F292706

General Info

Members Datasets Scaffolds Average Seq Length
190 155 380 193

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10036465|Ga0265327_100364652
Length 198
Sequence MAKNVLNGKRIAILVTDGFEQVEMVKPRKALDKAGAKTVLISPVTPTSQTVRGWKETKWGSKFNVDVPLDQASIQDYEALLLPGGVMSPDKLRINSGAVEFVKAFFDANKPVAAICHGPQLLIEADVLRGRRMTSWPALRTDLTNAGAHWVDEPVVTDSNLVTSRKPDDIPQFNEAMINEFAMAFAQPREMGETVPVL

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
44 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
52 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
88 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
89 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
90 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
91 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
92 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
93 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
94 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
95 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
108 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
109 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
112 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
113 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
114 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
115 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
118 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
119 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
126 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
130 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
131 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
132 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
133 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
145 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
146 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
149 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
150 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
151 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
152 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
153 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
154 2739367866 Hymenobacter sp. YR204 Isolate Unclassified
155 2842677519 Variovorax sp. R-72495 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 6.84
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 88.95
Stem 0
Stem Tuber 0
Unclassified 6.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10036465 3300031251 Bacteria 2702
2 MRS1b_contig_3244769 2162886011 Bacteria 938
3 MBSR1b_contig_13516173 2162886012 Bacteria 959
4 rootH2_10220382 3300003320 Bacteria 1787
5 Ga0065715_10384410 3300005293 Bacteria 903
6 Ga0070666_10037978 3300005335 Bacteria 3203
7 Ga0070680_100107395 3300005336 Bacteria 2322
8 Ga0070689_100130518 3300005340 Bacteria 2015
9 Ga0070689_100336125 3300005340 Bacteria 1264
10 Ga0070661_100003694 3300005344 Bacteria 10551
11 Ga0070669_100000002 3300005353 Bacteria 506497
12 Ga0070671_100039844 3300005355 Bacteria 3900
13 Ga0070673_100161440 3300005364 Bacteria 1906
14 Ga0070688_100339555 3300005365 Bacteria 1096
15 Ga0070667_100055478 3300005367 Bacteria 3346
16 Ga0070709_10016492 3300005434 Bacteria 4219
17 Ga0070713_100029212 3300005436 Bacteria 4364
18 Ga0070710_10294460 3300005437 Bacteria 1057
19 Ga0070701_10023899 3300005438 Bacteria 2950
20 Ga0070663_100004228 3300005455 Bacteria 8400
21 Ga0070663_100404314 3300005455 Bacteria 1117
