F295105

General Info

Members Datasets Scaffolds Average Seq Length
192 123 188 410

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100055984|Ga0068869_1000559842
Length 448
Sequence VPRASGNDQSESLAAPAPQCMLRPMTDWNFLAVAILIALFLLWKLDFAATLLNLKAFPESVPAPLAGVLDADALDRARAYLRDNARFKILQSSVMLALLIGFWTFGGFAWLDDLARQLSGGRPIVRGLWFFAGIALGSSLAGLPFEWFHTFVIEEKFGFNRATVATFWSDRLKGLLLGAAIGLPLAAAVLWIFLHVGHAWLWAWGVFTVVQLLLAYLAPSLILPLFNRFTPMPESDLRRKIEALGARCGFPLDGVFVMDGSKRSAKANAFFTGFGKRKKIAIFDTLLEKHDDDELLAVLAHEIGHFRRGHIRQRIAVGILQSAALFFLLGLATDPRGTFARQLFDAFGVREITPHVGLVLFSLLFEPVSRLLGVVANAWSRRHEFEADAFAAEATGGPLPLASALKKLSVDQLAHPSPHPLRVWLDYSHPPLLRRLEALLKGRAADLR

Samples

Sample ID Description Type Environment
1 2740891818 Desulfofaba hansenii DSM 12642 Isolate Unclassified
2 2786546517 Verrucomicrobia bacterium LW23 Isolate Rhizoplane
3 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
4 2884634485 Algoriphagus kandeliae XY-J91 Isolate Unclassified
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
34 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
35 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
38 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
48 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
49 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
50 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
62 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
63 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
64 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
67 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
68 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
69 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
70 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
73 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
76 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
77 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
78 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
79 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
80 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
81 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
82 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
83 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
84 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
85 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
86 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
87 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
88 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
89 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
90 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
91 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
92 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
93 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
94 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
95 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
96 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
97 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
98 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
99 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
100 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
101 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
102 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
105 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
106 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
107 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
108 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
109 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
