F293768

General Info

Members Datasets Scaffolds Average Seq Length
191 159 191 144

Family's Representative Sequence

Representative Sequence 3300005840|Ga0068870_10539483|Ga0068870_105394832
Length 160
Sequence MTDAAHDTRETRRNMTLKRMDNVLLVVEDLEAAKAFFAELGMELEGEATNEGPWVDRIVGLEGVRCDLAMMRTPDGHGGIELARFHTPPAVRAEPQNAPTNTLGLRRIMFAVEDVDGVVARLREHGAELVGEIAQYEDVYRLCFVRGPEGIVIGLAEQLG

Samples

Sample ID Description Type Environment
1 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
20 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
26 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
27 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
28 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
29 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
43 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
52 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
78 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
84 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
85 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
86 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
87 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
90 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
91 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
92 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
93 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
94 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
95 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
96 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
97 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
98 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
99 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
100 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
101 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
102 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
103 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
104 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
108 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
109 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
110 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
111 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
112 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
113 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
114 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
115 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
116 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
117 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
118 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
121 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
128 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
129 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
130 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
131 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
132 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
133 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049650 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought Metagenome Rhizosphere
137 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
138 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
139 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
140 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
141 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
142 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
143 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
144 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
145 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
146 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
147 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
148 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
149 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
150 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
151 3300053127 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 endosphere Metagenome Endosphere
152 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
153 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
154 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
155 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
156 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
157 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
158 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
159 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.61
Nodule 0
