F294449

General Info

Members Datasets Scaffolds Average Seq Length
191 138 185 320

Family's Representative Sequence

Representative Sequence 3300044694|Ga0466963_0005544|Ga0466963_0005544_5324_6403
Length 359
Sequence VPAKSIRVGSHEAAMRSVGSAAASPRFCYRQRRSGAGAFDMRLRSHGQLTMQTILSISNLSKTYASGFQALKRVNLEIRRGEIFALLGPNGAGKTTLIGTVCGLVTPTSGTVAVEGHDIIKDYRRARALIGLVPQELTTNAFETVWATVSFSRGLFGKPADPAHLEKVLRALSLWDKRNNAIMTLSGGMKRRVLIAKALAHEPQVLFLDEPTAGVDVELRRDMWELMRGLKDTGVTIILTTHYIDEAEEMADRIGIINRGEIVLVEEKTQLLRKLGKKQLTLQLAEPIEQVPHALSGYGLELSAGGAALTYTYDDTQSERAGIATLLKDLDDARVRFKDLQTTQSSLEDIFVDLVKERS

Samples

Sample ID Description Type Environment
1 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
2 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
3 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
4 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
30 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
31 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
38 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
41 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
42 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
43 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
49 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
50 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
53 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
72 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
73 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
76 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
77 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
78 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
79 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
80 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
81 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
82 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
83 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
84 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
87 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
88 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
89 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
90 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
95 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
96 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
97 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
98 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
99 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
100 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
101 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
102 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
105 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
106 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
107 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
108 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
120 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
123 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
127 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
130 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
131 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