110 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
111 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
112 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
113 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
114 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
115 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
116 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
117 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
118 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
119 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
120 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
121 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.4
Metatranscriptomes 0.52
Isolates 2.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.81
Nodule 0
Rhizoplane 0.52
Rhizosphere 78.65
Stem 0
Stem Tuber 0
Unclassified 13.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1000097 3300001977 Bacteria 9825
2 rootH1_10001629 3300003316 Bacteria 29048
3 rootH2_10003246 3300003320 Bacteria 168239
4 rootH2_10015166 3300003320 Bacteria 33417
5 rootH2_10174675 3300003320 Bacteria 3966
6 rootH2_10263850 3300003320 Bacteria 3122
7 rootL2_10004752 3300003322 Bacteria 7433
8 rootH1_10006351 3300003323 Bacteria 17213
9 rootH1_10110103 3300003323 Bacteria 5194
10 JGI25405J52794_10000878 3300003911 Unclassified 4696
11 Ga0065704_10079528 3300005289 Bacteria 4140
12 Ga0070658_10004013 3300005327 Bacteria 12061
13 Ga0068869_100055984 3300005334 Bacteria 2875
14 Ga0070660_100237338 3300005339 Unclassified 1484
15 Ga0070661_100008202 3300005344 Bacteria 7203
16 Ga0070688_100088092 3300005365 Bacteria 2023
17 Ga0070709_10103328 3300005434 Bacteria 1902
18 Ga0070708_100016905 3300005445 Bacteria 6067
19 Ga0070708_100173181 3300005445 Unclassified 2016
20 Ga0068867_100000151 3300005459 Bacteria 44554
21 Ga0070706_100001178 3300005467 Bacteria 28119
22 Ga0070706_100021590 3300005467 Bacteria 5928
23 Ga0070698_100010505 3300005471 Bacteria 9870
24 Ga0070699_100059144 3300005518 Bacteria 3320
25 Ga0070686_100079381 3300005544 Bacteria 2169
26 Ga0070665_100227576 3300005548 Bacteria 1865
27 Ga0070664_100000437 3300005564 Bacteria 31349
28 Ga0068857_100120162 3300005577 Bacteria 2365
29 Ga0068863_100014792 3300005841 Bacteria 7503
30 Ga0068860_100002842 3300005843 Bacteria 17986
31 Ga0068860_100341120 3300005843 Bacteria 1473
32 Ga0081455_10008714 3300005937 Bacteria 10505
33 Ga0081538_10000604 3300005981 Bacteria 39782
34 Ga0081538_10021237 3300005981 Bacteria 4748
35 Ga0081539_10014566 3300005985 Bacteria 5803
36 Ga0070717_10195297 3300006028 Bacteria 1770
37 Ga0075362_10007923 3300006177 Bacteria 4043
38 Ga0075366_10052479 3300006195 Bacteria 2422
39 Ga0075366_10059014 3300006195 Unclassified 2279
40 Ga0075370_10085050 3300006353 Unclassified 1821
41 Ga0075428_100004619 3300006844 Bacteria 15233
42 Ga0075428_100030936 3300006844 Bacteria 5919
43 Ga0075430_100007440 3300006846 Bacteria 9244
44 Ga0075431_100075901 3300006847 Unclassified 3468
45 Ga0075429_100200256 3300006880 Unclassified 1749
46 Ga0111539_10025624 3300009094 Bacteria 7227
47 Ga0114129_10382267 3300009147 Bacteria 1859
48 Ga0105243_10000110 3300009148 Bacteria 93759
49 Ga0105249_10049538 3300009553 Unclassified 3831
50 Ga0157373_10003367 3300013100 Bacteria 12087
51 Ga0157371_10121617 3300013102 Bacteria 1856
52 Ga0157370_10000352 3300013104 Bacteria 58319
53 Ga0157379_10043895 3300014968 Bacteria 3992
54 Ga0213872_10005126 3300021361 Bacteria 6791
55 Ga0213872_10047734 3300021361 Bacteria 1946
56 Ga0213876_10001054 3300021384 Bacteria 17809
57 Ga0207705_10001663 3300025909 Bacteria 17676