Rhizoplane 7.85
Rhizosphere 71.73
Stem 0
Stem Tuber 0
Unclassified 6.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25160J50197_1000604 3300003354 Bacteria 20110
2 Ga0065165_1001894 3300005262 Bacteria 20128
3 Ga0070683_100046974 3300005329 Bacteria 3989
4 Ga0068869_100130379 3300005334 Unclassified 1932
5 Ga0068868_100321777 3300005338 Bacteria 1318
6 Ga0070689_100427336 3300005340 Bacteria 1124
7 Ga0070691_10210957 3300005341 Bacteria 1025
8 Ga0070661_100275177 3300005344 Bacteria 1305
9 Ga0070668_100220290 3300005347 Bacteria 1565
10 Ga0070668_100426005 3300005347 Bacteria 1137
11 Ga0070700_100721431 3300005441 Bacteria 795
12 Ga0070663_100258029 3300005455 Bacteria 1382
13 Ga0070663_100326530 3300005455 Bacteria 1235
14 Ga0070699_100277459 3300005518 Unclassified 1501
15 Ga0070684_100051358 3300005535 Bacteria 3582
16 Ga0070684_100071244 3300005535 Bacteria 3060
17 Ga0068853_100551049 3300005539 Bacteria 1092
18 Ga0068853_100655252 3300005539 Bacteria 999
19 Ga0070702_100189383 3300005615 Bacteria 1352
20 Ga0068852_100111517 3300005616 Bacteria 2487
21 Ga0068864_101397055 3300005618 Bacteria 702
22 Ga0068866_10535713 3300005718 Bacteria 780
23 Ga0068861_100193133 3300005719 Bacteria 1703
24 Ga0068861_100602183 3300005719 Bacteria 1009
25 Ga0068870_10539483 3300005840 Bacteria 784
26 Ga0068860_100059948 3300005843 Bacteria 3617
27 Ga0068860_100244547 3300005843 Bacteria 1745
28 Ga0081455_10424947 3300005937 Bacteria 915
29 Ga0081538_10170733 3300005981 Bacteria 949
30 Ga0075363_100203189 3300006048 Bacteria 1132
31 Ga0075367_10378156 3300006178 Bacteria 895
32 Ga0075366_10044952 3300006195 Bacteria 2618
33 Ga0075428_101019655 3300006844 Bacteria 876
34 Ga0075429_101125366 3300006880 Bacteria 686
35 Ga0068865_100171317 3300006881 Bacteria 1664
36 Ga0097620_101077707 3300006931 Unclassified 883
37 Ga0099795_10420851 3300007788 Bacteria 610
38 Ga0105251_10092932 3300009011 Bacteria 1384
39 Ga0105240_10061082 3300009093 Bacteria 4696
40 Ga0111539_10301679 3300009094 Bacteria 1864
41 Ga0111539_12933721 3300009094 Bacteria 552
42 Ga0114129_10434734 3300009147 Bacteria 1724
43 Ga0105243_10025402 3300009148 Bacteria 4527
44 Ga0105243_10163024 3300009148 Bacteria 1924
45 Ga0105243_11749923 3300009148 Bacteria 651
46 Ga0105241_10064233 3300009174 Bacteria 2833
47 Ga0105242_10425034 3300009176 Bacteria 1246
48 Ga0105242_10538839 3300009176 Bacteria 1117
49 Ga0105238_11686963 3300009551 Bacteria 665
50 Ga0105249_10476874 3300009553 Bacteria 1290
51 Ga0105239_11802525 3300010375 Bacteria 709
52 Ga0105246_10073535 3300011119 Bacteria 2414
53 Ga0157338_1060870 3300012515 Bacteria 567
54 Ga0157369_10874004 3300013105 Bacteria 922
55 Ga0157369_11305548 3300013105 Bacteria 740
56 Ga0157378_11090998 3300013297 Bacteria 835
57 Ga0163162_10451431 3300013306 Bacteria 1418
58 Ga0163162_10842288 3300013306 Bacteria 1033
59 Ga0157372_10432664 3300013307 Bacteria 1534
60 Ga0163163_10238597 3300014325 Bacteria 1868
61 Ga0157380_10470002 3300014326 Bacteria 1213
62 Ga0157377_11285768 3300014745 Bacteria 571
63 Ga0213872_10088701 3300021361 Bacteria 1385
64 Ga0209130_1005163 3300025284 Bacteria 4630
65 Ga0207426_1000004 3300025302 Bacteria 1047900
66 Ga0207688_10073496 3300025901 Bacteria 1944
67 Ga0207643_10399895 3300025908 Bacteria 868
68 Ga0207654_10405520 3300025911 Unclassified 949
69 Ga0207695_10091526 3300025913 Bacteria 3055
70 Ga0207657_10069694 3300025919 Bacteria 2983
71 Ga0207649_10564725 3300025920 Bacteria 872
72 Ga0207681_11234980 3300025923 Bacteria 628
73 Ga0207687_10399877 3300025927 Bacteria 1130
74 Ga0207690_10389232 3300025932 Bacteria 1110
75 Ga0207686_10021711 3300025934 Bacteria 3688
76 Ga0207686_10620060 3300025934 Bacteria 853
77 Ga0207704_10030203 3300025938 Bacteria 3035
78 Ga0207704_10614389 3300025938 Bacteria 891
79 Ga0207704_11205900 3300025938 Bacteria 645
80 Ga0207691_11126096 3300025940 Bacteria 652
81 Ga0207689_10040443 3300025942 Bacteria 3859
82 Ga0207689_10455557 3300025942 Bacteria 1069
83 Ga0207661_10036758 3300025944 Bacteria 3825
84 Ga0207661_10389494 3300025944 Bacteria 1262
85 Ga0207679_10251066 3300025945 Bacteria 1504
86 Ga0207679_10421113 3300025945 Bacteria 1179
87 Ga0207668_10162530 3300025972 Bacteria 1742
88 Ga0207668_11042092 3300025972 Bacteria 732
89 Ga0207677_11176312 3300026023 Bacteria 701
90 Ga0207639_11343760 3300026041 Bacteria 671
91 Ga0207678_10080774 3300026067 Bacteria 2783
92 Ga0207678_10357351 3300026067 Bacteria 1260
93 Ga0207678_11049069 3300026067 Bacteria 722
94 Ga0207648_10089798 3300026089 Bacteria 2685