138 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.34
Metatranscriptomes 0.52
Isolates 3.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.14
Nodule 0.52
Rhizoplane 5.24
Rhizosphere 83.25
Stem 0
Stem Tuber 0
Unclassified 7.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000554 3300002067 Bacteria 13115
2 Ga0055533_1007204 3300003756 Bacteria 1539
3 Ga0055527_1003296 3300003760 Bacteria 2444
4 Ga0070658_10032970 3300005327 Bacteria 4165
5 Ga0070670_100018493 3300005331 Bacteria 5979
6 Ga0070670_100034216 3300005331 Bacteria 4373
7 Ga0070680_100038513 3300005336 Bacteria 3867
8 Ga0068868_100091908 3300005338 Bacteria 2445
9 Ga0070660_100000666 3300005339 Bacteria 22715
10 Ga0070660_100051328 3300005339 Bacteria 3176
11 Ga0070660_100216045 3300005339 Bacteria 1557
12 Ga0070674_100050766 3300005356 Bacteria 2856
13 Ga0070673_100490427 3300005364 Bacteria 1110
14 Ga0070714_100343933 3300005435 Bacteria 1400
15 Ga0070705_100203372 3300005440 Bacteria 1360
16 Ga0070706_100150055 3300005467 Bacteria 2176
17 Ga0068853_100038009 3300005539 Bacteria 4099
18 Ga0070704_100166874 3300005549 Bacteria 1746
19 Ga0070704_100279880 3300005549 Bacteria 1382
20 Ga0068855_100007915 3300005563 Bacteria 12840
21 Ga0068855_100028256 3300005563 Bacteria 6708
22 Ga0068856_100015422 3300005614 Bacteria 7385
23 Ga0068864_100044436 3300005618 Bacteria 3808
24 Ga0081455_10040482 3300005937 Bacteria 4108
25 Ga0070717_10444441 3300006028 Bacteria 1168
26 Ga0070716_100003568 3300006173 Bacteria 7344
27 Ga0075367_10151593 3300006178 Bacteria 1439
28 Ga0097621_100008562 3300006237 Bacteria 7373
29 Ga0075433_10185129 3300006852 Bacteria 1853
30 Ga0075429_100104863 3300006880 Bacteria 2469
31 Ga0075436_100123947 3300006914 Bacteria 1810
32 Ga0099794_10083886 3300007265 Bacteria 1575
33 Ga0105251_10001001 3300009011 Bacteria 24726
34 Ga0105244_10018905 3300009036 Bacteria 3858
35 Ga0105240_10003010 3300009093 Bacteria 26512
36 Ga0114129_10004033 3300009147 Bacteria 20731
37 Ga0105248_10124245 3300009177 Bacteria 2911
38 Ga0105249_10431906 3300009553 Bacteria 1353
39 Ga0105239_10002086 3300010375 Bacteria 25910
40 Ga0105239_10178634 3300010375 Bacteria 2374
41 Ga0157373_10007822 3300013100 Bacteria 7949
42 Ga0157373_10054457 3300013100 Bacteria 2842
43 Ga0157370_10002412 3300013104 Bacteria 22531
44 Ga0157370_10003902 3300013104 Bacteria 17379
45 Ga0157369_10000368 3300013105 Bacteria 59977
46 Ga0157369_10002876 3300013105 Bacteria 20563
47 Ga0157369_10012544 3300013105 Bacteria 9615
48 Ga0157374_10000065 3300013296 Bacteria 108630
49 Ga0157378_10489296 3300013297 Bacteria 1227
50 Ga0163162_10137989 3300013306 Bacteria 2550
51 Ga0157372_10004398 3300013307 Bacteria 15034
52 Ga0163163_10029871 3300014325 Bacteria 5245
53 Ga0157377_10278553 3300014745 Bacteria 1095
54 Ga0183369_1003 3300015685 Bacteria 726443
55 Ga0213875_10000003 3300021388 Bacteria 719367
56 Ga0224712_10000214 3300022467 Bacteria 10415
57 Ga0209672_100352 3300025228 Bacteria 29317
58 Ga0209759_1003962 3300025256 Bacteria 5687
59 Ga0207647_10000711 3300025904 Bacteria 26125
60 Ga0207705_10001644 3300025909 Bacteria 17733
61 Ga0207705_10050031 3300025909 Bacteria 3008
62 Ga0207684_10226463 3300025910 Bacteria 1613
