F293549

General Info

Members Datasets Scaffolds Average Seq Length
191 147 188 321

Family's Representative Sequence

Representative Sequence 3300005334|Ga0068869_100014823|Ga0068869_1000148234
Length 326
Sequence MALPPVFADRLRLPVIASPLFIISNPELVIAQCKAGVVGSFPALNARPVSQLDEWLHQITEELAAWDRDHPEQKSAPFAVNQIVHKSNNRLEQDVELATKWKAPIVITSLGAREDVNAAVHTYGGVVMHDVINDRFARKAVEKGADGLIAVAALSPFAIIQELREWFDGPLALSGSIANGAAVLAAQAMGADLAYIGSAFIATQEANASQEYKDMIVKGGGDDIVYSNLFTGVHGNYLRASVSAAGLDPDNLPVADPSKMNFGSGGNQSAKAWKDIWGSGQGIGAIKAVPSAAEFIGQLAAQYEAAKASLAAKTSFTSGCGVLAAE

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
3 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
4 2928058823 Ralstonia sp. 1138 Isolate Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
43 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
47 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
48 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
69 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
73 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
74 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
75 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
76 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
77 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
78 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
79 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
85 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
86 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
87 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
88 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
89 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
90 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
91 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
92 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
93 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
97 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
98 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
102 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
105 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
108 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
109 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
110 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
111 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
115 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
116 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
117 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
118 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
119 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
120 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
127 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
131 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
132 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
133 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
134 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
135 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
136 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
137 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
138 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
139 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
