F293823

General Info

Members Datasets Scaffolds Average Seq Length
191 134 191 141

Family's Representative Sequence

Representative Sequence 3300006163|Ga0070715_10511237|Ga0070715_105112372
Length 162
Sequence MNETCELPLQNATSAEIRDILGAAKVVAVVGLSNKLERDSYGVAAYLQAQGYRIIPVNPNINQVLGERAYASLEQVPGPVDVVDIFRRPEFVPEIVDQAIAKGAKVIWMQEGIAHNSAADKARAAGLRVVMNKCILKEHRKLSAKPGPNHRTAEPLIDTNKH

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
61 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
85 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
89 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
90 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
91 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
92 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
93 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
98 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
99 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
100 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
101 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
102 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
103 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
104 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
105 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
114 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
115 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
116 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
117 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
118 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
119 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
120 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
121 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
127 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
128 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
129 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
130 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
131 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
132 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
133 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
134 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 96.86
Stem 0
Stem Tuber 0
Unclassified 2.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10201039 3300005295 Bacteria 1310
2 Ga0070683_100154164 3300005329 Bacteria 2178
3 Ga0070680_100014824 3300005336 Bacteria 6096
4 Ga0068868_100001373 3300005338 Bacteria 16760
5 Ga0070692_10040994 3300005345 Unclassified 2370
6 Ga0070671_100028155 3300005355 Bacteria 4626
7 Ga0070671_101073138 3300005355 Bacteria 707
8 Ga0070673_100209067 3300005364 Unclassified 1684
9 Ga0070673_100670839 3300005364 Unclassified 950
10 Ga0070659_101784512 3300005366 Unclassified 551
11 Ga0070667_100033021 3300005367 Bacteria 4321
12 Ga0070703_10065586 3300005406 Unclassified 1199
13 Ga0070709_10957543 3300005434 Unclassified 679
14 Ga0070713_100564980 3300005436 Unclassified 1078
15 Ga0070713_101094405 3300005436 Unclassified 770
16 Ga0070701_10128616 3300005438 Bacteria 1436
17 Ga0070705_100014403 3300005440 Bacteria 4066
18 Ga0070694_100177966 3300005444 Unclassified 1571
19 Ga0070708_100001833 3300005445 Bacteria 16294
20 Ga0070708_100055192 3300005445 Bacteria 3532
21 Ga0070708_100069074 3300005445 Bacteria 3176
22 Ga0070708_100227629 3300005445 Bacteria 1749
23 Ga0070708_102236169 3300005445 Bacteria 505
24 Ga0070681_10007702 3300005458 Bacteria 10531
25 Ga0070706_100006025 3300005467 Bacteria 11461
26 Ga0070706_100027824 3300005467 Bacteria 5200
27 Ga0070706_100058494 3300005467 Bacteria 3557
28 Ga0070706_100969312 3300005467 Bacteria 785
29 Ga0070707_100001798 3300005468 Bacteria 20598
30 Ga0070707_100178129 3300005468 Bacteria 2072
31 Ga0070707_100287518 3300005468 Bacteria 1597
32 Ga0070707_100435815 3300005468 Bacteria 1271
33 Ga0070707_100863669 3300005468 Bacteria 869