63 Ga0207707_10004181 3300025912 Bacteria 12786
64 Ga0207695_10004468 3300025913 Bacteria 19049
65 Ga0207657_10000192 3300025919 Bacteria 63445
66 Ga0207657_10230976 3300025919 Bacteria 1480
67 Ga0207650_10030618 3300025925 Bacteria 3878
68 Ga0207664_10129612 3300025929 Bacteria 2122
69 Ga0207690_10145604 3300025932 Bacteria 1751
70 Ga0207686_10016901 3300025934 Bacteria 4100
71 Ga0207669_10026981 3300025937 Bacteria 3135
72 Ga0207667_10000273 3300025949 Bacteria 71462
73 Ga0207667_10015652 3300025949 Bacteria 8604
74 Ga0207639_10118944 3300026041 Bacteria 2167
75 Ga0207702_10013996 3300026078 Bacteria 6665
76 Ga0207676_10095208 3300026095 Bacteria 2455
77 Ga0207698_10486696 3300026142 Bacteria 1198
78 Ga0265328_10007688 3300031239 Bacteria 4483
79 Ga0265340_10028040 3300031247 Bacteria 2835
80 Ga0265316_10052237 3300031344 Bacteria 3207
81 Ga0265314_10056892 3300031711 Bacteria 2690
82 Ga0316578_10140820 3300031728 Bacteria 1453
83 Ga0307414_10072792 3300032004 Bacteria 2484
84 Ga0316580_10034324 3300032139 Bacteria 1570
85 Ga0316574_0092596 3300035398 Bacteria 1929
86 Ga0373931_0018720 3300035691 Bacteria 3446
87 Ga0316582_0089421 3300036647 Bacteria 2025
88 Ga0373925_0164744 3300037068 Bacteria 1748
89 Ga0395899_0000030 3300037312 Bacteria 329063
90 Ga0395899_0000041 3300037312 Bacteria 255615
91 Ga0395899_0003954 3300037312 Bacteria 11678
92 Ga0395900_0000023 3300037418 Bacteria 336048
93 Ga0395900_0000077 3300037418 Bacteria 179525
94 Ga0395900_0000097 3300037418 Bacteria 161598
95 Ga0395898_0000038 3300037466 Bacteria 329063
96 Ga0395898_0000322 3300037466 Bacteria 109324
97 Ga0395898_0000936 3300037466 Bacteria 46540
98 Ga0395898_0048685 3300037466 Bacteria 4155
99 Ga0395898_0049092 3300037466 Bacteria 4136
100 Ga0395898_0225070 3300037466 Bacteria 1789
101 Ga0395905_0000021 3300037471 Bacteria 329054
102 Ga0395905_0012205 3300037471 Bacteria 8275
103 Ga0436364_0505381 3300037853 Bacteria 66783
104 Ga0395901_0000011 3300038443 Bacteria 400724
105 Ga0395901_0000018 3300038443 Bacteria 336048
106 Ga0395901_0000085 3300038443 Bacteria 126093
107 Ga0395901_0001346 3300038443 Bacteria 25770
108 Ga0436362_0301701 3300039453 Bacteria 2809
109 Ga0439448_0000195 3300042005 Bacteria 12572
110 Ga0466969_0000012 3300044656 Bacteria 112852
111 Ga0466969_0009618 3300044656 Bacteria 5123
112 Ga0466969_0112880 3300044656 Bacteria 1270
113 Ga0466965_0000401 3300044683 Bacteria 14848
114 Ga0466965_0005704 3300044683 Bacteria 5615
115 Ga0466966_0000002 3300044684 Bacteria 370962
116 Ga0466966_0002140 3300044684 Bacteria 12803
117 Ga0466966_0038499 3300044684 Bacteria 3081
118 Ga0466966_0050038 3300044684 Bacteria 2659
119 Ga0466961_0000216 3300044693 Bacteria 38914
120 Ga0466961_0027651 3300044693 Bacteria 3648
121 Ga0466961_0092113 3300044693 Bacteria 1913
122 Ga0466963_0001417 3300044694 Bacteria 12904
123 Ga0466963_0005544 3300044694 Bacteria 7393
124 Ga0466963_0014943 3300044694 Bacteria 4797
125 Ga0466963_0309050 3300044694 Bacteria 1112
126 Ga0466964_0024788 3300044706 Bacteria 2338
127 Ga0466971_0000120 3300044719 Bacteria 28491
128 Ga0466971_0000891 3300044719 Bacteria 12211
129 Ga0466968_0021399 3300044735 Bacteria 2619