22 Ga0070662_100061740 3300005457 Bacteria 2737
23 Ga0070662_100073378 3300005457 Bacteria 2528
24 Ga0070681_10028249 3300005458 Bacteria 5638
25 Ga0068867_101461434 3300005459 Bacteria 635
26 Ga0070679_100080504 3300005530 Bacteria 3247
27 Ga0070684_100000273 3300005535 Bacteria 35830
28 Ga0070672_100358378 3300005543 Bacteria 1244
29 Ga0070686_100021177 3300005544 Bacteria 3860
30 Ga0070704_100572308 3300005549 Bacteria 990
31 Ga0070704_100704009 3300005549 Bacteria 896
32 Ga0068855_100106233 3300005563 Bacteria 3227
33 Ga0070664_100000589 3300005564 Bacteria 27672
34 Ga0068857_100082614 3300005577 Bacteria 2870
35 Ga0068854_100035204 3300005578 Bacteria 3503
36 Ga0068856_100269253 3300005614 Bacteria 1719
37 Ga0068852_101534056 3300005616 Bacteria 689
38 Ga0068859_100336350 3300005617 Bacteria 1604
39 Ga0068864_100095922 3300005618 Bacteria 2624
40 Ga0068861_100888518 3300005719 Bacteria 843
41 Ga0070717_10075958 3300006028 Bacteria 2811
42 Ga0070712_100203445 3300006175 Bacteria 1557
43 Ga0097621_100039148 3300006237 Bacteria 3807
44 Ga0097621_100413060 3300006237 Bacteria 1210
45 Ga0075431_100203159 3300006847 Bacteria 2027
46 Ga0068865_101119232 3300006881 Unclassified 694
47 Ga0097620_100336316 3300006931 Bacteria 1604
48 Ga0099794_10146819 3300007265 Bacteria 1196
49 Ga0114129_10785802 3300009147 Unclassified 1216
50 Ga0105242_11023328 3300009176 Bacteria 835
51 Ga0105248_10127528 3300009177 Bacteria 2871
52 Ga0105248_10157537 3300009177 Bacteria 2562
53 Ga0105249_11345815 3300009553 Bacteria 786
54 Ga0105239_10524554 3300010375 Unclassified 1348
55 Ga0157370_10277779 3300013104 Bacteria 1548
56 Ga0157369_10156184 3300013105 Bacteria 2410
57 Ga0157374_10108132 3300013296 Bacteria 2673
58 Ga0157378_10451104 3300013297 Bacteria 1276
59 Ga0157378_11570815 3300013297 Bacteria 703
60 Ga0157372_10354362 3300013307 Bacteria 1710
61 Ga0163163_10015214 3300014325 Bacteria 7107
62 Ga0163163_10185041 3300014325 Unclassified 2131
63 Ga0182008_10138887 3300014497 Bacteria 1215
64 Ga0157379_10142876 3300014968 Bacteria 2158
65 Ga0206356_10717832 3300020070 Bacteria 1782
66 Ga0206356_10909646 3300020070 Bacteria 802
67 Ga0206349_1482835 3300020075 Bacteria 1827
68 Ga0206351_10311176 3300020077 Bacteria 1354
69 Ga0206352_10891485 3300020078 Bacteria 632
70 Ga0206350_10034440 3300020080 Bacteria 1861
71 Ga0206350_10194990 3300020080 Bacteria 719
72 Ga0206350_10563232 3300020080 Bacteria 1567
73 Ga0206350_11269011 3300020080 Bacteria 870
74 Ga0206354_11578876 3300020081 Bacteria 1822
75 Ga0213876_10000104 3300021384 Bacteria 93860
76 Ga0224712_10007479 3300022467 Bacteria 3184
77 Ga0224712_10016456 3300022467 Bacteria 2430
78 Ga0224712_10075742 3300022467 Bacteria 1377
79 Ga0207697_10032866 3300025315 Bacteria 2124
80 Ga0207692_10113356 3300025898 Bacteria 1507
81 Ga0207680_10222149 3300025903 Bacteria 1295
82 Ga0207705_10001059 3300025909 Bacteria 22356
83 Ga0207649_10003814 3300025920 Bacteria 8217
84 Ga0207652_10082522 3300025921 Bacteria 2812
85 Ga0207681_10000009 3300025923 Bacteria 410736
86 Ga0207650_10314940 3300025925 Bacteria 1280
87 Ga0207650_10371626 3300025925 Bacteria 1179
88 Ga0207687_10863622 3300025927 Bacteria 773
89 Ga0207700_10019961 3300025928 Bacteria 4539
90 Ga0207644_10122071 3300025931 Bacteria 1984
91 Ga0207706_10120523 3300025933 Bacteria 2306
92 Ga0207691_10080240 3300025940 Bacteria 2935
93 Ga0207711_10231220 3300025941 Bacteria 1693