34 Ga0070707_100956429 3300005468 Unclassified 821
35 Ga0070698_100152674 3300005471 Bacteria 2256
36 Ga0070698_100935539 3300005471 Unclassified 813
37 Ga0070699_100037334 3300005518 Unclassified 4203
38 Ga0070699_100090800 3300005518 Bacteria 2670
39 Ga0070699_100334264 3300005518 Bacteria 1363
40 Ga0070699_100822868 3300005518 Unclassified 850
41 Ga0070679_100617856 3300005530 Bacteria 1027
42 Ga0070697_100134643 3300005536 Bacteria 2074
43 Ga0070672_100023489 3300005543 Bacteria 4546
44 Ga0070695_100088079 3300005545 Unclassified 2066
45 Ga0070696_100055976 3300005546 Unclassified 2750
46 Ga0070704_101589931 3300005549 Unclassified 602
47 Ga0070664_100002157 3300005564 Bacteria 15786
48 Ga0068859_102376727 3300005617 Unclassified 584
49 Ga0068864_100031453 3300005618 Bacteria 4503
50 Ga0068863_100110114 3300005841 Bacteria 2622
51 Ga0068858_100069568 3300005842 Bacteria 3263
52 Ga0068860_100954111 3300005843 Unclassified 875
53 Ga0081538_10038497 3300005981 Bacteria 3084
54 Ga0070717_10024878 3300006028 Unclassified 4757
55 Ga0070715_10511237 3300006163 Unclassified 689
56 Ga0070712_101582190 3300006175 Unclassified 573
57 Ga0070712_101987115 3300006175 Bacteria 509
58 Ga0097621_100105527 3300006237 Unclassified 2376
59 Ga0068871_100092386 3300006358 Unclassified 2524
60 Ga0075428_100033399 3300006844 Bacteria 5682
61 Ga0075430_100430710 3300006846 Bacteria 1089
62 Ga0075431_100411984 3300006847 Unclassified 1351
63 Ga0075433_10468041 3300006852 Bacteria 1110
64 Ga0075434_100072989 3300006871 Bacteria 3424
65 Ga0075429_100120773 3300006880 Bacteria 2291
66 Ga0075436_100002702 3300006914 Bacteria 12200
67 Ga0075436_100093491 3300006914 Bacteria 2091
68 Ga0097620_102377316 3300006931 Unclassified 584
69 Ga0075435_100017401 3300007076 Bacteria 5442
70 Ga0075435_100063801 3300007076 Bacteria 2992
71 Ga0075435_101234242 3300007076 Bacteria 654
72 Ga0111539_10075008 3300009094 Bacteria 3985
73 Ga0111539_10797126 3300009094 Unclassified 1099
74 Ga0105247_10089957 3300009101 Unclassified 1947
75 Ga0114129_10096644 3300009147 Bacteria 4089
76 Ga0114129_10171444 3300009147 Unclassified 2958
77 Ga0114129_10262325 3300009147 Bacteria 2314
78 Ga0105243_12461223 3300009148 Unclassified 559
79 Ga0105241_10503692 3300009174 Unclassified 1080
80 Ga0105242_11475130 3300009176 Unclassified 710
81 Ga0105248_10007922 3300009177 Bacteria 11674
82 Ga0105248_10802179 3300009177 Unclassified 1063
83 Ga0163162_10002352 3300013306 Bacteria 17762
84 Ga0157372_10024247 3300013307 Bacteria 6586
85 Ga0157375_10037229 3300013308 Bacteria 4660
86 Ga0163163_10008784 3300014325 Bacteria 8993
87 Ga0157376_10155466 3300014969 Bacteria 2067
88 Ga0157376_10591293 3300014969 Viruses 1104
89 Ga0157376_11205571 3300014969 Unclassified 785
90 Ga0213875_10292286 3300021388 Unclassified 770
91 Ga0207653_10067580 3300025885 Bacteria 1216
92 Ga0207653_10068048 3300025885 Bacteria 1213
93 Ga0207684_10001505 3300025910 Bacteria 24984
94 Ga0207684_10009032 3300025910 Bacteria 8832
95 Ga0207684_10231967 3300025910 Bacteria 1592
96 Ga0207684_10745311 3300025910 Bacteria 830
97 Ga0207660_10047797 3300025917 Bacteria 3027
98 Ga0207652_10087620 3300025921 Unclassified 2730
99 Ga0207646_10034150 3300025922 Bacteria 4597
100 Ga0207646_10061282 3300025922 Bacteria 3358
101 Ga0207646_10081656 3300025922 Bacteria 2890
102 Ga0207646_10177600 3300025922 Bacteria 1923
103 Ga0207646_10237121 3300025922 Bacteria 1648
104 Ga0207646_10772941 3300025922 Unclassified 856
105 Ga0207650_10005511 3300025925 Bacteria 8636
106 Ga0207700_10575693 3300025928 Unclassified 1001
107 Ga0207700_10704009 3300025928 Unclassified 902
108 Ga0207644_10046472 3300025931 Bacteria 3093
109 Ga0207709_10323801 3300025935 Bacteria 1155
110 Ga0207704_10264686 3300025938 Bacteria 1298
111 Ga0207691_10036296 3300025940 Bacteria 4567
112 Ga0207651_10033433 3300025960 Bacteria 3317