95 Ga0207676_11941380 3300026095 Bacteria 587
96 Ga0207675_100194076 3300026118 Bacteria 1949
97 Ga0268264_10832555 3300028381 Unclassified 923
98 Ga0265327_10005735 3300031251 Bacteria 10232
99 Ga0307406_11442280 3300031901 Bacteria 604
100 Ga0307416_101195563 3300032002 Bacteria 866
101 Ga0307415_100040816 3300032126 Bacteria 3077
102 Ga0373932_0303599 3300035112 Bacteria 596
103 Ga0373954_0381243 3300035118 Bacteria 697
104 Ga0373937_0413611 3300036401 Bacteria 1280
105 Ga0395901_0404258 3300038443 Bacteria 1403
106 Ga0436365_1323614 3300039437 Bacteria 617
107 Ga0436360_0236343 3300039438 Bacteria 727
108 Ga0436360_0411964 3300039438 Bacteria 1823
109 Ga0436361_0610433 3300039447 Bacteria 5624
110 Ga0436363_0383601 3300039450 Bacteria 837
111 Ga0439438_006924 3300041405 Bacteria 3940
112 Ga0439447_046436 3300041407 Bacteria 1045
113 Ga0439466_0001193 3300041411 Bacteria 10121
114 Ga0451789_1338303 3300041443 Bacteria 1916
115 Ga0451793_0287736 3300041452 Bacteria 1759
116 Ga0451795_0695037 3300041456 Bacteria 1799
117 Ga0451800_0139010 3300041459 Bacteria 2666
118 Ga0451802_1067831 3300041460 Bacteria 992
119 Ga0451807_1091285 3300041486 Bacteria 1417
120 Ga0451839_0579115 3300041496 Bacteria 1020
121 Ga0451841_0122033 3300041498 Bacteria 678
122 Ga0451851_0351435 3300041507 Bacteria 549
123 Ga0451853_1420438 3300041512 Bacteria 1602
124 Ga0439448_0097751 3300042005 Bacteria 996
125 Ga0439449_0095220 3300042007 Bacteria 1100
126 Ga0450908_051254 3300042184 Bacteria 719
127 Ga0466961_0016734 3300044693 Bacteria 4714
128 Ga0466963_0004751 3300044694 Bacteria 7928
129 Ga0466963_0126968 3300044694 Bacteria 1759
130 Ga0466964_0166338 3300044706 Bacteria 1035
131 Ga0466957_0293277 3300044842 Bacteria 1091
132 Ga0466957_0503544 3300044842 Bacteria 840
133 Ga0466958_0297594 3300045836 Bacteria 1036
134 Ga0466967_0000021 3300045976 Bacteria 76829
135 Ga0466967_0244326 3300045976 Bacteria 1713
136 Ga0466967_0295003 3300045976 Bacteria 1558
137 Ga0466967_2120025 3300045976 Bacteria 558
138 Ga0495591_004627 3300046458 Bacteria 6629
139 Ga0495605_0024785 3300046474 Bacteria 3135
140 Ga0495596_0297747 3300046500 Bacteria 627
141 Ga0495607_0056291 3300046501 Bacteria 2258
142 Ga0495632_0003050 3300046519 Bacteria 12191
143 Ga0495643_0456166 3300046522 Bacteria 555
144 Ga0495644_0139880 3300046523 Bacteria 924
145 Ga0495611_0057066 3300046648 Bacteria 1769
146 Ga0495680_0541137 3300047322 Bacteria 786
147 Ga0495673_0018029 3300047469 Bacteria 3570
148 Ga0496100_0002661 3300048903 Bacteria 9110
149 Ga0496100_0720482 3300048903 Bacteria 779
150 Ga0496101_0001487 3300048904 Bacteria 13995
151 Ga0496101_1236830 3300048904 Bacteria 585
152 Ga0496103_0003514 3300048906 Bacteria 9576
153 Ga0496104_0029359 3300048907 Bacteria 5100
154 Ga0496106_0211488 3300048909 Bacteria 1545
155 Ga0496106_1028055 3300048909 Bacteria 647
156 Ga0496109_0291728 3300048912 Bacteria 1538
157 Ga0496117_0003695 3300048920 Bacteria 17568
158 Ga0496118_0004118 3300048921 Bacteria 17607
159 Ga0496119_0051301 3300048922 Bacteria 2536
160 Ga0496120_0183601 3300048923 Bacteria 1025
161 Ga0496121_0004787 3300048924 Bacteria 17844
162 Ga0496122_0142449 3300048925 Bacteria 1497
163 Ga0496124_0409744 3300048927 Bacteria 938
164 Ga0501034_0978598 3300049571 Bacteria 731
165 Ga0501069_0508731 3300049585 Bacteria 719
166 Ga0501199_030738 3300049650 Bacteria 662
167 Ga0501225_0222204 3300049705 Bacteria 609
168 Ga0501079_0423694 3300049741 Bacteria 1045
169 Ga0501080_0015108 3300049742 Bacteria 7116
170 nmdc:mga03n38_419540_c1 3300050490 Bacteria 740
171 nmdc:mga0k408_244724_c1 3300050493 Bacteria 1071
172 nmdc:mga06z11_300722_c1 3300050494 Bacteria 954
173 nmdc:mga08y16_1548854_c1 3300050511 Bacteria 622
174 nmdc:mga08y16_274680_c1 3300050511 Bacteria 1739
175 nmdc:mga08y16_567106_c1 3300050511 Bacteria 1147
176 Ga0500643_099371 3300053087 Bacteria 790
177 Ga0500644_0054726 3300053088 Bacteria 1382
178 Ga0500646_0042166 3300053090 Bacteria 1288
179 Ga0500583_0455969 3300053092 Bacteria 606
180 Ga0500651_0223384 3300053093 Bacteria 1103
181 Ga0500650_0011090 3300053098 Bacteria 3696
182 Ga0500569_068968 3300053109 Bacteria 1109
183 Ga0500623_080419 3300053127 Bacteria 1552
184 Ga0500628_008309 3300053129 Bacteria 1801
185 Ga0500642_0031405 3300053130 Bacteria 2219
186 Ga0500652_000362 3300053131 Bacteria 16330
187 Ga0500655_126877 3300053133 Bacteria 543
188 Ga0500568_0010766 3300053139 Bacteria 4268
189 Ga0500604_0014310 3300053151 Bacteria 2159
190 Ga0500622_0000262 3300053156 Bacteria 53796
191 Ga0500570_060736 3300053724 Bacteria 1831

