_c1 3300050511 Bacteria 511
187 nmdc:mga08y16_527701_c1 3300050511 Bacteria 1197
188 nmdc:mga0rr50_1437357_c1 3300050513 Unclassified 583
189 nmdc:mga0a205_107158_c1 3300050515 Bacteria 2692
190 nmdc:mga0a205_1330820_c1 3300050515 Bacteria 566
191 Ga0590075_178205 3300059424 Bacteria 562
192 Ga0530510_1159630 3300061734 Unclassified 592
193 Ga0070711_100269442
194 Ga0065707_10532361
195 Ga0070683_100862727
196 Ga0070692_10068495
197 Ga0070669_100012164
198 Ga0070703_10076338
199 Ga0070714_100290236
200 Ga0070701_10599593
201 Ga0070701_10844419
202 Ga0070705_100018422
203 Ga0070705_100063976
204 Ga0070705_100160382
205 Ga0070700_100004767
206 Ga0070694_100063880
207 Ga0070694_100182328
208 Ga0070694_100483386
209 Ga0070708_100695515
210 Ga0070708_100782743
211 Ga0070662_100455599
212 Ga0070681_10110478
213 Ga0068867_100012583
214 Ga0070707_100556461
215 Ga0070697_100759332
216 Ga0068853_101780713
217 Ga0070695_100057114
218 Ga0070695_100087818
219 Ga0070695_100719163
220 Ga0070695_101168739
221 Ga0070695_101187753
222 Ga0070696_100181362
223 Ga0070696_100618837
224 Ga0070704_100000579
225 Ga0070704_100053478
226 Ga0070702_100077867
227 Ga0068859_100074128
228 Ga0068864_101026501
229 Ga0068861_100016135
230 Ga0068862_100039848
231 Ga0068862_100060374
232 Ga0068862_100255209
233 Ga0068862_101324290
234 Ga0070715_10382156
235 Ga0070716_100022149
236 Ga0070716_100039407
237 Ga0070716_100237202
238 Ga0070716_101666068
239 Ga0075428_100031285
240 Ga0075428_100498623
241 Ga0075431_100005878
242 Ga0075433_11586380
243 Ga0075434_100170094
244 Ga0075429_100002905
245 Ga0068865_100125914
246 Ga0075436_100065314
247 Ga0097620_100074129
248 Ga0099794_10071007
249 Ga0099794_10072774
250 Ga0099795_10021359
251 Ga0111539_10388774
252 Ga0111539_10472377
253 Ga0111539_10648643
254 Ga0111539_10981632
255 Ga0111539_11101125
256 Ga0114129_10027903
257 Ga0114129_10361533
258 Ga0114129_10505376
259 Ga0114129_10696235
260 Ga0105243_10107853
261 Ga0105243_10108874
262 Ga0105248_12309612
263 Ga0105237_10045067
264 Ga0105249_10025435
265 Ga0099796_10133184
266 Ga0157369_10609442
267 Ga0157372_10150430
268 Ga0157380_10061477
269 Ga0157377_10840689
270 Ga0207653_10062651
271 Ga0207642_10729468
272 Ga0207685_10276066
273 Ga0207643_10236192
274 Ga0207660_10400108
275 Ga0207662_10393402
276 Ga0207662_10456231
277 Ga0207646_10279883
278 Ga0207646_10704663
279 Ga0207646_10784179
280 Ga0207681_10050000
281 Ga0207664_10109942
282 Ga0207706_10422633
283 Ga0207709_10041299
284 Ga0207709_10286688
285 Ga0207709_10625738
286 Ga0207670_10116867
287 Ga0207704_10290042
288 Ga0207665_10018654
289 Ga0207665_10082347
290 Ga0207665_10416753
291 Ga0207691_10095598
292 Ga0207689_10034975
293 Ga0207661_10221660
294 Ga0207712_10217783
295 Ga0207668_10070488
296 Ga0207708_10020173
297 Ga0207648_10020453
298 Ga0207648_11440417
299 Ga0207675_100005283
300 Ga0207675_100087388
301 Ga0209969_1002690
302 Ga0209967_1001691
303 Ga0209981_1001482
304 Ga0209996_1001733
305 Ga0210000_1000464
306 Ga0209995_1003360
307 Ga0209179_1005323
308 Ga0209999_1000818
309 Ga0209588_1009826
310 Ga0209966_1012303
311 Ga0268265_10139350
312 Ga0268265_11022593
313 Ga0307408_100326593
314 Ga0307408_100429600
315 Ga0316575_10325636
316 Ga0307405_11617205
317 Ga0307413_10753341
318 Ga0307413_11271386
319 Ga0307406_10605374
320 Ga0307407_10184034
321 Ga0307412_11489161
322 Ga0307409_101896445
323 Ga0307416_100937600
324 Ga0307411_10200020
325 Ga0373934_0111455
326 Ga0373952_0123469
327 Ga0373954_0094017
328 Ga0373956_0010337
329 Ga0373955_0357166
330 Ga0373961_0124969
331 Ga0316574_0001113
332 Ga0373924_0014903
333 Ga0373931_0071896
334 Ga0373933_0001756
335 Ga0373947_0680289
336 Ga0373937_0003796
337 Ga0373937_0069559
338 Ga0373925_0140357
339 Ga0439461_0030297
340 Ga0439433_0058772
341 Ga0439441_042302
342 Ga0439446_0016327
343 Ga0439434_0006415
344 Ga0439434_0101776
345 Ga0439435_0001074
346 Ga0451577_0062535
347 Ga0451577_0190529
348 Ga0453684_0781696
349 Ga0451576_0033544
350 Ga0451576_1009841
351 Ga0495651_0108013
352 Ga0495608_0397404
353 Ga0495644_0119729
354 Ga0495652_0151449
355 Ga0495598_0030621
356 Ga0495656_0084032
357 Ga0495656_0278706
358 Ga0495635_0551730
359 Ga0495659_0415249
360 Ga0495669_0046797
361 Ga0495600_0132947
362 Ga0495680_0059973
363 Ga0501048_0371338
364 Ga0501071_0799991
365 Ga0501072_0368890
366 Ga0501072_0565244
367 Ga0501073_0141921
368 Ga0501221_124545
369 Ga0501080_0352012
370 Ga0501045_0392580
371 nmdc:mga05p37_4605_c1
372 nmdc:mga05p37_569441_c1
373 nmdc:mga09592_885251_c1
374 nmdc:mga09592_940_c1
375 nmdc:mga0qj67_139870_c1
376 nmdc:mga06r32_196608_c1
377 nmdc:mga06r32_62237_c1
378 nmdc:mga08y16_2109144_c1
379 nmdc:mga08y16_527701_c1
380 nmdc:mga0rr50_1437357_c1
381 nmdc:mga0a205_107158_c1
382 nmdc:mga0a205_1330820_c1
383 Ga0590075_178205
384 Ga0530510_1159630