113 Ga0207641_10189871 3300026088 Unclassified 1888
114 Ga0207676_10007222 3300026095 Bacteria 7866
115 Ga0207428_10197037 3300027907 Unclassified 1516
116 Ga0268265_10087701 3300028380 Bacteria 2477
117 Ga0268264_10589802 3300028381 Unclassified 1094
118 Ga0265316_10630296 3300031344 Unclassified 759
119 Ga0307408_102293545 3300031548 Bacteria 523
120 Ga0265342_10324073 3300031712 Unclassified 807
121 Ga0307413_10090702 3300031824 Bacteria 1989
122 Ga0307410_10087319 3300031852 Bacteria 2205
123 Ga0307412_10162723 3300031911 Bacteria 1660
124 Ga0307409_100094759 3300031995 Bacteria 2457
125 Ga0307411_10081641 3300032005 Bacteria 2227
126 Ga0307415_100056128 3300032126 Bacteria 2698
127 Ga0307415_100197593 3300032126 Unclassified 1593
128 Ga0373928_0120750 3300035084 Bacteria 702
129 Ga0373955_0616842 3300035172 Unclassified 665
130 Ga0373924_0074508 3300035410 Bacteria 1436
131 Ga0373933_0194454 3300035724 Bacteria 1296
132 Ga0373937_0041006 3300036401 Bacteria 4222
133 Ga0373937_0046688 3300036401 Bacteria 3961
134 Ga0316582_0643936 3300036647 Unclassified 729
135 Ga0395898_0692569 3300037466 Bacteria 961
136 Ga0436364_0856627 3300037853 Bacteria 7310
137 Ga0395901_0583600 3300038443 Bacteria 1129
138 Ga0436365_1408304 3300039437 Bacteria 1586
139 Ga0436361_1180136 3300039447 Bacteria 586
140 Ga0436363_0358177 3300039450 Bacteria 2798
141 Ga0439450_113974 3300042008 Unclassified 693
142 Ga0453683_0025551 3300044673 Bacteria 3751
143 Ga0453684_2428488 3300044712 Bacteria 519
144 Ga0466957_0172378 3300044842 Bacteria 1410
145 Ga0466959_0427032 3300045049 Unclassified 899
146 Ga0451576_0532819 3300045051 Bacteria 1234
147 Ga0451576_1622781 3300045051 Bacteria 670
148 Ga0495592_0004676 3300046454 Bacteria 10033
149 Ga0495592_0339081 3300046454 Bacteria 967
150 Ga0495592_0365865 3300046454 Bacteria 921
151 Ga0495582_0270426 3300046473 Bacteria 975
152 Ga0495608_0031793 3300046511 Bacteria 3566
153 Ga0495618_0061855 3300046514 Bacteria 2375
154 Ga0495628_0056819 3300046516 Bacteria 3080
155 Ga0495630_0064124 3300046517 Bacteria 2760
156 Ga0495630_0518610 3300046517 Bacteria 914
157 Ga0495640_0055762 3300046533 Bacteria 2703
158 Ga0495586_0052788 3300046535 Unclassified 2201
159 Ga0495586_0148595 3300046535 Bacteria 1318
160 Ga0495586_0741082 3300046535 Unclassified 567
161 Ga0495667_0001910 3300046559 Bacteria 13814
162 Ga0495657_0001211 3300046675 Bacteria 22626
163 Ga0495599_0745798 3300046678 Unclassified 562
164 Ga0495646_0667624 3300046680 Unclassified 524
165 Ga0495658_0300985 3300046683 Bacteria 1014
166 Ga0495613_0126189 3300046689 Bacteria 1835
167 Ga0495674_0139428 3300047319 Unclassified 2039
168 Ga0495674_0439573 3300047319 Bacteria 1049
169 Ga0495676_0326562 3300047321 Bacteria 1030
170 Ga0495675_0227931 3300047444 Bacteria 1125
171 Ga0495684_0540181 3300047471 Unclassified 795
172 Ga0495684_0860791 3300047471 Unclassified 587
173 Ga0496104_0007823 3300048907 Bacteria 9475
174 Ga0496104_1298075 3300048907 Unclassified 631
175 Ga0501071_1519329 3300049587 Unclassified 517
176 nmdc:mga05p37_1244194_c1 3300050507 Unclassified 764
177 nmdc:mga05p37_1300276_c1 3300050507 Bacteria 741
178 nmdc:mga05p37_386576_c1 3300050507 Bacteria 1638
179 nmdc:mga05p37_415395_c1 3300050507 Bacteria 1567
180 nmdc:mga05p37_454754_c1 3300050507 Bacteria 1481
181 nmdc:mga09592_369659_c1 3300050508 Unclassified 1240
182 nmdc:mga06r32_753718_c1 3300050510 Unclassified 937
183 nmdc:mga08y16_350783_c1 3300050511 Unclassified 1516
184 nmdc:mga0n895_146609_c1 3300050512 Bacteria 2390
185 nmdc:mga0n895_70979_c1 3300050512 Bacteria 3452
186 nmdc:mga0n895_82913_c1 3300050512 Bacteria 3197
187 nmdc:mga0rr50_1172948_c1 3300050513 Bacteria 653
188 nmdc:mga0rr50_71712_c1 3300050513 Bacteria 2644
189 nmdc:mga08x19_4112_c1 3300050514 Bacteria 8635
190 nmdc:mga0a205_82881_c1 3300050515 Bacteria 3098
191 Ga0495601_0383785 3300053077 Bacteria 912