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009011 Ga0105251_10092932 Ga0105251_100929323 139
2 3300009093 Ga0105240_10061082 Ga0105240_100610824 139
3 3300009094 Ga0111539_12933721 Ga0111539_129337211 139
4 3300026067 Ga0207678_10080774 Ga0207678_100807742 139
5 3300035112 Ga0373932_0303599 Ga0373932_0303599_81_506 139
6 3300038443 Ga0395901_0404258 Ga0395901_0404258_128_553 139
7 3300039437 Ga0436365_1323614 Ga0436365_1323614_166_591 139
8 3300039438 Ga0436360_0236343 Ga0436360_0236343_125_550 139
9 3300039438 Ga0436360_0411964 Ga0436360_0411964_1148_1573 139
10 3300041405 Ga0439438_006924 Ga0439438_006924_232_651 139
11 3300041407 Ga0439447_046436 Ga0439447_046436_437_856 139
12 3300041411 Ga0439466_0001193 Ga0439466_0001193_6190_6609 139
13 3300041443 Ga0451789_1338303 Ga0451789_1338303_452_871 139
14 3300041452 Ga0451793_0287736 Ga0451793_0287736_659_1078 139
15 3300041456 Ga0451795_0695037 Ga0451795_0695037_800_1219 139
16 3300041459 Ga0451800_0139010 Ga0451800_0139010_951_1370 139
17 3300041460 Ga0451802_1067831 Ga0451802_1067831_188_607 139
18 3300041486 Ga0451807_1091285 Ga0451807_1091285_285_704 139
19 3300041496 Ga0451839_0579115 Ga0451839_0579115_422_841 139
20 3300041498 Ga0451841_0122033 Ga0451841_0122033_193_612 139
21 3300041507 Ga0451851_0351435 Ga0451851_0351435_91_510 139
22 3300041512 Ga0451853_1420438 Ga0451853_1420438_61_480 139
23 3300042184 Ga0450908_051254 Ga0450908_051254_16_435 139
24 3300046458 Ga0495591_004627 Ga0495591_004627_4544_4963 139
25 3300046474 Ga0495605_0024785 Ga0495605_0024785_1701_2120 139
26 3300046501 Ga0495607_0056291 Ga0495607_0056291_1177_1596 139
27 3300046519 Ga0495632_0003050 Ga0495632_0003050_4883_5302 139
28 3300046522 Ga0495643_0456166 Ga0495643_0456166_74_493 139
29 3300046523 Ga0495644_0139880 Ga0495644_0139880_444_863 139
30 3300046648 Ga0495611_0057066 Ga0495611_0057066_38_457 139
31 3300047469 Ga0495673_0018029 Ga0495673_0018029_2004_2423 139
32 3300048903 Ga0496100_0002661 Ga0496100_0002661_5168_5587 139
33 3300048904 Ga0496101_0001487 Ga0496101_0001487_3550_3969 139
34 3300048906 Ga0496103_0003514 Ga0496103_0003514_5614_6033 139
35 3300048907 Ga0496104_0029359 Ga0496104_0029359_2704_3123 139
36 3300048909 Ga0496106_0211488 Ga0496106_0211488_809_1228 139
37 3300048909 Ga0496106_1028055 Ga0496106_1028055_52_477 139
38 3300048920 Ga0496117_0003695 Ga0496117_0003695_13619_14038 139
39 3300048921 Ga0496118_0004118 Ga0496118_0004118_3550_3969 139
40 3300048922 Ga0496119_0051301 Ga0496119_0051301_782_1201 139
41 3300048923 Ga0496120_0183601 Ga0496120_0183601_496_915 139
42 3300048924 Ga0496121_0004787 Ga0496121_0004787_13876_14295 139
43 3300048925 Ga0496122_0142449 Ga0496122_0142449_273_692 139
44 3300048927 Ga0496124_0409744 Ga0496124_0409744_389_808 139
45 3300049705 Ga0501225_0222204 Ga0501225_0222204_74_493 139
46 3300050490 nmdc:mga03n38_419540_c1 nmdc:mga03n38_419540_c1_299_724 139