140 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
141 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
142 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
143 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
144 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
145 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
146 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
147 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0.52
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.32
Nodule 1.05
Rhizoplane 3.14
Rhizosphere 64.4
Stem 0
Stem Tuber 0
Unclassified 13.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2447314 2162886007 Bacteria 6982
2 Ga0006562J51391_1055312 3300003578 Bacteria 1700
3 Ga0055530_10016604 3300003791 Bacteria 2343
4 Ga0065704_10070447 3300005289 Bacteria 24411
5 Ga0065704_10155478 3300005289 Bacteria 1394
6 Ga0070670_100017021 3300005331 Bacteria 6240
7 Ga0068869_100014823 3300005334 Bacteria 5214
8 Ga0070680_100249194 3300005336 Bacteria 1501
9 Ga0068868_100101463 3300005338 Bacteria 2329
10 Ga0070660_100023558 3300005339 Bacteria 4561
11 Ga0070668_100007093 3300005347 Bacteria 8302
12 Ga0070669_100000814 3300005353 Bacteria 22710
13 Ga0070671_100011293 3300005355 Bacteria 7176
14 Ga0070671_100134981 3300005355 Bacteria 2080
15 Ga0070659_100000839 3300005366 Bacteria 22393
16 Ga0070659_100027448 3300005366 Bacteria 4387
17 Ga0070659_100057857 3300005366 Bacteria 3058
18 Ga0070667_100001006 3300005367 Bacteria 25830
19 Ga0070667_100028700 3300005367 Bacteria 4633
20 Ga0070714_100628099 3300005435 Bacteria 1033
21 Ga0070663_100062694 3300005455 Bacteria 2681
22 Ga0070698_100000259 3300005471 Bacteria 53181
23 Ga0070679_100160507 3300005530 Bacteria 2223
24 Ga0070679_100200987 3300005530 Bacteria 1959
25 Ga0070665_100000530 3300005548 Bacteria 53943
26 Ga0068863_100047552 3300005841 Bacteria 4069
27 Ga0068858_100220383 3300005842 Bacteria 1796
28 Ga0068860_100004428 3300005843 Bacteria 14340
29 Ga0068860_100011187 3300005843 Bacteria 8844
30 Ga0068860_100020466 3300005843 Bacteria 6408
31 Ga0068860_100020716 3300005843 Bacteria 6370
32 Ga0068862_100004967 3300005844 Bacteria 11199
33 Ga0068862_100084080 3300005844 Bacteria 2764
34 Ga0075365_10005509 3300006038 Bacteria 6835
35 Ga0075364_10001674 3300006051 Bacteria 12168
36 Ga0075364_10002886 3300006051 Bacteria 9690
37 Ga0075364_10060023 3300006051 Bacteria 2494
38 Ga0075362_10001327 3300006177 Bacteria 7824
39 Ga0075367_10001461 3300006178 Bacteria 10189
40 Ga0075369_10016671 3300006186 Bacteria 2968
41 Ga0075366_10021907 3300006195 Bacteria 3715
42 Ga0075370_10012373 3300006353 Bacteria 4508
43 Ga0079104_1007540 3300006946 Bacteria 3922
44 Ga0079104_1016868 3300006946 Bacteria 2118
45 Ga0105251_10002601 3300009011 Bacteria 13964
46 Ga0105243_10053603 3300009148 Bacteria 3200
47 Ga0105237_10010978 3300009545 Bacteria 9612
48 Ga0105237_10091276 3300009545 Bacteria 3035
49 Ga0105249_10000056 3300009553 Bacteria 160443
50 Ga0157373_10023007 3300013100 Bacteria 4519
51 Ga0157371_10155944 3300013102 Bacteria 1629
52 Ga0157370_10171600 3300013104 Bacteria 2016
53 Ga0157372_10358328 3300013307 Bacteria 1699
54 Ga0163163_10462372 3300014325 Bacteria 1329
55 Ga0157380_10010602 3300014326 Bacteria 6631
56 Ga0182008_10015551 3300014497 Bacteria 3968