130 Ga0466970_0005905 3300044765 Bacteria 6099
131 Ga0466970_0023830 3300044765 Bacteria 3200
132 Ga0466957_0000794 3300044842 Bacteria 16134
133 Ga0466957_0004724 3300044842 Bacteria 7627
134 Ga0466957_0123002 3300044842 Bacteria 1655
135 Ga0466959_0009449 3300045049 Bacteria 6937
136 Ga0466959_0011101 3300045049 Bacteria 6464
137 Ga0466959_0015588 3300045049 Bacteria 5540
138 Ga0466958_0003491 3300045836 Bacteria 8163
139 Ga0466958_0009972 3300045836 Bacteria 5306
140 Ga0466958_0011526 3300045836 Bacteria 4978
141 Ga0466958_0046847 3300045836 Bacteria 2609
142 Ga0495590_0001070 3300046457 Bacteria 12069
143 Ga0495620_0042078 3300046515 Bacteria 1998
144 Ga0495683_0001776 3300047323 Bacteria 13601
145 Ga0496101_0028590 3300048904 Bacteria 3893
146 Ga0496102_0000166 3300048905 Bacteria 88956
147 Ga0496102_0137086 3300048905 Bacteria 2293
148 Ga0496103_0019246 3300048906 Bacteria 4099
149 Ga0496104_0243325 3300048907 Bacteria 1711
150 Ga0496106_0002084 3300048909 Bacteria 14990
151 Ga0496107_0003771 3300048910 Bacteria 10178
152 Ga0496111_0003675 3300048914 Bacteria 9528
153 Ga0496113_0004819 3300048916 Bacteria 8342
154 Ga0496114_0337268 3300048917 Bacteria 1333
155 Ga0496116_0010019 3300048919 Bacteria 7999
156 Ga0496117_0049621 3300048920 Bacteria 2983
157 Ga0496118_0080129 3300048921 Bacteria 2300
158 Ga0496121_0002369 3300048924 Bacteria 28981
159 Ga0496121_0065755 3300048924 Bacteria 2948
160 Ga0496123_0022757 3300048926 Bacteria 4819
161 Ga0496124_0014535 3300048927 Bacteria 7605
162 Ga0496125_0042725 3300048928 Bacteria 3856
163 Ga0501032_0072272 3300049569 Bacteria 2299
164 Ga0501034_0000538 3300049571 Bacteria 60200
165 Ga0501037_0013379 3300049573 Bacteria 6044
166 Ga0501043_0000010 3300049579 Bacteria 206374
167 Ga0501046_0000097 3300049580 Bacteria 93650
168 Ga0501047_0000026 3300049581 Bacteria 225296
169 Ga0501047_0232906 3300049581 Bacteria 1695
170 Ga0501048_0007102 3300049582 Bacteria 8507
171 Ga0501070_0156675 3300049586 Bacteria 1878
172 Ga0501045_0013286 3300049824 Bacteria 5812
173 nmdc:mga00v17_11820_c1 3300050491 Bacteria 4803
174 nmdc:mga05p37_4786_c1 3300050507 Bacteria 15817
175 nmdc:mga09592_221590_c1 3300050508 Bacteria 1639
176 nmdc:mga0qj67_197945_c1 3300050509 Bacteria 1633
177 nmdc:mga0qj67_2750_c1 3300050509 Bacteria 12616
178 nmdc:mga08x19_19286_c1 3300050514 Bacteria 4183
179 nmdc:mga0a205_26730_c1 3300050515 Bacteria 5506
180 Ga0500562_012699 3300053108 Bacteria 2145
181 Ga0501082_0085244 3300060353 Bacteria 2725
182 Ga0501082_0469867 3300060353 Bacteria 1099
183 Ga0466962_0001945 3300061719 Bacteria 9740
184 Ga0466962_0004504 3300061719 Bacteria 6680
185 Ga0466962_0009595 3300061719 Bacteria 4642

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048917 Ga0496114_0337268 Ga0496114_0337268_124_945 273
2 3300050491 nmdc:mga00v17_11820_c1 nmdc:mga00v17_11820_c1_1202_2059 285
3 iso_pu_bacteria 2881412998 2881414244 294
4 3300031239 Ga0265328_10007688 Ga0265328_100076884 296
5 3300031344 Ga0265316_10052237 Ga0265316_100522373 296
6 3300032139 Ga0316580_10034324 Ga0316580_100343241 297
7 3300035398 Ga0316574_0092596 Ga0316574_0092596_404_1330 297
8 3300036647 Ga0316582_0089421 Ga0316582_0089421_442_1368 297