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_101073138 Ga0070671_1010731381 130
2 3300005434 Ga0070709_10957543 Ga0070709_109575431 130
3 3300005436 Ga0070713_101094405 Ga0070713_1010944051 130
4 3300005329 Ga0070683_100154164 Ga0070683_1001541641 131
5 3300009101 Ga0105247_10089957 Ga0105247_100899573 131
6 3300005617 Ga0068859_102376727 Ga0068859_1023767272 132
7 3300006931 Ga0097620_102377316 Ga0097620_1023773162 132
8 3300007076 Ga0075435_101234242 Ga0075435_1012342421 132
9 3300050512 nmdc:mga0n895_146609_c1 nmdc:mga0n895_146609_c1_1727_2125 132
10 3300050513 nmdc:mga0rr50_1172948_c1 nmdc:mga0rr50_1172948_c1_112_510 132
11 3300035084 Ga0373928_0120750 Ga0373928_0120750_283_687 133
12 3300044673 Ga0453683_0025551 Ga0453683_0025551_1736_2140 133
13 3300049587 Ga0501071_1519329 Ga0501071_1519329_44_445 133
14 3300005436 Ga0070713_100564980 Ga0070713_1005649801 134
15 3300021388 Ga0213875_10292286 Ga0213875_102922862 134
16 3300025928 Ga0207700_10575693 Ga0207700_105756931 134
17 3300037853 Ga0436364_0856627 Ga0436364_0856627_2453_2857 134
18 3300039437 Ga0436365_1408304 Ga0436365_1408304_797_1201 134
19 3300045051 Ga0451576_1622781 Ga0451576_1622781_162_566 134
20 3300005338 Ga0068868_100001373 Ga0068868_1000013733 135
21 3300005355 Ga0070671_100028155 Ga0070671_1000281553 135
22 3300005364 Ga0070673_100670839 Ga0070673_1006708392 135
23 3300005367 Ga0070667_100033021 Ga0070667_1000330213 135
24 3300005543 Ga0070672_100023489 Ga0070672_1000234894 135
25 3300005564 Ga0070664_100002157 Ga0070664_1000021572 135
26 3300005618 Ga0068864_100031453 Ga0068864_1000314533 135
27 3300005841 Ga0068863_100110114 Ga0068863_1001101142 135
28 3300005842 Ga0068858_100069568 Ga0068858_1000695685 135
29 3300006237 Ga0097621_100105527 Ga0097621_1001055272 135
30 3300006358 Ga0068871_100092386 Ga0068871_1000923862 135
31 3300009177 Ga0105248_10007922 Ga0105248_100079227 135
32 3300009177 Ga0105248_10802179 Ga0105248_108021791 135
33 3300013306 Ga0163162_10002352 Ga0163162_1000235219 135
34 3300013308 Ga0157375_10037229 Ga0157375_100372292 135
35 3300014325 Ga0163163_10008784 Ga0163163_100087843 135
36 3300014969 Ga0157376_10155466 Ga0157376_101554662 135
37 3300014969 Ga0157376_11205571 Ga0157376_112055711 135
38 3300025925 Ga0207650_10005511 Ga0207650_100055118 135
39 3300025931 Ga0207644_10046472 Ga0207644_100464723 135
40 3300025940 Ga0207691_10036296 Ga0207691_100362962 135
41 3300025960 Ga0207651_10033433 Ga0207651_100334333 135
42 3300026095 Ga0207676_10007222 Ga0207676_100072224 135
43 3300035172 Ga0373955_0616842 Ga0373955_0616842_177_584 135
44 3300035410 Ga0373924_0074508 Ga0373924_0074508_130_537 135
45 3300035724 Ga0373933_0194454 Ga0373933_0194454_710_1117 135
46 3300036401 Ga0373937_0041006 Ga0373937_0041006_3154_3561 135
47 3300036401 Ga0373937_0046688 Ga0373937_0046688_44_451 135
48 3300039447 Ga0436361_1180136 Ga0436361_1180136_136_543 135