58 Ga0207684_10000420 3300025910 Bacteria 56576
59 Ga0207684_10069874 3300025910 Unclassified 2984
60 Ga0207649_10043966 3300025920 Bacteria 2734
61 Ga0207687_10029809 3300025927 Bacteria 3672
62 Ga0207700_10271635 3300025928 Bacteria 1455
63 Ga0207709_10000204 3300025935 Bacteria 77293
64 Ga0207679_10106591 3300025945 Bacteria 2203
65 Ga0207648_10000076 3300026089 Bacteria 93717
66 Ga0207674_10139325 3300026116 Bacteria 2386
67 Ga0207428_10034685 3300027907 Unclassified 4131
68 Ga0268264_10004547 3300028381 Bacteria 11816
69 Ga0265323_10000975 3300028653 Bacteria 14931
70 Ga0265322_10000362 3300028654 Bacteria 18876
71 Ga0307511_10021536 3300030521 Bacteria 6067
72 Ga0265325_10043427 3300031241 Bacteria 2346
73 Ga0265327_10002089 3300031251 Bacteria 22248
74 Ga0265327_10012452 3300031251 Bacteria 5738
75 Ga0265316_10000618 3300031344 Bacteria 39590
76 Ga0265316_10006709 3300031344 Bacteria 10969
77 Ga0307408_100000070 3300031548 Bacteria 119377
78 Ga0316576_10000937 3300031727 Bacteria 14903
79 Ga0316576_10003415 3300031727 Bacteria 9296
80 Ga0316576_10061350 3300031727 Bacteria 2756
81 Ga0316576_10090684 3300031727 Bacteria 2277
82 Ga0316576_10095290 3300031727 Bacteria 2220
83 Ga0316578_10007457 3300031728 Bacteria 5490
84 Ga0316577_10086817 3300031733 Unclassified 1751
85 Ga0307413_10036431 3300031824 Bacteria 2832
86 Ga0307406_10006773 3300031901 Bacteria 6337
87 Ga0307407_10000043 3300031903 Bacteria 64968
88 Ga0307412_10000114 3300031911 Bacteria 61933
89 Ga0307409_100100798 3300031995 Bacteria 2394
90 Ga0307414_10000003 3300032004 Bacteria 519751
91 Ga0307414_10002898 3300032004 Bacteria 9069
92 Ga0307414_10067483 3300032004 Bacteria 2562
93 Ga0307414_10079560 3300032004 Bacteria 2393
94 Ga0316583_10023207 3300032133 Unclassified 2218
95 Ga0316596_1010806 3300033541 Unclassified 2219
96 Ga0316584_0039330 3300036712 Bacteria 3521
97 Ga0316584_0182693 3300036712 Unclassified 1552
98 Ga0436364_1338308 3300037853 Bacteria 2061
99 Ga0400484_24086 3300038725 Bacteria 9155
100 Ga0400490_09938 3300038726 Bacteria 131324
101 Ga0400485_02405 3300038735 Bacteria 20830
102 Ga0400488_62943 3300038741 Unclassified 1713
103 Ga0400486_23990 3300038742 Bacteria 12926
104 Ga0400489_36426 3300039093 Bacteria 73193
105 Ga0400489_65311 3300039093 Bacteria 5825
106 Ga0436365_0929814 3300039437 Bacteria 3601
107 Ga0436365_1233928 3300039437 Bacteria 64859
108 Ga0436365_1712468 3300039437 Bacteria 26288
109 Ga0436360_0645992 3300039438 Bacteria 2520
110 Ga0436360_0704662 3300039438 Bacteria 7161
111 Ga0436360_1112264 3300039438 Bacteria 3672
112 Ga0436361_0289571 3300039447 Bacteria 2143
113 Ga0436361_0567552 3300039447 Bacteria 3689
114 Ga0436361_0606730 3300039447 Bacteria 1546
115 Ga0436363_1603526 3300039450 Bacteria 7891
116 Ga0439453_0003465 3300041408 Bacteria 2272
117 Ga0450920_010105 3300042122 Bacteria 1747
118 Ga0450890_000061 3300042127 Bacteria 21030
119 Ga0450889_002070 3300042144 Bacteria 2012
120 Ga0450908_000486 3300042184 Bacteria 7635
121 Ga0450893_0001848 3300042532 Bacteria 3269
122 Ga0451577_0000205 3300042876 Bacteria 123564
123 Ga0451577_0000431 3300042876 Bacteria 75097
124 Ga0451577_0001104 3300042876 Bacteria 38380
125 Ga0451577_0002209 3300042876 Bacteria 23696
126 Ga0451577_0009910 3300042876 Bacteria 9133
127 Ga0451577_0010220 3300042876 Bacteria 8989
128 Ga0451577_0011004 3300042876 Bacteria 8592
129 Ga0451577_0044122 3300042876 Bacteria 3992
130 Ga0451577_0050396 3300042876 Bacteria 3716
131 Ga0451577_0061729 3300042876 Bacteria 3342
132 Ga0451577_0074666 3300042876 Bacteria 3023
133 Ga0453683_0000155 3300044673 Bacteria 100950