9 3300005435 Ga0070714_100343933 Ga0070714_1003439331 298
10 3300025929 Ga0207664_10129612 Ga0207664_101296122 298
11 3300021388 Ga0213875_10000003 Ga0213875_10000003540 303
12 3300037853 Ga0436364_0505381 Ga0436364_0505381_47393_48382 303
13 iso_pu_bacteria 2808606379 2808941596 304
14 iso_pu_bacteria 2990196909 2990197112 304
15 iso_pu_bacteria 8054563764 8054566571 304
16 3300060353 Ga0501082_0469867 Ga0501082_0469867_143_1060 305
17 iso_pu_bacteria 2515154123 2515687411 305
18 3300005364 Ga0070673_100490427 Ga0070673_1004904272 306
19 3300005327 Ga0070658_10032970 Ga0070658_100329701 307
20 3300005339 Ga0070660_100051328 Ga0070660_1000513283 307
21 3300005563 Ga0068855_100028256 Ga0068855_1000282564 307
22 3300005937 Ga0081455_10040482 Ga0081455_100404825 307
23 3300013104 Ga0157370_10003902 Ga0157370_1000390211 307
24 3300025909 Ga0207705_10001644 Ga0207705_100016443 307
25 3300025919 Ga0207657_10230976 Ga0207657_102309762 307
26 3300025932 Ga0207690_10145604 Ga0207690_101456042 307
27 3300025949 Ga0207667_10000273 Ga0207667_1000027317 307
28 3300005336 Ga0070680_100038513 Ga0070680_1000385132 308
29 3300005338 Ga0068868_100091908 Ga0068868_1000919082 308
30 3300005339 Ga0070660_100216045 Ga0070660_1002160452 308
31 3300005356 Ga0070674_100050766 Ga0070674_1000507665 308
32 3300005440 Ga0070705_100203372 Ga0070705_1002033722 308
33 3300005467 Ga0070706_100150055 Ga0070706_1001500552 308
34 3300005539 Ga0068853_100038009 Ga0068853_1000380093 308
35 3300005549 Ga0070704_100166874 Ga0070704_1001668742 308
36 3300005549 Ga0070704_100279880 Ga0070704_1002798801 308
37 3300005614 Ga0068856_100015422 Ga0068856_1000154225 308
38 3300006028 Ga0070717_10444441 Ga0070717_104444411 308
39 3300006173 Ga0070716_100003568 Ga0070716_1000035688 308
40 3300006237 Ga0097621_100008562 Ga0097621_1000085628 308
41 3300006880 Ga0075429_100104863 Ga0075429_1001048632 308
42 3300006914 Ga0075436_100123947 Ga0075436_1001239472 308
43 3300007265 Ga0099794_10083886 Ga0099794_100838861 308
44 3300009147 Ga0114129_10004033 Ga0114129_100040333 308
45 3300009177 Ga0105248_10124245 Ga0105248_101242453 308
46 3300009553 Ga0105249_10431906 Ga0105249_104319062 308
47 3300013100 Ga0157373_10054457 Ga0157373_100544572 308
48 3300013297 Ga0157378_10489296 Ga0157378_104892961 308
49 3300013306 Ga0163162_10137989 Ga0163162_101379892 308
50 3300014325 Ga0163163_10029871 Ga0163163_100298713 308
51 3300014745 Ga0157377_10278553 Ga0157377_102785532 308
52 3300025910 Ga0207684_10226463 Ga0207684_102264632 308
53 3300025912 Ga0207707_10004181 Ga0207707_100041815 308
54 3300025934 Ga0207686_10016901 Ga0207686_100169012 308
55 3300025937 Ga0207669_10026981 Ga0207669_100269812 308
56 3300026041 Ga0207639_10118944 Ga0207639_101189442 308
57 3300026078 Ga0207702_10013996 Ga0207702_100139965 308
58 3300031247 Ga0265340_10028040 Ga0265340_100280402 308
59 3300031711 Ga0265314_10056892 Ga0265314_100568923 308
60 3300037068 Ga0373925_0164744 Ga0373925_0164744_741_1667 308
61 3300037312 Ga0395899_0000030 Ga0395899_0000030_176085_177011 308
62 3300037418 Ga0395900_0000023 Ga0395900_0000023_182491_183417 308
63 3300037466 Ga0395898_0000038 Ga0395898_0000038_176085_177011 308