49 3300039450 Ga0436363_0358177 Ga0436363_0358177_1174_1581 135
50 3300044842 Ga0466957_0172378 Ga0466957_0172378_982_1389 135
51 3300045049 Ga0466959_0427032 Ga0466959_0427032_144_551 135
52 3300046454 Ga0495592_0004676 Ga0495592_0004676_2041_2448 135
53 3300046454 Ga0495592_0339081 Ga0495592_0339081_436_843 135
54 3300046473 Ga0495582_0270426 Ga0495582_0270426_484_891 135
55 3300046511 Ga0495608_0031793 Ga0495608_0031793_1865_2272 135
56 3300046517 Ga0495630_0518610 Ga0495630_0518610_166_573 135
57 3300046535 Ga0495586_0148595 Ga0495586_0148595_718_1125 135
58 3300046535 Ga0495586_0741082 Ga0495586_0741082_109_516 135
59 3300046559 Ga0495667_0001910 Ga0495667_0001910_1540_1947 135
60 3300046675 Ga0495657_0001211 Ga0495657_0001211_17714_18121 135
61 3300046678 Ga0495599_0745798 Ga0495599_0745798_85_492 135
62 3300046683 Ga0495658_0300985 Ga0495658_0300985_454_861 135
63 3300047319 Ga0495674_0439573 Ga0495674_0439573_53_460 135
64 3300047321 Ga0495676_0326562 Ga0495676_0326562_52_459 135
65 3300047444 Ga0495675_0227931 Ga0495675_0227931_634_1041 135
66 3300047471 Ga0495684_0540181 Ga0495684_0540181_159_566 135
67 3300053077 Ga0495601_0383785 Ga0495601_0383785_160_567 135
68 3300006175 Ga0070712_101582190 Ga0070712_1015821901 136
69 3300006175 Ga0070712_101987115 Ga0070712_1019871151 136
70 3300006871 Ga0075434_100072989 Ga0075434_1000729895 136
71 3300006914 Ga0075436_100002702 Ga0075436_1000027022 136
72 3300013307 Ga0157372_10024247 Ga0157372_100242472 136
73 3300025928 Ga0207700_10704009 Ga0207700_107040091 136
74 3300036647 Ga0316582_0643936 Ga0316582_0643936_85_495 136
75 3300044712 Ga0453684_2428488 Ga0453684_2428488_83_493 136
76 3300046454 Ga0495592_0365865 Ga0495592_0365865_397_807 136
77 3300046514 Ga0495618_0061855 Ga0495618_0061855_1910_2320 136
78 3300046516 Ga0495628_0056819 Ga0495628_0056819_1089_1499 136
79 3300046517 Ga0495630_0064124 Ga0495630_0064124_287_697 136
80 3300046533 Ga0495640_0055762 Ga0495640_0055762_1361_1771 136
81 3300046535 Ga0495586_0052788 Ga0495586_0052788_186_596 136
82 3300046680 Ga0495646_0667624 Ga0495646_0667624_25_435 136
83 3300046689 Ga0495613_0126189 Ga0495613_0126189_1131_1541 136
84 3300047319 Ga0495674_0139428 Ga0495674_0139428_1562_1972 136
85 3300047471 Ga0495684_0860791 Ga0495684_0860791_146_556 136
86 3300048907 Ga0496104_0007823 Ga0496104_0007823_7484_7894 136
87 3300050512 nmdc:mga0n895_70979_c1 nmdc:mga0n895_70979_c1_2896_3306 136
88 3300050514 nmdc:mga08x19_4112_c1 nmdc:mga08x19_4112_c1_2296_2706 136
89 3300005364 Ga0070673_100209067 Ga0070673_1002090672 137
90 3300009094 Ga0111539_10075008 Ga0111539_100750082 137
91 3300014969 Ga0157376_10591293 Ga0157376_105912932 137
92 3300026088 Ga0207641_10189871 Ga0207641_101898712 137
93 3300027907 Ga0207428_10197037 Ga0207428_101970372 137
94 3300031344 Ga0265316_10630296 Ga0265316_106302961 137
95 3300031712 Ga0265342_10324073 Ga0265342_103240732 137
96 3300050511 nmdc:mga08y16_350783_c1 nmdc:mga08y16_350783_c1_405_827 137