134 Ga0453683_0001297 3300044673 Bacteria 22092
135 Ga0453683_0007004 3300044673 Bacteria 7685
136 Ga0453683_0054686 3300044673 Bacteria 2498
137 Ga0453683_0133002 3300044673 Bacteria 1568
138 Ga0453684_0000091 3300044712 Bacteria 387720
139 Ga0453684_0000177 3300044712 Bacteria 282969
140 Ga0453684_0000281 3300044712 Bacteria 219577
141 Ga0453684_0000572 3300044712 Bacteria 137431
142 Ga0453684_0003426 3300044712 Bacteria 35772
143 Ga0453684_0008258 3300044712 Bacteria 18768
144 Ga0453684_0011549 3300044712 Bacteria 14775
145 Ga0453684_0015716 3300044712 Bacteria 11924
146 Ga0453684_0017937 3300044712 Bacteria 10909
147 Ga0453684_0051451 3300044712 Bacteria 5400
148 Ga0453684_0066827 3300044712 Bacteria 4576
149 Ga0453684_0091959 3300044712 Bacteria 3742
150 Ga0453684_0097432 3300044712 Bacteria 3609
151 Ga0453684_0270202 3300044712 Bacteria 1943
152 Ga0453684_0279841 3300044712 Bacteria 1903
153 Ga0451576_0000363 3300045051 Bacteria 108839
154 Ga0451576_0001097 3300045051 Bacteria 49425
155 Ga0451576_0007665 3300045051 Bacteria 12831
156 Ga0451576_0014143 3300045051 Bacteria 8892
157 Ga0451576_0062090 3300045051 Bacteria 3896
158 Ga0451576_0091353 3300045051 Bacteria 3167
159 Ga0451576_0113828 3300045051 Bacteria 2816
160 Ga0451576_0211406 3300045051 Bacteria 2026
161 Ga0451576_0292014 3300045051 Bacteria 1704
162 Ga0496121_0067700 3300048924 Bacteria 2893
163 Ga0501032_0013174 3300049569 Bacteria 5885
164 Ga0501034_0000603 3300049571 Bacteria 56634
165 Ga0501048_0097824 3300049582 Unclassified 2071
166 Ga0501073_0038697 3300049589 Unclassified 3382
167 Ga0501227_000285 3300049665 Bacteria 10423
168 Ga0501080_0002276 3300049742 Bacteria 16708
169 Ga0501080_0024002 3300049742 Bacteria 5653
170 Ga0501263_005171 3300049760 Unclassified 1463
171 Ga0501035_0222821 3300049822 Bacteria 1610
172 nmdc:mga0k408_217547_c1 3300050493 Bacteria 1140
173 nmdc:mga0k408_5021_c1 3300050493 Bacteria 7008
174 nmdc:mga07m45_2876_c1 3300050496 Bacteria 7819
175 nmdc:mga05p37_60902_c1 3300050507 Unclassified 4647
176 nmdc:mga09592_84591_c1 3300050508 Bacteria 2705
177 nmdc:mga0qj67_84461_c1 3300050509 Unclassified 2546
178 nmdc:mga06r32_23779_c1 3300050510 Bacteria 5676
179 nmdc:mga08y16_387228_c1 3300050511 Unclassified 1432
180 nmdc:mga08y16_73140_c1 3300050511 Bacteria 3572
181 Ga0500643_004810 3300053087 Bacteria 5966
182 Ga0500555_000214 3300053103 Bacteria 26574
183 Ga0500556_0000478 3300053104 Bacteria 27954
184 Ga0500642_0004795 3300053130 Bacteria 4280
185 Ga0500559_0002153 3300053136 Bacteria 10462
186 Ga0500616_0001646 3300053153 Bacteria 20652
187 Ga0500622_0000141 3300053156 Bacteria 76332
188 Ga0500622_0000155 3300053156 Bacteria 72050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050493 nmdc:mga0k408_217547_c1 nmdc:mga0k408_217547_c1_63_1085 339
2 3300038741 Ga0400488_62943 Ga0400488_62943_15_1076 343
3 3300013102 Ga0157371_10121617 Ga0157371_101216172 346
4 3300049582 Ga0501048_0097824 Ga0501048_0097824_919_1968 348
5 3300049822 Ga0501035_0222821 Ga0501035_0222821_426_1475 348
6 3300036712 Ga0316584_0182693 Ga0316584_0182693_378_1508 365
7 3300044712 Ga0453684_0279841 Ga0453684_0279841_223_1485 377
8 3300044712 Ga0453684_0091959 Ga0453684_0091959_1550_2689 378
9 3300042876 Ga0451577_0000205 Ga0451577_0000205_32331_33575 385
10 3300044712 Ga0453684_0000281 Ga0453684_0000281_175249_176493 385
11 3300038726 Ga0400490_09938 Ga0400490_09938_16705_17961 388
12 3300030521 Ga0307511_10021536 Ga0307511_100215362 389
13 3300031727 Ga0316576_10095290 Ga0316576_100952901 390
14 3300032004 Ga0307414_10002898 Ga0307414_100028983 390