64 3300037471 Ga0395905_0000021 Ga0395905_0000021_176085_177011 308
65 3300038443 Ga0395901_0000018 Ga0395901_0000018_182491_183417 308
66 3300049571 Ga0501034_0000538 Ga0501034_0000538_17730_18656 308
67 3300049586 Ga0501070_0156675 Ga0501070_0156675_868_1830 308
68 3300050507 nmdc:mga05p37_4786_c1 nmdc:mga05p37_4786_c1_14666_15592 308
69 3300050508 nmdc:mga09592_221590_c1 nmdc:mga09592_221590_c1_408_1334 308
70 3300050509 nmdc:mga0qj67_197945_c1 nmdc:mga0qj67_197945_c1_318_1244 308
71 3300050509 nmdc:mga0qj67_2750_c1 nmdc:mga0qj67_2750_c1_8424_9350 308
72 3300050514 nmdc:mga08x19_19286_c1 nmdc:mga08x19_19286_c1_259_1185 308
73 3300050515 nmdc:mga0a205_26730_c1 nmdc:mga0a205_26730_c1_224_1150 308
74 3300053108 Ga0500562_012699 Ga0500562_012699_1067_2011 308
75 3300060353 Ga0501082_0085244 Ga0501082_0085244_330_1256 308
76 3300003760 Ga0055527_1003296 Ga0055527_10032962 309
77 3300005331 Ga0070670_100034216 Ga0070670_1000342165 309
78 3300005618 Ga0068864_100044436 Ga0068864_1000444365 309
79 3300010375 Ga0105239_10002086 Ga0105239_100020865 309
80 3300013104 Ga0157370_10002412 Ga0157370_100024128 309
81 3300013296 Ga0157374_10000065 Ga0157374_1000006525 309
82 3300013307 Ga0157372_10004398 Ga0157372_100043985 309
83 3300022467 Ga0224712_10000214 Ga0224712_1000021411 309
84 3300025228 Ga0209672_100352 Ga0209672_10035217 309
85 3300025256 Ga0209759_1003962 Ga0209759_10039622 309
86 3300025913 Ga0207695_10004468 Ga0207695_1000446812 309
87 3300025925 Ga0207650_10030618 Ga0207650_100306184 309
88 3300026095 Ga0207676_10095208 Ga0207676_100952085 309
89 3300037312 Ga0395899_0000041 Ga0395899_0000041_218494_219423 309
90 3300037312 Ga0395899_0003954 Ga0395899_0003954_5888_6817 309
91 3300037418 Ga0395900_0000077 Ga0395900_0000077_70417_71352 309
92 3300037418 Ga0395900_0000097 Ga0395900_0000097_124477_125406 309
93 3300037466 Ga0395898_0000322 Ga0395898_0000322_36193_37122 309
94 3300037466 Ga0395898_0048685 Ga0395898_0048685_2854_3783 309
95 3300037466 Ga0395898_0049092 Ga0395898_0049092_33_962 309
96 3300038443 Ga0395901_0001346 Ga0395901_0001346_1179_2108 309
97 3300044656 Ga0466969_0000012 Ga0466969_0000012_11422_12396 309
98 3300044683 Ga0466965_0000401 Ga0466965_0000401_5053_6027 309
99 3300044684 Ga0466966_0002140 Ga0466966_0002140_7706_8647 309
100 3300044684 Ga0466966_0050038 Ga0466966_0050038_1342_2316 309
101 3300044693 Ga0466961_0027651 Ga0466961_0027651_43_1017 309
102 3300044694 Ga0466963_0001417 Ga0466963_0001417_821_1795 309
103 3300044694 Ga0466963_0014943 Ga0466963_0014943_3507_4448 309
104 3300044719 Ga0466971_0000120 Ga0466971_0000120_10565_11506 309
105 3300044719 Ga0466971_0000891 Ga0466971_0000891_7336_8310 309
106 3300044842 Ga0466957_0000794 Ga0466957_0000794_796_1770 309
107 3300044842 Ga0466957_0123002 Ga0466957_0123002_295_1236 309
108 3300045049 Ga0466959_0011101 Ga0466959_0011101_3233_4207 309
109 3300045836 Ga0466958_0009972 Ga0466958_0009972_312_1241 309
110 3300045836 Ga0466958_0011526 Ga0466958_0011526_2638_3612 309
111 3300049569 Ga0501032_0072272 Ga0501032_0072272_1101_2030 309
112 3300049579 Ga0501043_0000010 Ga0501043_0000010_33204_34133 309
113 3300049580 Ga0501046_0000097 Ga0501046_0000097_34519_35448 309