57 Ga0157379_10051776 3300014968 Bacteria 3667
58 Ga0182006_1008186 3300015261 Bacteria 4742
59 Ga0209050_1000217 3300025298 Bacteria 128833
60 Ga0207713_1002321 3300025735 Bacteria 13975
61 Ga0207645_10044403 3300025907 Bacteria 2844
62 Ga0207705_10122749 3300025909 Bacteria 1929
63 Ga0207660_10241474 3300025917 Bacteria 1423
64 Ga0207657_10004307 3300025919 Bacteria 15083
65 Ga0207681_10000394 3300025923 Bacteria 30575
66 Ga0207681_10009883 3300025923 Bacteria 5838
67 Ga0207659_10009421 3300025926 Bacteria 6101
68 Ga0207659_10035161 3300025926 Bacteria 3461
69 Ga0207644_10003798 3300025931 Bacteria 9786
70 Ga0207690_10001459 3300025932 Bacteria 14792
71 Ga0207690_10034878 3300025932 Bacteria 3245
72 Ga0207706_10007147 3300025933 Bacteria 10327
73 Ga0207709_10043798 3300025935 Bacteria 2700
74 Ga0207665_10304656 3300025939 Bacteria 1192
75 Ga0207711_10040064 3300025941 Bacteria 3985
76 Ga0207679_10014432 3300025945 Bacteria 5196
77 Ga0207712_10000015 3300025961 Bacteria 346689
78 Ga0207668_10137297 3300025972 Bacteria 1875
79 Ga0207658_10088119 3300025986 Bacteria 2398
80 Ga0207641_10004476 3300026088 Bacteria 12094
81 Ga0207641_10094503 3300026088 Bacteria 2622
82 Ga0207674_10055171 3300026116 Bacteria 4041
83 Ga0209813_10000132 3300027866 Bacteria 26788
84 Ga0268266_10001263 3300028379 Bacteria 30915
85 Ga0268266_10049665 3300028379 Bacteria 3598
86 Ga0268265_10000021 3300028380 Bacteria 272292
87 Ga0268265_10098049 3300028380 Bacteria 2360
88 Ga0268264_10000820 3300028381 Bacteria 33465
89 Ga0268264_10015700 3300028381 Bacteria 6202
90 Ga0268264_10039388 3300028381 Bacteria 3905
91 Ga0307513_10142106 3300031456 Bacteria 2325
92 Ga0307509_10167218 3300031507 Bacteria 2085
93 Ga0307412_10000247 3300031911 Bacteria 35011
94 Ga0307414_10000443 3300032004 Bacteria 21946
95 Ga0307411_10054447 3300032005 Bacteria 2627
96 Ga0307510_10116784 3300033180 Bacteria 2388
97 Ga0373943_0006277 3300035170 Bacteria 5338
98 Ga0373946_0017448 3300035171 Bacteria 2747
99 Ga0373935_0079089 3300035692 Bacteria 2134
100 Ga0373925_0139300 3300037068 Bacteria 1898
101 Ga0395899_0001024 3300037312 Bacteria 25503
102 Ga0395900_0009971 3300037418 Bacteria 9724
103 Ga0395900_0179168 3300037418 Bacteria 2154
104 Ga0395900_0502572 3300037418 Bacteria 1162
105 Ga0395905_0170150 3300037471 Bacteria 2046
106 Ga0395905_0263906 3300037471 Bacteria 1607
107 Ga0395901_0000268 3300038443 Bacteria 64837
108 Ga0395901_0423122 3300038443 Bacteria 1365
109 Ga0237819_00752 3300038705 Bacteria 10410
110 Ga0400483_040792 3300039062 Bacteria 1451
111 Ga0436363_0656327 3300039450 Bacteria 1305
112 Ga0466972_0000891 3300044658 Bacteria 14345
113 Ga0466965_0023823 3300044683 Bacteria 2957
114 Ga0466961_0000194 3300044693 Bacteria 40839
115 Ga0466964_0025438 3300044706 Bacteria 2311
116 Ga0466968_0011131 3300044735 Bacteria 3502
117 Ga0466957_0018736 3300044842 Bacteria 4066
118 Ga0466959_0000928 3300045049 Bacteria 17381
119 Ga0451576_0000007 3300045051 Bacteria 782228
120 Ga0451576_0013808 3300045051 Bacteria 9023
121 Ga0451576_0600088 3300045051 Bacteria 1157
122 Ga0466967_0136460 3300045976 Bacteria 2281
123 Ga0495610_0005837 3300046512 Bacteria 8651
124 Ga0495632_0012167 3300046519 Bacteria 4975
125 Ga0495643_0016921 3300046522 Bacteria 4275
126 Ga0495597_0031502 3300046542 Bacteria 2412