47 3300050493 nmdc:mga0k408_244724_c1 nmdc:mga0k408_244724_c1_424_843 139
48 3300050494 nmdc:mga06z11_300722_c1 nmdc:mga06z11_300722_c1_160_585 139
49 3300050511 nmdc:mga08y16_567106_c1 nmdc:mga08y16_567106_c1_519_944 139
50 3300053087 Ga0500643_099371 Ga0500643_099371_55_474 139
51 3300053088 Ga0500644_0054726 Ga0500644_0054726_397_816 139
52 3300053090 Ga0500646_0042166 Ga0500646_0042166_339_758 139
53 3300053092 Ga0500583_0455969 Ga0500583_0455969_48_467 139
54 3300053093 Ga0500651_0223384 Ga0500651_0223384_458_877 139
55 3300053098 Ga0500650_0011090 Ga0500650_0011090_2624_3043 139
56 3300053109 Ga0500569_068968 Ga0500569_068968_612_1031 139
57 3300053127 Ga0500623_080419 Ga0500623_080419_617_1036 139
58 3300053129 Ga0500628_008309 Ga0500628_008309_784_1203 139
59 3300053130 Ga0500642_0031405 Ga0500642_0031405_708_1127 139
60 3300053131 Ga0500652_000362 Ga0500652_000362_6071_6490 139
61 3300053133 Ga0500655_126877 Ga0500655_126877_39_458 139
62 3300053139 Ga0500568_0010766 Ga0500568_0010766_768_1187 139
63 3300053151 Ga0500604_0014310 Ga0500604_0014310_1034_1453 139
64 3300053156 Ga0500622_0000262 Ga0500622_0000262_39366_39785 139
65 3300053724 Ga0500570_060736 Ga0500570_060736_1317_1736 139
66 3300005455 Ga0070663_100258029 Ga0070663_1002580292 143
67 3300049741 Ga0501079_0423694 Ga0501079_0423694_580_1017 143
68 3300003354 JGI25160J50197_1000604 JGI25160J50197_100060410 144
69 3300005262 Ga0065165_1001894 Ga0065165_100189413 144
70 3300005329 Ga0070683_100046974 Ga0070683_1000469741 144
71 3300005334 Ga0068869_100130379 Ga0068869_1001303792 144
72 3300005338 Ga0068868_100321777 Ga0068868_1003217774 144
73 3300005340 Ga0070689_100427336 Ga0070689_1004273362 144
74 3300005341 Ga0070691_10210957 Ga0070691_102109571 144
75 3300005344 Ga0070661_100275177 Ga0070661_1002751772 144
76 3300005347 Ga0070668_100220290 Ga0070668_1002202902 144
77 3300005347 Ga0070668_100426005 Ga0070668_1004260052 144
78 3300005441 Ga0070700_100721431 Ga0070700_1007214311 144
79 3300005455 Ga0070663_100326530 Ga0070663_1003265302 144
80 3300005518 Ga0070699_100277459 Ga0070699_1002774592 144
81 3300005535 Ga0070684_100051358 Ga0070684_1000513582 144
82 3300005535 Ga0070684_100071244 Ga0070684_1000712444 144
83 3300005539 Ga0068853_100551049 Ga0068853_1005510492 144
84 3300005539 Ga0068853_100655252 Ga0068853_1006552522 144
85 3300005615 Ga0070702_100189383 Ga0070702_1001893831 144
86 3300005616 Ga0068852_100111517 Ga0068852_1001115172 144
87 3300005618 Ga0068864_101397055 Ga0068864_1013970552 144
88 3300005718 Ga0068866_10535713 Ga0068866_105357132 144
89 3300005719 Ga0068861_100193133 Ga0068861_1001931332 144
90 3300005719 Ga0068861_100602183 Ga0068861_1006021832 144
91 3300005840 Ga0068870_10539483 Ga0068870_105394832 144
92 3300005843 Ga0068860_100059948 Ga0068860_1000599482 144
93 3300005843 Ga0068860_100244547 Ga0068860_1002445472 144
94 3300005937 Ga0081455_10424947 Ga0081455_104249472 144