114 3300049581 Ga0501047_0000026 Ga0501047_0000026_191223_192152 309
115 3300049582 Ga0501048_0007102 Ga0501048_0007102_1556_2485 309
116 3300049824 Ga0501045_0013286 Ga0501045_0013286_4133_5062 309
117 3300061719 Ga0466962_0001945 Ga0466962_0001945_1190_2131 309
118 3300061719 Ga0466962_0004504 Ga0466962_0004504_4107_5081 309
119 3300049581 Ga0501047_0232906 Ga0501047_0232906_280_1227 310
120 3300006852 Ga0075433_10185129 Ga0075433_101851292 311
121 3300048924 Ga0496121_0065755 Ga0496121_0065755_52_996 314
122 3300031728 Ga0316578_10140820 Ga0316578_101408202 318
123 3300006178 Ga0075367_10151593 Ga0075367_101515932 319
124 3300035691 Ga0373931_0018720 Ga0373931_0018720_1577_2542 319
125 3300005331 Ga0070670_100018493 Ga0070670_1000184933 320
126 3300037471 Ga0395905_0012205 Ga0395905_0012205_1852_2865 320
127 3300044656 Ga0466969_0112880 Ga0466969_0112880_165_1133 321
128 3300044683 Ga0466965_0005704 Ga0466965_0005704_661_1629 321
129 3300044684 Ga0466966_0038499 Ga0466966_0038499_289_1257 321
130 3300044694 Ga0466963_0309050 Ga0466963_0309050_27_995 321
131 3300044706 Ga0466964_0024788 Ga0466964_0024788_1120_2088 321
132 3300044735 Ga0466968_0021399 Ga0466968_0021399_879_1847 321
133 3300044765 Ga0466970_0005905 Ga0466970_0005905_3559_4527 321
134 3300044842 Ga0466957_0004724 Ga0466957_0004724_5764_6732 321
135 3300045049 Ga0466959_0015588 Ga0466959_0015588_4279_5247 321
136 3300045836 Ga0466958_0003491 Ga0466958_0003491_5780_6748 321
137 3300061719 Ga0466962_0009595 Ga0466962_0009595_2639_3607 321
138 3300010375 Ga0105239_10178634 Ga0105239_101786342 322
139 3300048905 Ga0496102_0000166 Ga0496102_0000166_63441_64457 322
140 iso_pu_bacteria 640427133 640489871 322
141 3300015685 Ga0183369_1003 Ga0183369_100330 323
142 3300038443 Ga0395901_0000011 Ga0395901_0000011_239384_240394 323
143 3300049573 Ga0501037_0013379 Ga0501037_0013379_456_1508 323
144 3300039453 Ga0436362_0301701 Ga0436362_0301701_157_1248 325
145 3300003756 Ga0055533_1007204 Ga0055533_10072042 326
146 3300009011 Ga0105251_10001001 Ga0105251_1000100119 326
147 3300009036 Ga0105244_10018905 Ga0105244_100189053 326
148 3300013105 Ga0157369_10000368 Ga0157369_1000036846 326
149 3300026142 Ga0207698_10486696 Ga0207698_104866962 326
150 3300032004 Ga0307414_10072792 Ga0307414_100727924 326
151 3300044684 Ga0466966_0000002 Ga0466966_0000002_255723_256760 326
152 3300044693 Ga0466961_0000216 Ga0466961_0000216_8594_9631 326
153 3300045836 Ga0466958_0046847 Ga0466958_0046847_1562_2599 326
154 3300046457 Ga0495590_0001070 Ga0495590_0001070_6541_7590 326
155 3300046515 Ga0495620_0042078 Ga0495620_0042078_403_1452 326
156 3300047323 Ga0495683_0001776 Ga0495683_0001776_3362_4411 326
157 3300048904 Ga0496101_0028590 Ga0496101_0028590_960_2009 326
158 3300048905 Ga0496102_0137086 Ga0496102_0137086_742_1791 326
159 3300048906 Ga0496103_0019246 Ga0496103_0019246_1048_2097 326
160 3300048907 Ga0496104_0243325 Ga0496104_0243325_424_1473 326
161 3300048909 Ga0496106_0002084 Ga0496106_0002084_12046_13095 326
162 3300048910 Ga0496107_0003771 Ga0496107_0003771_3233_4282 326
163 3300048914 Ga0496111_0003675 Ga0496111_0003675_5491_6540 326
164 3300048916 Ga0496113_0004819 Ga0496113_0004819_2414_3463 326