127 Ga0495625_0030329 3300046660 Bacteria 4037
128 Ga0495661_0028390 3300046665 Bacteria 3582
129 Ga0495687_028193 3300047443 Bacteria 2615
130 Ga0495615_0000113 3300048090 Bacteria 20683
131 Ga0495626_0003383 3300048091 Bacteria 10265
132 Ga0496109_0531431 3300048912 Bacteria 1110
133 Ga0496110_0026417 3300048913 Bacteria 4969
134 Ga0496111_0081702 3300048914 Bacteria 2359
135 Ga0496112_0028960 3300048915 Bacteria 5352
136 Ga0496112_0048816 3300048915 Bacteria 4147
137 Ga0496113_0095192 3300048916 Bacteria 2301
138 Ga0496116_0000039 3300048919 Bacteria 349134
139 Ga0496117_0026218 3300048920 Bacteria 4565
140 Ga0496117_0103762 3300048920 Bacteria 1791
141 Ga0496121_0002650 3300048924 Bacteria 26852
142 Ga0496122_0000841 3300048925 Bacteria 58100
143 Ga0496122_0008945 3300048925 Bacteria 10652
144 Ga0496122_0082994 3300048925 Bacteria 2224
145 Ga0496123_0001492 3300048926 Bacteria 32495
146 Ga0496123_0002576 3300048926 Bacteria 22062
147 Ga0496123_0054383 3300048926 Bacteria 2636
148 Ga0496124_0006389 3300048927 Bacteria 12849
149 Ga0496124_0023750 3300048927 Bacteria 5589
150 Ga0496125_0005536 3300048928 Bacteria 13973
151 Ga0496125_0024035 3300048928 Bacteria 5612
152 Ga0496126_0000041 3300048929 Bacteria 340389
153 Ga0496126_0466750 3300048929 Bacteria 1014
154 Ga0501032_0000348 3300049569 Bacteria 38624
155 Ga0501043_0009313 3300049579 Bacteria 7716
156 Ga0501067_0000017 3300049583 Bacteria 102087
157 Ga0501068_0001593 3300049584 Bacteria 12077
158 Ga0501073_0000021 3300049589 Bacteria 135534
159 Ga0501077_0000036 3300049593 Bacteria 68459
160 Ga0501225_0000185 3300049705 Bacteria 19439
161 Ga0501080_0000369 3300049742 Bacteria 34812
162 Ga0501035_0382402 3300049822 Bacteria 1174
163 Ga0501044_0002311 3300049823 Bacteria 21722
164 Ga0501226_000043 3300049853 Bacteria 58106
165 nmdc:mga03683_61_c1 3300050489 Bacteria 41527
166 nmdc:mga03n38_9620_c1 3300050490 Bacteria 3524
167 nmdc:mga00v17_2648_c1 3300050491 Bacteria 6665
168 nmdc:mga00v17_27175_c1 3300050491 Bacteria 3339
169 nmdc:mga00v17_862_c2 3300050491 Bacteria 15867
170 nmdc:mga0yw44_42522_c1 3300050492 Bacteria 2710
171 nmdc:mga0k408_10661_c1 3300050493 Bacteria 4977
172 nmdc:mga0k408_32435_c2 3300050493 Bacteria 2531
173 nmdc:mga06z11_119411_c1 3300050494 Bacteria 1469
174 nmdc:mga06z11_467_c1 3300050494 Bacteria 15048
175 nmdc:mga04h51_343_c1 3300050495 Bacteria 11595
176 nmdc:mga07m45_38_c1 3300050496 Bacteria 65235
177 nmdc:mga07m45_853_c1 3300050496 Bacteria 13250
178 nmdc:mga07m45_97065_c1 3300050496 Bacteria 1691
179 nmdc:mga0sz30_2862_c1 3300050516 Bacteria 6168
180 nmdc:mga0sz30_80150_c1 3300050516 Bacteria 1412
181 Ga0500643_014894 3300053087 Bacteria 2684
182 Ga0500607_000324 3300053121 Bacteria 45136
183 Ga0500559_0002165 3300053136 Bacteria 10411
184 Ga0500590_027466 3300053148 Bacteria 2952
185 Ga0500616_0001282 3300053153 Bacteria 25024
186 Ga0500637_0002476 3300053178 Bacteria 8223
187 Ga0500645_019075 3300053730 Bacteria 2136
188 Ga0466962_0020592 3300061719 Bacteria 3168

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037418 Ga0395900_0009971 Ga0395900_0009971_6248_7153 293
2 3300038443 Ga0395901_0000268 Ga0395901_0000268_46131_47036 293
3 3300037312 Ga0395899_0001024 Ga0395899_0001024_20415_21323 294
4 3300037471 Ga0395905_0170150 Ga0395905_0170150_591_1499 294