15 3300037853 Ga0436364_1338308 Ga0436364_1338308_617_1864 390
16 3300005434 Ga0070709_10103328 Ga0070709_101033281 391
17 3300039450 Ga0436363_1603526 Ga0436363_1603526_158_1414 391
18 3300049571 Ga0501034_0000603 Ga0501034_0000603_13041_14279 391
19 3300006028 Ga0070717_10195297 Ga0070717_101952971 392
20 3300021361 Ga0213872_10005126 Ga0213872_100051268 392
21 3300021361 Ga0213872_10047734 Ga0213872_100477341 392
22 3300025928 Ga0207700_10271635 Ga0207700_102716351 392
23 3300039437 Ga0436365_1233928 Ga0436365_1233928_37192_38436 392
24 3300039447 Ga0436361_0289571 Ga0436361_0289571_694_1941 392
25 3300039447 Ga0436361_0567552 Ga0436361_0567552_228_1475 392
26 3300050496 nmdc:mga07m45_2876_c1 nmdc:mga07m45_2876_c1_1951_3234 394
27 3300003320 rootH2_10174675 rootH2_101746752 395
28 3300049760 Ga0501263_005171 Ga0501263_005171_233_1435 395
29 3300053156 Ga0500622_0000141 Ga0500622_0000141_59975_61207 395
30 3300005981 Ga0081538_10021237 Ga0081538_100212375 396
31 3300031727 Ga0316576_10090684 Ga0316576_100906842 396
32 3300044673 Ga0453683_0000155 Ga0453683_0000155_5570_6796 396
33 3300044712 Ga0453684_0066827 Ga0453684_0066827_355_1581 396
34 3300045051 Ga0451576_0000363 Ga0451576_0000363_44570_45796 396
35 3300042122 Ga0450920_010105 Ga0450920_010105_480_1706 397
36 3300042184 Ga0450908_000486 Ga0450908_000486_5321_6547 397
37 3300042876 Ga0451577_0044122 Ga0451577_0044122_213_1451 397
38 3300044712 Ga0453684_0097432 Ga0453684_0097432_1051_2289 397
39 3300003316 rootH1_10001629 rootH1_1000162916 398
40 3300003320 rootH2_10003246 rootH2_1000324656 398
41 3300003322 rootL2_10004752 rootL2_100047526 398
42 3300003323 rootH1_10006351 rootH1_1000635113 398
43 3300049742 Ga0501080_0024002 Ga0501080_0024002_2933_4168 398
44 3300049665 Ga0501227_000285 Ga0501227_000285_6948_8195 399
45 3300053136 Ga0500559_0002153 Ga0500559_0002153_874_2124 399
46 3300039438 Ga0436360_0645992 Ga0436360_0645992_832_2079 400
47 3300031733 Ga0316577_10086817 Ga0316577_100868172 401
48 3300031901 Ga0307406_10006773 Ga0307406_100067733 401
49 3300031995 Ga0307409_100100798 Ga0307409_1001007982 401
50 3300049742 Ga0501080_0002276 Ga0501080_0002276_9315_10553 401
51 3300039093 Ga0400489_36426 Ga0400489_36426_49473_50684 402
52 3300032004 Ga0307414_10000003 Ga0307414_10000003269 403
53 3300044673 Ga0453683_0007004 Ga0453683_0007004_5524_6759 403
54 3300044712 Ga0453684_0270202 Ga0453684_0270202_165_1400 403
55 3300045051 Ga0451576_0001097 Ga0451576_0001097_29178_30413 403
56 3300031251 Ga0265327_10012452 Ga0265327_100124525 404
57 3300053087 Ga0500643_004810 Ga0500643_004810_1806_3068 404
58 3300005445 Ga0070708_100016905 Ga0070708_1000169056 405
59 3300005471 Ga0070698_100010505 Ga0070698_10001050510 405
60 3300005518 Ga0070699_100059144 Ga0070699_1000591442 405
61 iso_pu_bacteria 2833640130 2833640447 405
62 iso_pu_bacteria 2884634485 2884637212 405
63 3300005445 Ga0070708_100173181 Ga0070708_1001731811 406
64 3300005467 Ga0070706_100021590 Ga0070706_1000215904 406
65 3300025910 Ga0207684_10069874 Ga0207684_100698744 406
66 3300031727 Ga0316576_10061350 Ga0316576_100613502 406
67 3300042876 Ga0451577_0011004 Ga0451577_0011004_3076_4299 406
68 3300005365 Ga0070688_100088092 Ga0070688_1000880922 407
69 3300031824 Ga0307413_10036431 Ga0307413_100364312 407
70 3300042876 Ga0451577_0009910 Ga0451577_0009910_4130_5356 407
71 3300044673 Ga0453683_0054686 Ga0453683_0054686_819_2045 407
72 3300044712 Ga0453684_0003426 Ga0453684_0003426_17843_19069 407
73 3300049589 Ga0501073_0038697 Ga0501073_0038697_2098_3345 407
74 3300050511 nmdc:mga08y16_387228_c1 nmdc:mga08y16_387228_c1_100_1347 407