95 3300005981 Ga0081538_10170733 Ga0081538_101707332 144
96 3300006048 Ga0075363_100203189 Ga0075363_1002031892 144
97 3300006178 Ga0075367_10378156 Ga0075367_103781562 144
98 3300006195 Ga0075366_10044952 Ga0075366_100449521 144
99 3300006844 Ga0075428_101019655 Ga0075428_1010196552 144
100 3300006880 Ga0075429_101125366 Ga0075429_1011253662 144
101 3300006881 Ga0068865_100171317 Ga0068865_1001713173 144
102 3300006931 Ga0097620_101077707 Ga0097620_1010777072 144
103 3300007788 Ga0099795_10420851 Ga0099795_104208512 144
104 3300009094 Ga0111539_10301679 Ga0111539_103016793 144
105 3300009147 Ga0114129_10434734 Ga0114129_104347344 144
106 3300009148 Ga0105243_10025402 Ga0105243_100254026 144
107 3300009148 Ga0105243_10163024 Ga0105243_101630242 144
108 3300009148 Ga0105243_11749923 Ga0105243_117499232 144
109 3300009174 Ga0105241_10064233 Ga0105241_100642332 144
110 3300009176 Ga0105242_10425034 Ga0105242_104250342 144
111 3300009176 Ga0105242_10538839 Ga0105242_105388392 144
112 3300009551 Ga0105238_11686963 Ga0105238_116869632 144
113 3300009553 Ga0105249_10476874 Ga0105249_104768742 144
114 3300010375 Ga0105239_11802525 Ga0105239_118025251 144
115 3300011119 Ga0105246_10073535 Ga0105246_100735352 144
116 3300012515 Ga0157338_1060870 Ga0157338_10608701 144
117 3300013105 Ga0157369_10874004 Ga0157369_108740042 144
118 3300013105 Ga0157369_11305548 Ga0157369_113055482 144
119 3300013297 Ga0157378_11090998 Ga0157378_110909981 144
120 3300013306 Ga0163162_10451431 Ga0163162_104514312 144
121 3300013306 Ga0163162_10842288 Ga0163162_108422882 144
122 3300013307 Ga0157372_10432664 Ga0157372_104326641 144
123 3300014325 Ga0163163_10238597 Ga0163163_102385972 144
124 3300014326 Ga0157380_10470002 Ga0157380_104700022 144
125 3300014745 Ga0157377_11285768 Ga0157377_112857681 144
126 3300021361 Ga0213872_10088701 Ga0213872_100887012 144
127 3300025284 Ga0209130_1005163 Ga0209130_10051634 144
128 3300025302 Ga0207426_1000004 Ga0207426_100000412 144
129 3300025901 Ga0207688_10073496 Ga0207688_100734962 144
130 3300025908 Ga0207643_10399895 Ga0207643_103998951 144
131 3300025911 Ga0207654_10405520 Ga0207654_104055202 144
132 3300025913 Ga0207695_10091526 Ga0207695_100915263 144
133 3300025919 Ga0207657_10069694 Ga0207657_100696942 144
134 3300025920 Ga0207649_10564725 Ga0207649_105647252 144
135 3300025923 Ga0207681_11234980 Ga0207681_112349801 144
136 3300025927 Ga0207687_10399877 Ga0207687_103998771 144
137 3300025932 Ga0207690_10389232 Ga0207690_103892322 144
138 3300025934 Ga0207686_10021711 Ga0207686_100217114 144
139 3300025934 Ga0207686_10620060 Ga0207686_106200602 144
140 3300025938 Ga0207704_10030203 Ga0207704_100302036 144
141 3300025938 Ga0207704_10614389 Ga0207704_106143892 144
142 3300025938 Ga0207704_11205900 Ga0207704_112059002 144
143 3300025940 Ga0207691_11126096 Ga0207691_111260962 144
144 3300025942 Ga0207689_10040443 Ga0207689_100404432 144