5 3300048915 Ga0496112_0048816 Ga0496112_0048816_1371_2279 294
6 3300050496 nmdc:mga07m45_853_c1 nmdc:mga07m45_853_c1_2528_3430 298
7 3300053136 Ga0500559_0002165 Ga0500559_0002165_5979_6947 298
8 3300053178 Ga0500637_0002476 Ga0500637_0002476_3734_4702 298
9 3300031507 Ga0307509_10167218 Ga0307509_101672182 300
10 3300053121 Ga0500607_000324 Ga0500607_000324_5993_6952 301
11 3300046519 Ga0495632_0012167 Ga0495632_0012167_3559_4602 303
12 3300014968 Ga0157379_10051776 Ga0157379_100517762 305
13 3300006946 Ga0079104_1016868 Ga0079104_10168683 307
14 3300050494 nmdc:mga06z11_119411_c1 nmdc:mga06z11_119411_c1_31_1002 307
15 3300005334 Ga0068869_100014823 Ga0068869_1000148234 308
16 3300009545 Ga0105237_10010978 Ga0105237_100109781 310
17 3300009545 Ga0105237_10091276 Ga0105237_100912764 310
18 3300025926 Ga0207659_10035161 Ga0207659_100351613 310
19 3300025945 Ga0207679_10014432 Ga0207679_100144326 310
20 3300048914 Ga0496111_0081702 Ga0496111_0081702_185_1141 310
21 3300048915 Ga0496112_0028960 Ga0496112_0028960_2997_3953 310
22 3300048916 Ga0496113_0095192 Ga0496113_0095192_295_1251 310
23 3300005435 Ga0070714_100628099 Ga0070714_1006280991 311
24 3300005844 Ga0068862_100084080 Ga0068862_1000840803 311
25 3300006051 Ga0075364_10001674 Ga0075364_1000167413 311
26 3300009148 Ga0105243_10053603 Ga0105243_100536033 311
27 3300013100 Ga0157373_10023007 Ga0157373_100230073 311
28 3300013104 Ga0157370_10171600 Ga0157370_101716002 311
29 3300013307 Ga0157372_10358328 Ga0157372_103583282 311
30 3300014325 Ga0163163_10462372 Ga0163163_104623721 311
31 3300014326 Ga0157380_10010602 Ga0157380_100106029 311
32 3300025907 Ga0207645_10044403 Ga0207645_100444032 311
33 3300025935 Ga0207709_10043798 Ga0207709_100437983 311
34 3300025939 Ga0207665_10304656 Ga0207665_103046561 311
35 3300028380 Ga0268265_10098049 Ga0268265_100980493 311
36 3300039062 Ga0400483_040792 Ga0400483_040792_51_1010 311
37 3300039450 Ga0436363_0656327 Ga0436363_0656327_156_1115 311
38 3300048912 Ga0496109_0531431 Ga0496109_0531431_100_1062 311
39 3300048913 Ga0496110_0026417 Ga0496110_0026417_3719_4681 311
40 3300048925 Ga0496122_0082994 Ga0496122_0082994_430_1392 311
41 3300048926 Ga0496123_0054383 Ga0496123_0054383_374_1336 311
42 3300050491 nmdc:mga00v17_862_c2 nmdc:mga00v17_862_c2_4611_5573 311
43 3300005336 Ga0070680_100249194 Ga0070680_1002491942 312
44 3300005339 Ga0070660_100023558 Ga0070660_1000235586 312
45 3300005366 Ga0070659_100027448 Ga0070659_1000274484 312
46 3300005366 Ga0070659_100057857 Ga0070659_1000578573 312
47 3300005455 Ga0070663_100062694 Ga0070663_1000626944 312
48 3300006038 Ga0075365_10005509 Ga0075365_100055096 312
49 3300006051 Ga0075364_10060023 Ga0075364_100600232 312
50 3300006177 Ga0075362_10001327 Ga0075362_100013272 312
51 3300006178 Ga0075367_10001461 Ga0075367_100014616 312
52 3300006186 Ga0075369_10016671 Ga0075369_100166713 312
53 3300006195 Ga0075366_10021907 Ga0075366_100219073 312
54 3300006353 Ga0075370_10012373 Ga0075370_100123732 312
55 3300006946 Ga0079104_1007540 Ga0079104_10075402 312
56 3300025909 Ga0207705_10122749 Ga0207705_101227493 312
57 3300025917 Ga0207660_10241474 Ga0207660_102414742 312
58 3300025919 Ga0207657_10004307 Ga0207657_1000430717 312
59 3300025932 Ga0207690_10034878 Ga0207690_100348784 312