75 3300005985 Ga0081539_10014566 Ga0081539_100145665 408
76 3300006847 Ga0075431_100075901 Ga0075431_1000759012 408
77 3300006880 Ga0075429_100200256 Ga0075429_1002002561 408
78 3300009147 Ga0114129_10382267 Ga0114129_103822671 408
79 3300031911 Ga0307412_10000114 Ga0307412_1000011427 408
80 3300032004 Ga0307414_10079560 Ga0307414_100795602 408
81 3300039438 Ga0436360_0704662 Ga0436360_0704662_208_1497 408
82 3300042876 Ga0451577_0061729 Ga0451577_0061729_926_2155 408
83 3300044673 Ga0453683_0133002 Ga0453683_0133002_262_1491 408
84 3300044712 Ga0453684_0000091 Ga0453684_0000091_368013_369242 408
85 3300044712 Ga0453684_0017937 Ga0453684_0017937_5563_6792 408
86 3300044712 Ga0453684_0051451 Ga0453684_0051451_3165_4448 408
87 3300045051 Ga0451576_0062090 Ga0451576_0062090_1444_2673 408
88 3300045051 Ga0451576_0091353 Ga0451576_0091353_1731_2960 408
89 3300050510 nmdc:mga06r32_23779_c1 nmdc:mga06r32_23779_c1_92_1342 408
90 3300013100 Ga0157373_10003367 Ga0157373_100033676 409
91 3300032004 Ga0307414_10067483 Ga0307414_100674832 409
92 3300053156 Ga0500622_0000155 Ga0500622_0000155_13910_15142 409
93 iso_pu_bacteria 2740891818 2740990974 409
94 3300009553 Ga0105249_10049538 Ga0105249_100495381 410
95 3300031344 Ga0265316_10006709 Ga0265316_1000670910 410
96 3300042876 Ga0451577_0001104 Ga0451577_0001104_3881_5116 410
97 3300042876 Ga0451577_0002209 Ga0451577_0002209_5880_7112 410
98 3300044712 Ga0453684_0008258 Ga0453684_0008258_14314_15549 410
99 3300045051 Ga0451576_0211406 Ga0451576_0211406_296_1531 410
100 3300045051 Ga0451576_0292014 Ga0451576_0292014_173_1408 410
101 iso_pu_bacteria 2786546517 2787437273 410
102 3300003320 rootH2_10263850 rootH2_102638502 411
103 3300005327 Ga0070658_10004013 Ga0070658_100040136 411
104 3300025909 Ga0207705_10001663 Ga0207705_1000166311 411
105 3300028654 Ga0265322_10000362 Ga0265322_100003626 411
106 3300042876 Ga0451577_0010220 Ga0451577_0010220_1979_3217 411
107 3300053153 Ga0500616_0001646 Ga0500616_0001646_2924_4159 411
108 3300005548 Ga0070665_100227576 Ga0070665_1002275762 412
109 3300005843 Ga0068860_100002842 Ga0068860_1000028423 412
110 3300028381 Ga0268264_10004547 Ga0268264_100045473 412
111 3300050511 nmdc:mga08y16_73140_c1 nmdc:mga08y16_73140_c1_179_1420 412
112 3300005467 Ga0070706_100001178 Ga0070706_10000117825 413
113 3300005841 Ga0068863_100014792 Ga0068863_1000147929 413
114 3300006177 Ga0075362_10007923 Ga0075362_100079231 413
115 3300006195 Ga0075366_10052479 Ga0075366_100524792 413
116 3300006195 Ga0075366_10059014 Ga0075366_100590142 413
117 3300021384 Ga0213876_10001054 Ga0213876_1000105414 413
118 3300025910 Ga0207684_10000420 Ga0207684_1000042013 413
119 3300038725 Ga0400484_24086 Ga0400484_24086_3866_5110 413
120 3300039093 Ga0400489_65311 Ga0400489_65311_2204_3448 413
121 3300039437 Ga0436365_1712468 Ga0436365_1712468_24848_26164 413
122 3300039438 Ga0436360_1112264 Ga0436360_1112264_1799_3046 413
123 3300039447 Ga0436361_0606730 Ga0436361_0606730_117_1364 413
124 3300042876 Ga0451577_0000431 Ga0451577_0000431_4643_5887 413
125 3300044712 Ga0453684_0000177 Ga0453684_0000177_51760_53004 413
126 3300050493 nmdc:mga0k408_5021_c1 nmdc:mga0k408_5021_c1_4027_5310 413
127 3300053103 Ga0500555_000214 Ga0500555_000214_7819_9102 413
128 3300053104 Ga0500556_0000478 Ga0500556_0000478_7653_8936 413
129 3300053130 Ga0500642_0004795 Ga0500642_0004795_903_2186 413
130 3300005339 Ga0070660_100237338 Ga0070660_1002373381 414
131 3300006844 Ga0075428_100030936 Ga0075428_1000309366 414
132 3300013104 Ga0157370_10000352 Ga0157370_1000035252 414
133 3300028653 Ga0265323_10000975 Ga0265323_100009754 414