145 3300025942 Ga0207689_10455557 Ga0207689_104555572 144
146 3300025944 Ga0207661_10036758 Ga0207661_100367584 144
147 3300025944 Ga0207661_10389494 Ga0207661_103894942 144
148 3300025945 Ga0207679_10251066 Ga0207679_102510662 144
149 3300025945 Ga0207679_10421113 Ga0207679_104211133 144
150 3300025972 Ga0207668_10162530 Ga0207668_101625303 144
151 3300025972 Ga0207668_11042092 Ga0207668_110420921 144
152 3300026023 Ga0207677_11176312 Ga0207677_111763121 144
153 3300026041 Ga0207639_11343760 Ga0207639_113437602 144
154 3300026067 Ga0207678_10357351 Ga0207678_103573512 144
155 3300026067 Ga0207678_11049069 Ga0207678_110490692 144
156 3300026089 Ga0207648_10089798 Ga0207648_100897982 144
157 3300026095 Ga0207676_11941380 Ga0207676_119413801 144
158 3300026118 Ga0207675_100194076 Ga0207675_1001940763 144
159 3300028381 Ga0268264_10832555 Ga0268264_108325552 144
160 3300031251 Ga0265327_10005735 Ga0265327_100057352 144
161 3300031901 Ga0307406_11442280 Ga0307406_114422801 144
162 3300032002 Ga0307416_101195563 Ga0307416_1011955631 144
163 3300032126 Ga0307415_100040816 Ga0307415_1000408164 144
164 3300035118 Ga0373954_0381243 Ga0373954_0381243_187_627 144
165 3300036401 Ga0373937_0413611 Ga0373937_0413611_179_619 144
166 3300039447 Ga0436361_0610433 Ga0436361_0610433_3914_4354 144
167 3300039450 Ga0436363_0383601 Ga0436363_0383601_299_739 144
168 3300042005 Ga0439448_0097751 Ga0439448_0097751_397_837 144
169 3300042007 Ga0439449_0095220 Ga0439449_0095220_97_531 144
170 3300044693 Ga0466961_0016734 Ga0466961_0016734_2281_2721 144
171 3300044694 Ga0466963_0004751 Ga0466963_0004751_7433_7873 144
172 3300044694 Ga0466963_0126968 Ga0466963_0126968_521_961 144
173 3300044706 Ga0466964_0166338 Ga0466964_0166338_211_651 144
174 3300044842 Ga0466957_0293277 Ga0466957_0293277_152_604 144
175 3300044842 Ga0466957_0503544 Ga0466957_0503544_15_455 144
176 3300045836 Ga0466958_0297594 Ga0466958_0297594_211_651 144
177 3300045976 Ga0466967_0000021 Ga0466967_0000021_8642_9082 144
178 3300045976 Ga0466967_0244326 Ga0466967_0244326_11_463 144
179 3300045976 Ga0466967_0295003 Ga0466967_0295003_426_866 144
180 3300045976 Ga0466967_2120025 Ga0466967_2120025_66_506 144
181 3300046500 Ga0495596_0297747 Ga0495596_0297747_167_607 144
182 3300047322 Ga0495680_0541137 Ga0495680_0541137_100_540 144
183 3300048903 Ga0496100_0720482 Ga0496100_0720482_286_726 144
184 3300048904 Ga0496101_1236830 Ga0496101_1236830_23_481 144
185 3300048912 Ga0496109_0291728 Ga0496109_0291728_515_955 144
186 3300049571 Ga0501034_0978598 Ga0501034_0978598_204_641 144
187 3300049585 Ga0501069_0508731 Ga0501069_0508731_105_551 144
188 3300049650 Ga0501199_030738 Ga0501199_030738_109_549 144
189 3300049742 Ga0501080_0015108 Ga0501080_0015108_2395_2868 144
190 3300050511 nmdc:mga08y16_1548854_c1 nmdc:mga08y16_1548854_c1_171_611 144
191 3300050511 nmdc:mga08y16_274680_c1 nmdc:mga08y16_274680_c1_16_456 144