97 3300005530 Ga0070679_100617856 Ga0070679_1006178561 139
98 3300005981 Ga0081538_10038497 Ga0081538_100384973 140
99 3300031548 Ga0307408_102293545 Ga0307408_1022935451 140
100 3300005445 Ga0070708_100001833 Ga0070708_1000018332 141
101 3300005445 Ga0070708_100069074 Ga0070708_1000690742 141
102 3300005445 Ga0070708_102236169 Ga0070708_1022361691 141
103 3300005467 Ga0070706_100006025 Ga0070706_1000060259 141
104 3300005467 Ga0070706_100027824 Ga0070706_1000278245 141
105 3300005468 Ga0070707_100001798 Ga0070707_10000179819 141
106 3300005468 Ga0070707_100178129 Ga0070707_1001781292 141
107 3300005468 Ga0070707_100287518 Ga0070707_1002875182 141
108 3300005468 Ga0070707_100863669 Ga0070707_1008636692 141
109 3300005518 Ga0070699_100090800 Ga0070699_1000908002 141
110 3300005518 Ga0070699_100334264 Ga0070699_1003342642 141
111 3300006844 Ga0075428_100033399 Ga0075428_1000333992 141
112 3300006847 Ga0075431_100411984 Ga0075431_1004119842 141
113 3300009147 Ga0114129_10171444 Ga0114129_101714445 141
114 3300025910 Ga0207684_10001505 Ga0207684_100015055 141
115 3300025910 Ga0207684_10231967 Ga0207684_102319672 141
116 3300025922 Ga0207646_10061282 Ga0207646_100612823 141
117 3300025922 Ga0207646_10081656 Ga0207646_100816562 141
118 3300025922 Ga0207646_10177600 Ga0207646_101776002 141
119 3300031824 Ga0307413_10090702 Ga0307413_100907022 141
120 3300031852 Ga0307410_10087319 Ga0307410_100873193 141
121 3300031911 Ga0307412_10162723 Ga0307412_101627232 141
122 3300031995 Ga0307409_100094759 Ga0307409_1000947593 141
123 3300032005 Ga0307411_10081641 Ga0307411_100816413 141
124 3300032126 Ga0307415_100056128 Ga0307415_1000561284 141
125 3300037466 Ga0395898_0692569 Ga0395898_0692569_518_943 141
126 3300038443 Ga0395901_0583600 Ga0395901_0583600_171_596 141
127 3300007076 Ga0075435_100017401 Ga0075435_1000174016 142
128 3300050507 nmdc:mga05p37_415395_c1 nmdc:mga05p37_415395_c1_180_608 142
129 3300006846 Ga0075430_100430710 Ga0075430_1004307102 144
130 3300006880 Ga0075429_100120773 Ga0075429_1001207733 144
131 3300042008 Ga0439450_113974 Ga0439450_113974_23_463 144
132 3300048907 Ga0496104_1298075 Ga0496104_1298075_125_559 144
133 3300050507 nmdc:mga05p37_1244194_c1 nmdc:mga05p37_1244194_c1_151_591 144
134 3300050508 nmdc:mga09592_369659_c1 nmdc:mga09592_369659_c1_712_1152 144
135 3300050510 nmdc:mga06r32_753718_c1 nmdc:mga06r32_753718_c1_430_870 144
136 3300009147 Ga0114129_10096644 Ga0114129_100966445 145
137 3300025922 Ga0207646_10772941 Ga0207646_107729412 145
138 3300050507 nmdc:mga05p37_454754_c1 nmdc:mga05p37_454754_c1_285_749 145
139 3300009094 Ga0111539_10797126 Ga0111539_107971262 146
140 3300009147 Ga0114129_10262325 Ga0114129_102623252 146
141 3300050507 nmdc:mga05p37_386576_c1 nmdc:mga05p37_386576_c1_274_792 146
142 3300005445 Ga0070708_100055192 Ga0070708_1000551922 147
143 3300005467 Ga0070706_100058494 Ga0070706_1000584941 147