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07386

DUF1499

Protein of unknown function (DUF1499)

34

144

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1mwo-assembly1.cif.gz_A crystal structure analysis of the hyperthermostable pyrocoocus woesei alpha-amylase 0.8248 60 88
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7333 42 74
5zfr-assembly1.cif.gz_C-2 crystal structure of pilb, an extension atpase motor of type iv pilus, from geobacter sulfurreducens 0.7256 68 100
9cgt-assembly1.cif.gz_A structure of cyclodextrin glycosyltransferase complexed with a thio-maltopentaose 0.725 53 88
6li9-assembly1.cif.gz_A heteromeric amino acid transporter b0,+at-rbat complex bound with arginine 0.7185 60 89
ID Description Score Start End Superfamily
af_Q9LZY2_79_203_3.30.310.50 Alpha Beta;2-Layer Sandwich;TATA-Binding Protein;Alpha-D-phosphohexomutase, C-terminal domain 0.9149 16 120 3.30.310.50
af_Q95RQ7_11_360_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8363 60 100 2.130.10.10
1lwjB03 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8344 60 88 2.60.40.1180
1mwoA02 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.8248 60 88 2.60.40.1180
af_Q07837_570_652_2.60.40.1180 Mainly Beta;Sandwich;Immunoglobulin-like;Golgi alpha-mannosidase II 0.7767 62 89 2.60.40.1180
ID Description Score Start End GO Terms
AF-A0A6P0IGF4-F1-model_v4 DUF1499 domain-containing protein 0.9784 47 121
AF-A0A372DEC0-F1-model_v4 DUF1499 domain-containing protein 0.9712 5 123
AF-A0A1C0VDI2-F1-model_v4 DUF1499 domain-containing protein 0.9679 5 123
AF-A0A401FS97-F1-model_v4 DUF1499 domain-containing protein 0.9658 5 125
AF-A0A0V7ZBR0-F1-model_v4 DUF1499 domain-containing protein 0.9628 5 123

Map