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

19

155

0.94

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

21

144

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yfo-assembly2.cif.gz_B receptor protein tyrosine phosphatase alpha, domain 1 from mouse 0.8502 112 142
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8438 1 144
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.8385 1 144
2i4e-assembly2.cif.gz_B structural studies of protein tyrosine phosphatase beta catalytic domain in complex with inhibitors 0.811 112 142
5irb-assembly2.cif.gz_B structural insight into host cell surface retention of a 1.5-mda bacterial ice-binding adhesin 0.7828 48 70
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8649 92 144 3.30.720.110
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8079 7 144 3.10.180.10
af_P77795_256_333_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7987 112 142 2.40.50.140
af_Q54G44_5_242_3.30.830.10 Alpha Beta;2-Layer Sandwich;Cytochrome Bc1 Complex; Chain A, domain 1;Metalloenzyme, LuxS/M16 peptidase-like 0.7983 112 140 3.30.830.10
af_A0A1D6NNB1_8_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.7981 112 142 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A2V6GRG1-F1-model_v4 Glyoxalase 0.9333 7 73
AF-A0A142MG90-F1-model_v4 deleted 0.9122 1 77
AF-A0A2V5Q6J1-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9101 7 76
AF-A0A2V9DWN7-F1-model_v4 VOC domain-containing protein 0.9031 94 142
AF-A0A0A9EU40-F1-model_v4 Glyoxalase-like domain-containing protein 0.8973 92 142

Feature Viewer

pLDDT pTM Quality
77.72 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map