165 3300048919 Ga0496116_0010019 Ga0496116_0010019_3496_4545 326
166 3300048920 Ga0496117_0049621 Ga0496117_0049621_1469_2518 326
167 3300048921 Ga0496118_0080129 Ga0496118_0080129_507_1556 326
168 3300048924 Ga0496121_0002369 Ga0496121_0002369_18377_19426 326
169 3300048926 Ga0496123_0022757 Ga0496123_0022757_3336_4385 326
170 3300048927 Ga0496124_0014535 Ga0496124_0014535_3956_5005 326
171 3300048928 Ga0496125_0042725 Ga0496125_0042725_1974_3023 326
172 3300002067 JGI24735J21928_10000554 JGI24735J21928_100005545 328
173 3300005339 Ga0070660_100000666 Ga0070660_10000066615 328
174 3300005563 Ga0068855_100007915 Ga0068855_1000079159 328
175 3300009093 Ga0105240_10003010 Ga0105240_100030105 328
176 3300013100 Ga0157373_10007822 Ga0157373_100078223 328
177 3300013105 Ga0157369_10002876 Ga0157369_100028764 328
178 3300013105 Ga0157369_10012544 Ga0157369_100125443 328
179 3300025904 Ga0207647_10000711 Ga0207647_100007113 328
180 3300025909 Ga0207705_10050031 Ga0207705_100500312 328
181 3300025919 Ga0207657_10000192 Ga0207657_1000019214 328
182 3300025949 Ga0207667_10015652 Ga0207667_1001565210 328
183 3300037466 Ga0395898_0000936 Ga0395898_0000936_35416_36417 328
184 3300037466 Ga0395898_0225070 Ga0395898_0225070_776_1762 328
185 3300038443 Ga0395901_0000085 Ga0395901_0000085_102151_103152 328
186 3300042005 Ga0439448_0000195 Ga0439448_0000195_6854_7840 328
187 3300044656 Ga0466969_0009618 Ga0466969_0009618_3737_4756 328
188 3300044693 Ga0466961_0092113 Ga0466961_0092113_510_1529 328
189 3300044694 Ga0466963_0005544 Ga0466963_0005544_5324_6403 328
190 3300044765 Ga0466970_0023830 Ga0466970_0023830_2013_3032 328
191 3300045049 Ga0466959_0009449 Ga0466959_0009449_5543_6562 328

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

71

213

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9319 21 235
7ahc-assembly1.cif.gz_C opua apo inward-facing 0.9158 24 233
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9128 22 239
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9079 22 228
5x41-assembly2.cif.gz_D 3.5a resolution structure of a cobalt energy-coupling factor transporter using lcp method-cbimqo 0.9077 20 242
ID Description Score Start End Superfamily
af_Q1RS86_918_1157_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9516 20 225 3.40.50.300
af_A4HV32_726_961_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9422 20 243 3.40.50.300
af_P0A9R7_1_220_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9384 24 229 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9382 24 236 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9382 20 243 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Q6RQW5-F1-model_v4 ABC transporter domain-containing protein 0.9693 24 241 GO:0005524
GO:0016887
AF-A0A7V5DKD2-F1-model_v4 Heme ABC exporter ATP-binding protein CcmA 0.9633 24 237 GO:0005524
GO:0016887
GO:0017004
GO:0022857
AF-A0A2S6SPB6-F1-model_v4 Putative ABC transporter ATP-binding protein YbhF 0.9606 21 241 GO:0005524
GO:0016887
AF-A0A7D4BZX1-F1-model_v4 deleted 0.9527 24 237
AF-A0A7C2K6D1-F1-model_v4 ABC transporter ATP-binding protein 0.9513 24 236 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
83.96 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map