60 3300027866 Ga0209813_10000132 Ga0209813_1000013220 312
61 3300035170 Ga0373943_0006277 Ga0373943_0006277_1302_2264 312
62 3300035171 Ga0373946_0017448 Ga0373946_0017448_1219_2181 312
63 3300035692 Ga0373935_0079089 Ga0373935_0079089_1015_1977 312
64 3300037068 Ga0373925_0139300 Ga0373925_0139300_546_1508 312
65 3300050489 nmdc:mga03683_61_c1 nmdc:mga03683_61_c1_28500_29444 312
66 3300050490 nmdc:mga03n38_9620_c1 nmdc:mga03n38_9620_c1_166_1110 312
67 3300050491 nmdc:mga00v17_2648_c1 nmdc:mga00v17_2648_c1_4572_5516 312
68 3300050492 nmdc:mga0yw44_42522_c1 nmdc:mga0yw44_42522_c1_463_1407 312
69 3300050493 nmdc:mga0k408_10661_c1 nmdc:mga0k408_10661_c1_1498_2442 312
70 3300050493 nmdc:mga0k408_32435_c2 nmdc:mga0k408_32435_c2_914_1858 312
71 3300050494 nmdc:mga06z11_467_c1 nmdc:mga06z11_467_c1_3391_4335 312
72 3300050495 nmdc:mga04h51_343_c1 nmdc:mga04h51_343_c1_8546_9490 312
73 3300050496 nmdc:mga07m45_38_c1 nmdc:mga07m45_38_c1_55664_56608 312
74 3300050516 nmdc:mga0sz30_2862_c1 nmdc:mga0sz30_2862_c1_3263_4207 312
75 iso_pu_bacteria 2818991438 2819550590 312
76 iso_pu_bacteria 2900577576 2900581494 312
77 iso_pu_bacteria 2928058823 2928060045 312
78 3300006051 Ga0075364_10002886 Ga0075364_1000288610 313
79 3300046522 Ga0495643_0016921 Ga0495643_0016921_2497_3465 313
80 3300046542 Ga0495597_0031502 Ga0495597_0031502_544_1512 313
81 3300046665 Ga0495661_0028390 Ga0495661_0028390_1764_2732 313
82 3300047443 Ga0495687_028193 Ga0495687_028193_130_1098 313
83 3300050491 nmdc:mga00v17_27175_c1 nmdc:mga00v17_27175_c1_855_1823 313
84 3300050516 nmdc:mga0sz30_80150_c1 nmdc:mga0sz30_80150_c1_384_1352 313
85 3300031911 Ga0307412_10000247 Ga0307412_1000024715 314
86 3300032004 Ga0307414_10000443 Ga0307414_100004433 314
87 3300032005 Ga0307411_10054447 Ga0307411_100544474 314
88 3300045051 Ga0451576_0013808 Ga0451576_0013808_3946_4911 314
89 3300049705 Ga0501225_0000185 Ga0501225_0000185_12525_13589 314
90 3300049853 Ga0501226_000043 Ga0501226_000043_44819_45883 314
91 3300005471 Ga0070698_100000259 Ga0070698_10000025942 315
92 3300005530 Ga0070679_100160507 Ga0070679_1001605072 315
93 3300005530 Ga0070679_100200987 Ga0070679_1002009872 315
94 3300005843 Ga0068860_100004428 Ga0068860_1000044285 315
95 3300013102 Ga0157371_10155944 Ga0157371_101559442 315
96 3300025923 Ga0207681_10009883 Ga0207681_100098833 315
97 3300025926 Ga0207659_10009421 Ga0207659_100094217 315
98 3300025933 Ga0207706_10007147 Ga0207706_100071478 315
99 3300028381 Ga0268264_10015700 Ga0268264_100157005 315
100 3300037418 Ga0395900_0179168 Ga0395900_0179168_1077_2048 315
101 3300037418 Ga0395900_0502572 Ga0395900_0502572_85_1056 315
102 3300037471 Ga0395905_0263906 Ga0395905_0263906_118_1089 315
103 3300038443 Ga0395901_0423122 Ga0395901_0423122_107_1078 315
104 3300038705 Ga0237819_00752 Ga0237819_00752_6318_7331 315
105 3300049822 Ga0501035_0382402 Ga0501035_0382402_18_1001 315
106 2162886007 SwRhRL2b_contig_2447314 SwRhRL2b_0814.00004500 316
107 3300003578 Ga0006562J51391_1055312 Ga0006562J51391_10553122 316
108 3300003791 Ga0055530_10016604 Ga0055530_100166043 316
109 3300005289 Ga0065704_10070447 Ga0065704_1007044722 316
110 3300005289 Ga0065704_10155478 Ga0065704_101554782 316
111 3300005331 Ga0070670_100017021 Ga0070670_1000170216 316
112 3300005338 Ga0068868_100101463 Ga0068868_1001014631 316