134 3300031344 Ga0265316_10000618 Ga0265316_100006184 414
135 3300031728 Ga0316578_10007457 Ga0316578_100074577 414
136 3300044712 Ga0453684_0011549 Ga0453684_0011549_13356_14624 414
137 3300045051 Ga0451576_0007665 Ga0451576_0007665_1723_3027 414
138 3300045051 Ga0451576_0014143 Ga0451576_0014143_74_1342 414
139 3300050507 nmdc:mga05p37_60902_c1 nmdc:mga05p37_60902_c1_1934_3181 414
140 3300050508 nmdc:mga09592_84591_c1 nmdc:mga09592_84591_c1_873_2120 414
141 3300003911 JGI25405J52794_10000878 JGI25405J52794_100008781 415
142 3300005544 Ga0070686_100079381 Ga0070686_1000793812 415
143 3300005843 Ga0068860_100341120 Ga0068860_1003411201 415
144 3300005937 Ga0081455_10008714 Ga0081455_100087144 415
145 3300005981 Ga0081538_10000604 Ga0081538_1000060410 415
146 3300006844 Ga0075428_100004619 Ga0075428_10000461918 415
147 3300006846 Ga0075430_100007440 Ga0075430_1000074403 415
148 3300009094 Ga0111539_10025624 Ga0111539_100256246 415
149 3300027907 Ga0207428_10034685 Ga0207428_100346853 415
150 3300031727 Ga0316576_10003415 Ga0316576_100034155 415
151 3300032133 Ga0316583_10023207 Ga0316583_100232072 415
152 3300033541 Ga0316596_1010806 Ga0316596_10108062 415
153 3300036712 Ga0316584_0039330 Ga0316584_0039330_1025_2329 415
154 3300042876 Ga0451577_0050396 Ga0451577_0050396_2044_3306 415
155 3300042876 Ga0451577_0074666 Ga0451577_0074666_1672_2922 415
156 3300044673 Ga0453683_0001297 Ga0453683_0001297_363_1613 415
157 3300044712 Ga0453684_0000572 Ga0453684_0000572_6985_8241 415
158 3300044712 Ga0453684_0015716 Ga0453684_0015716_9410_10672 415
159 3300045051 Ga0451576_0113828 Ga0451576_0113828_287_1537 415
160 3300050509 nmdc:mga0qj67_84461_c1 nmdc:mga0qj67_84461_c1_423_1673 415
161 3300014968 Ga0157379_10043895 Ga0157379_100438953 416
162 3300005289 Ga0065704_10079528 Ga0065704_100795282 417
163 3300031727 Ga0316576_10000937 Ga0316576_1000093710 419
164 3300048924 Ga0496121_0067700 Ga0496121_0067700_726_1985 419
165 3300038735 Ga0400485_02405 Ga0400485_02405_13535_14812 421
166 3300038742 Ga0400486_23990 Ga0400486_23990_5707_6984 421
167 3300039437 Ga0436365_0929814 Ga0436365_0929814_1869_3152 422
168 3300031251 Ga0265327_10002089 Ga0265327_100020897 423
169 3300003323 rootH1_10110103 rootH1_101101034 424
170 3300031241 Ga0265325_10043427 Ga0265325_100434272 424
171 3300042144 Ga0450889_002070 Ga0450889_002070_683_1957 424
172 3300049569 Ga0501032_0013174 Ga0501032_0013174_638_1912 424
173 3300001977 JGI24746J21847_1000097 JGI24746J21847_100009710 428
174 3300003320 rootH2_10015166 rootH2_100151662 428
175 3300005334 Ga0068869_100055984 Ga0068869_1000559842 428
176 3300005344 Ga0070661_100008202 Ga0070661_1000082029 428
177 3300005459 Ga0068867_100000151 Ga0068867_10000015115 428
178 3300005564 Ga0070664_100000437 Ga0070664_10000043729 428
179 3300005577 Ga0068857_100120162 Ga0068857_1001201622 428
180 3300006353 Ga0075370_10085050 Ga0075370_100850502 428
181 3300009148 Ga0105243_10000110 Ga0105243_1000011051 428
182 3300025920 Ga0207649_10043966 Ga0207649_100439663 428
183 3300025927 Ga0207687_10029809 Ga0207687_100298094 428
184 3300025935 Ga0207709_10000204 Ga0207709_1000020443 428
185 3300025945 Ga0207679_10106591 Ga0207679_101065912 428
186 3300026089 Ga0207648_10000076 Ga0207648_1000007644 428
187 3300026116 Ga0207674_10139325 Ga0207674_101393252 428
188 3300031548 Ga0307408_100000070 Ga0307408_10000007062 428
189 3300031903 Ga0307407_10000043 Ga0307407_1000004341 428
190 3300041408 Ga0439453_0003465 Ga0439453_0003465_458_1744 428
191 3300042127 Ga0450890_000061 Ga0450890_000061_4386_5672 428
192 3300042532 Ga0450893_0001848 Ga0450893_0001848_665_1951 428