144 3300005471 Ga0070698_100152674 Ga0070698_1001526743 147
145 3300005518 Ga0070699_100037334 Ga0070699_1000373344 147
146 3300005536 Ga0070697_100134643 Ga0070697_1001346432 147
147 3300006028 Ga0070717_10024878 Ga0070717_100248782 147
148 3300025885 Ga0207653_10067580 Ga0207653_100675801 147
149 3300025910 Ga0207684_10009032 Ga0207684_100090326 147
150 3300025922 Ga0207646_10034150 Ga0207646_100341502 147
151 3300005295 Ga0065707_10201039 Ga0065707_102010391 149
152 3300005336 Ga0070680_100014824 Ga0070680_1000148247 149
153 3300005345 Ga0070692_10040994 Ga0070692_100409943 149
154 3300005366 Ga0070659_101784512 Ga0070659_1017845121 149
155 3300005406 Ga0070703_10065586 Ga0070703_100655861 149
156 3300005438 Ga0070701_10128616 Ga0070701_101286163 149
157 3300005440 Ga0070705_100014403 Ga0070705_1000144033 149
158 3300005444 Ga0070694_100177966 Ga0070694_1001779662 149
159 3300005445 Ga0070708_100227629 Ga0070708_1002276292 149
160 3300005458 Ga0070681_10007702 Ga0070681_1000770210 149
161 3300005467 Ga0070706_100969312 Ga0070706_1009693121 149
162 3300005468 Ga0070707_100435815 Ga0070707_1004358152 149
163 3300005468 Ga0070707_100956429 Ga0070707_1009564292 149
164 3300005471 Ga0070698_100935539 Ga0070698_1009355392 149
165 3300005518 Ga0070699_100822868 Ga0070699_1008228682 149
166 3300005545 Ga0070695_100088079 Ga0070695_1000880792 149
167 3300005546 Ga0070696_100055976 Ga0070696_1000559764 149
168 3300005549 Ga0070704_101589931 Ga0070704_1015899311 149
169 3300005843 Ga0068860_100954111 Ga0068860_1009541112 149
170 3300006163 Ga0070715_10511237 Ga0070715_105112372 149
171 3300006852 Ga0075433_10468041 Ga0075433_104680412 149
172 3300006914 Ga0075436_100093491 Ga0075436_1000934913 149
173 3300007076 Ga0075435_100063801 Ga0075435_1000638014 149
174 3300009148 Ga0105243_12461223 Ga0105243_124612231 149
175 3300009174 Ga0105241_10503692 Ga0105241_105036922 149
176 3300009176 Ga0105242_11475130 Ga0105242_114751302 149
177 3300025885 Ga0207653_10068048 Ga0207653_100680482 149
178 3300025910 Ga0207684_10745311 Ga0207684_107453112 149
179 3300025917 Ga0207660_10047797 Ga0207660_100477972 149
180 3300025921 Ga0207652_10087620 Ga0207652_100876203 149
181 3300025922 Ga0207646_10237121 Ga0207646_102371212 149
182 3300025935 Ga0207709_10323801 Ga0207709_103238012 149
183 3300025938 Ga0207704_10264686 Ga0207704_102646862 149
184 3300028380 Ga0268265_10087701 Ga0268265_100877013 149
185 3300028381 Ga0268264_10589802 Ga0268264_105898021 149
186 3300032126 Ga0307415_100197593 Ga0307415_1001975931 149
187 3300045051 Ga0451576_0532819 Ga0451576_0532819_148_597 149
188 3300050507 nmdc:mga05p37_1300276_c1 nmdc:mga05p37_1300276_c1_224_673 149
189 3300050512 nmdc:mga0n895_82913_c1 nmdc:mga0n895_82913_c1_569_1018 149
190 3300050513 nmdc:mga0rr50_71712_c1 nmdc:mga0rr50_71712_c1_1787_2236 149
191 3300050515 nmdc:mga0a205_82881_c1 nmdc:mga0a205_82881_c1_1076_1525 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13380