113 3300005347 Ga0070668_100007093 Ga0070668_1000070931 316
114 3300005353 Ga0070669_100000814 Ga0070669_1000008147 316
115 3300005355 Ga0070671_100011293 Ga0070671_1000112937 316
116 3300005355 Ga0070671_100134981 Ga0070671_1001349811 316
117 3300005366 Ga0070659_100000839 Ga0070659_10000083913 316
118 3300005367 Ga0070667_100001006 Ga0070667_1000010066 316
119 3300005367 Ga0070667_100028700 Ga0070667_1000287004 316
120 3300005548 Ga0070665_100000530 Ga0070665_10000053045 316
121 3300005841 Ga0068863_100047552 Ga0068863_1000475524 316
122 3300005842 Ga0068858_100220383 Ga0068858_1002203832 316
123 3300005843 Ga0068860_100011187 Ga0068860_1000111879 316
124 3300005843 Ga0068860_100020466 Ga0068860_1000204665 316
125 3300005843 Ga0068860_100020716 Ga0068860_1000207165 316
126 3300005844 Ga0068862_100004967 Ga0068862_1000049677 316
127 3300009011 Ga0105251_10002601 Ga0105251_1000260114 316
128 3300009553 Ga0105249_10000056 Ga0105249_1000005686 316
129 3300014497 Ga0182008_10015551 Ga0182008_100155512 316
130 3300015261 Ga0182006_1008186 Ga0182006_10081862 316
131 3300025298 Ga0209050_1000217 Ga0209050_100021755 316
132 3300025735 Ga0207713_1002321 Ga0207713_100232114 316
133 3300025923 Ga0207681_10000394 Ga0207681_1000039418 316
134 3300025931 Ga0207644_10003798 Ga0207644_100037986 316
135 3300025932 Ga0207690_10001459 Ga0207690_100014599 316
136 3300025941 Ga0207711_10040064 Ga0207711_100400643 316
137 3300025961 Ga0207712_10000015 Ga0207712_10000015209 316
138 3300025972 Ga0207668_10137297 Ga0207668_101372972 316
139 3300025986 Ga0207658_10088119 Ga0207658_100881192 316
140 3300026088 Ga0207641_10004476 Ga0207641_100044767 316
141 3300026088 Ga0207641_10094503 Ga0207641_100945033 316
142 3300026116 Ga0207674_10055171 Ga0207674_100551712 316
143 3300028379 Ga0268266_10001263 Ga0268266_1000126323 316
144 3300028379 Ga0268266_10049665 Ga0268266_100496652 316
145 3300028380 Ga0268265_10000021 Ga0268265_1000002135 316
146 3300028381 Ga0268264_10000820 Ga0268264_1000082022 316
147 3300028381 Ga0268264_10039388 Ga0268264_100393882 316
148 3300031456 Ga0307513_10142106 Ga0307513_101421063 316
149 3300033180 Ga0307510_10116784 Ga0307510_101167842 316
150 3300044658 Ga0466972_0000891 Ga0466972_0000891_13166_14170 316
151 3300044683 Ga0466965_0023823 Ga0466965_0023823_555_1559 316
152 3300044693 Ga0466961_0000194 Ga0466961_0000194_30181_31185 316
153 3300044706 Ga0466964_0025438 Ga0466964_0025438_17_1021 316
154 3300044735 Ga0466968_0011131 Ga0466968_0011131_2451_3455 316
155 3300044842 Ga0466957_0018736 Ga0466957_0018736_29_1033 316
156 3300045049 Ga0466959_0000928 Ga0466959_0000928_13013_14017 316
157 3300045051 Ga0451576_0000007 Ga0451576_0000007_162049_163053 316
158 3300045051 Ga0451576_0600088 Ga0451576_0600088_79_1059 316
159 3300045976 Ga0466967_0136460 Ga0466967_0136460_50_1054 316
160 3300046512 Ga0495610_0005837 Ga0495610_0005837_5744_6868 316
161 3300046660 Ga0495625_0030329 Ga0495625_0030329_932_1888 316
162 3300048090 Ga0495615_0000113 Ga0495615_0000113_11838_12788 316
163 3300048091 Ga0495626_0003383 Ga0495626_0003383_7519_8643 316
164 3300048919 Ga0496116_0000039 Ga0496116_0000039_228218_229168 316
165 3300048920 Ga0496117_0026218 Ga0496117_0026218_2242_3192 316
166 3300048920 Ga0496117_0103762 Ga0496117_0103762_318_1268 316