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16491

Peptidase_M48_N

CAAX prenyl protease N-terminal, five membrane helices

50

228

0.96

PF01435

Peptidase_M48

Peptidase family M48

231

443

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ypt-assembly4.cif.gz_E crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.9501 11 420
2ypt-assembly2.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 mutant (e336a) in complex with a synthetic csim tetrapeptide from the c-terminus of prelamin a 0.9486 11 421
4aw6-assembly1.cif.gz_A crystal structure of the human nuclear membrane zinc metalloprotease zmpste24 (face1) 0.9478 11 421
6bh8-assembly1.cif.gz_A crystal structure of zmpste24 in complex with phosphoramidon 0.9363 90 419
6bh8-assembly2.cif.gz_B crystal structure of zmpste24 in complex with phosphoramidon 0.9359 11 419
ID Description Score Start End Superfamily
af_A0A1D8PL01_226_308_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9794 208 287 3.30.2010.10
af_Q55C18_272_352_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9735 208 287 3.30.2010.10
af_Q55C18_272_352_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9386 208 287 3.30.2010.10
af_A0A1D8PL01_226_308_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9336 208 287 3.30.2010.10
af_Q7K172_215_314_3.30.2010.10 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.9311 208 289 3.30.2010.10
ID Description Score Start End GO Terms
AF-A0A7V7VJC0-F1-model_v4 M48 family metallopeptidase 0.9973 6 421 GO:0004222
GO:0016020
GO:0046872
GO:0071586
AF-A0A858RPK1-F1-model_v4 M48 family metallopeptidase 0.9954 7 421 GO:0004222
GO:0016020
GO:0046872
GO:0071586
AF-A0A848WRE5-F1-model_v4 M48 family metallopeptidase 0.9925 7 421 GO:0004222
GO:0016020
GO:0046872
GO:0071586
AF-A0A858RPK1-F1-model_v4 M48 family metallopeptidase 0.9882 7 421 GO:0004222
GO:0016020
GO:0046872
GO:0071586
AF-A0A838YH48-F1-model_v4 M48 family metallopeptidase 0.9866 6 422 GO:0004222
GO:0016020
GO:0046872
GO:0071586

Feature Viewer

pLDDT pTM Quality
91.6 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map