CoA_binding_2

CoA binding domain

25

140

0.98

PF02629

CoA_binding

CoA binding domain

23

110

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qa9-assembly1.cif.gz_A crystal structure of prb (ph1109 protein redesigned for binding) 0.979 10 139
1iul-assembly1.cif.gz_A the structure of cell-free id.343 from thermus thermophilus 0.9619 10 139
2d5a-assembly1.cif.gz_A hypothetical protein from pyrococcus horikoshii ot3 0.9401 5 142
3q9n-assembly2.cif.gz_B in silico and in vitro co-evolution of a high affinity complementary protein-protein interface 0.9291 2 142
1y81-assembly1.cif.gz_A conserved hypothetical protein pfu-723267-001 from pyrococcus furiosus 0.9281 22 132
ID Description Score Start End Superfamily
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9619 10 139 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9291 2 142 3.40.50.720
1y81A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 22 132 3.40.50.720
1iulA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9272 10 139 3.40.50.720
3q9nB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9225 2 142 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N7GHN4-F1-model_v4 CoA-binding protein 0.9988 22 145
AF-A0A1Q7I7G3-F1-model_v4 CoA-binding domain-containing protein 0.9914 11 147
AF-A0A7V8E2G2-F1-model_v4 CoA-binding domain-containing 0.9875 11 139
AF-A0A3M2FD87-F1-model_v4 CoA-binding protein 0.9869 7 139
AF-A0A419EMP9-F1-model_v4 CoA-binding protein 0.9865 10 139

Feature Viewer

pLDDT pTM Quality
92.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map