167 3300048924 Ga0496121_0002650 Ga0496121_0002650_2201_3151 316
168 3300048925 Ga0496122_0000841 Ga0496122_0000841_11441_12391 316
169 3300048925 Ga0496122_0008945 Ga0496122_0008945_5908_6858 316
170 3300048926 Ga0496123_0001492 Ga0496123_0001492_26726_27676 316
171 3300048926 Ga0496123_0002576 Ga0496123_0002576_3579_4529 316
172 3300048927 Ga0496124_0006389 Ga0496124_0006389_3967_4917 316
173 3300048927 Ga0496124_0023750 Ga0496124_0023750_811_1761 316
174 3300048928 Ga0496125_0005536 Ga0496125_0005536_9200_10150 316
175 3300048928 Ga0496125_0024035 Ga0496125_0024035_1462_2412 316
176 3300048929 Ga0496126_0000041 Ga0496126_0000041_112732_113682 316
177 3300048929 Ga0496126_0466750 Ga0496126_0466750_20_970 316
178 3300049569 Ga0501032_0000348 Ga0501032_0000348_36683_37672 316
179 3300049579 Ga0501043_0009313 Ga0501043_0009313_5925_6914 316
180 3300049583 Ga0501067_0000017 Ga0501067_0000017_15023_16012 316
181 3300049584 Ga0501068_0001593 Ga0501068_0001593_10227_11216 316
182 3300049589 Ga0501073_0000021 Ga0501073_0000021_60842_61831 316
183 3300049593 Ga0501077_0000036 Ga0501077_0000036_45681_46670 316
184 3300049742 Ga0501080_0000369 Ga0501080_0000369_12552_13541 316
185 3300049823 Ga0501044_0002311 Ga0501044_0002311_8925_9887 316
186 3300050496 nmdc:mga07m45_97065_c1 nmdc:mga07m45_97065_c1_522_1502 316
187 3300053087 Ga0500643_014894 Ga0500643_014894_1317_2333 316
188 3300053148 Ga0500590_027466 Ga0500590_027466_652_1614 316
189 3300053153 Ga0500616_0001282 Ga0500616_0001282_17353_18333 316
190 3300053730 Ga0500645_019075 Ga0500645_019075_386_1345 316
191 3300061719 Ga0466962_0020592 Ga0466962_0020592_50_1054 316

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03060

NMO

Nitronate monooxygenase

8

302

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
5gvj-assembly1.cif.gz_A-2 structure of fabk (m276a) mutant from thermotoga maritima 0.8617 10 312
3bw3-assembly1.cif.gz_A-2 crystal structures and site-directed mutagenesis study of nitroalkane oxidase from streptomyces ansochromogenes 0.8478 12 308
5gvj-assembly2.cif.gz_B-3 structure of fabk (m276a) mutant from thermotoga maritima 0.8449 12 312
2z6j-assembly1.cif.gz_A crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8324 12 312
2z6j-assembly1.cif.gz_B crystal structure of s. pneumoniae enoyl-acyl carrier protein reductase (fabk) in complex with an inhibitor 0.8278 12 312
ID Description Score Start End Superfamily
5gvjA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8617 10 312 3.20.20.70
af_O07738_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.839 12 311 3.20.20.70
af_Q2FZX9_3_354_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8347 12 307 3.20.20.70
af_O06179_1_371_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8297 10 310 3.20.20.70
2gjnA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8265 10 313 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3C1VQ54-F1-model_v4 Nitronate monooxygenase 0.9864 69 177 GO:0018580
AF-A0A357L4U6-F1-model_v4 Nitronate monooxygenase 0.982 6 217 GO:0018580
AF-A0A515BK76-F1-model_v4 deleted 0.9797 9 308
AF-A0A4R1UX75-F1-model_v4 Nitronate monooxygenase 0.9795 1 316 GO:0018580
AF-A0A4Q3N6N2-F1-model_v4 deleted 0.9785 19 199

Feature Viewer

pLDDT pTM Quality
90.6 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map