94 Ga0207711_10814123 3300025941 Bacteria 870
95 Ga0207661_10054521 3300025944 Bacteria 3203
96 Ga0207667_10109407 3300025949 Bacteria 2850
97 Ga0207712_10844428 3300025961 Bacteria 807
98 Ga0207658_10635687 3300025986 Bacteria 961
99 Ga0207639_10411522 3300026041 Bacteria 1221
100 Ga0207678_10014243 3300026067 Bacteria 6991
101 Ga0207678_10024903 3300026067 Bacteria 5225
102 Ga0207676_10112484 3300026095 Bacteria 2281
103 Ga0207676_10949482 3300026095 Bacteria 845
104 Ga0207674_10078109 3300026116 Bacteria 3315
105 Ga0316177_1074891 3300030731 Bacteria 5176
106 Ga0316176_1065436 3300030732 Bacteria 2980
107 Ga0314311_1070400 3300030733 Bacteria 25955
108 Ga0316179_1005344 3300030734 Bacteria 3024
109 Ga0316178_1089640 3300030735 Bacteria 7039
110 Ga0316180_1096745 3300030736 Bacteria 1030
111 Ga0316183_1008211 3300030742 Bacteria 6667
112 Ga0316181_1081212 3300030744 Bacteria 3302
113 Ga0316182_1020488 3300030745 Bacteria 2742
114 Ga0307408_100138735 3300031548 Unclassified 1906
115 Ga0307408_100391011 3300031548 Bacteria 1191
116 Ga0307405_10046426 3300031731 Bacteria 2668
117 Ga0307405_10972794 3300031731 Bacteria 722
118 Ga0307413_10147993 3300031824 Bacteria 1633
119 Ga0307410_10109087 3300031852 Bacteria 2000
120 Ga0307410_11015808 3300031852 Bacteria 716
121 Ga0307406_10180727 3300031901 Unclassified 1535
122 Ga0307406_10197960 3300031901 Bacteria 1476
123 Ga0307407_10241634 3300031903 Bacteria 1232
124 Ga0307412_10009144 3300031911 Bacteria 5677
125 Ga0307412_10770815 3300031911 Unclassified 832
126 Ga0307409_100088684 3300031995 Bacteria 2526
127 Ga0307409_100141160 3300031995 Bacteria 2076
128 Ga0307416_100020396 3300032002 Bacteria 4729
129 Ga0307416_100061231 3300032002 Bacteria 3070
130 Ga0307414_10034065 3300032004 Bacteria 3372
131 Ga0307414_10336966 3300032004 Bacteria 1290
132 Ga0307411_10049075 3300032005 Unclassified 2740
133 Ga0307411_10296948 3300032005 Bacteria 1294
134 Ga0307411_10388903 3300032005 Bacteria 1149
135 Ga0395899_0000004 3300037312 Bacteria 874267
136 Ga0395900_0060652 3300037418 Bacteria 3892
137 Ga0395905_0005939 3300037471 Bacteria 12371
138 Ga0395901_0331945 3300038443 Bacteria 1572
139 Ga0436365_1195936 3300039437 Bacteria 50732
140 Ga0451807_1187479 3300041486 Bacteria 1672
141 Ga0439449_0013197 3300042007 Bacteria 3108
142 Ga0450890_021729 3300042127 Bacteria 874
143 Ga0451577_0923511 3300042876 Bacteria 785
144 Ga0466966_0091277 3300044684 Bacteria 1891
145 Ga0453684_0215460 3300044712 Bacteria 2228
146 Ga0466959_0019950 3300045049 Bacteria 4935
147 Ga0466959_0051772 3300045049 Bacteria 3009
148 Ga0451576_0036402 3300045051 Bacteria 5218
149 Ga0451576_1330950 3300045051 Bacteria 748
150 Ga0466967_0589766 3300045976 Bacteria 1096
151 Ga0495603_0524181 3300046455 Bacteria 679
152 Ga0496100_0385647 3300048903 Bacteria 1065
153 Ga0496101_0110058 3300048904 Bacteria 2073
154 Ga0496104_0161285 3300048907 Bacteria 2151
155 Ga0496104_0673896 3300048907 Bacteria 942
156 Ga0496105_0083157 3300048908 Bacteria 2644
157 Ga0496106_0167983 3300048909 Bacteria 1738
158 Ga0496108_0004211 3300048911 Bacteria 11585
159 Ga0496109_0000569 3300048912 Bacteria 30886
160 Ga0496109_0089133 3300048912 Bacteria 2852
161 Ga0496110_0034026 3300048913 Bacteria 4411
162 Ga0496111_0006776 3300048914 Bacteria 7466
163 Ga0496112_0004899 3300048915 Bacteria 11452
164 Ga0496112_0061641 3300048915 Bacteria 3698
165 Ga0496113_0077034 3300048916 Bacteria 2549
166 Ga0496114_0680486 3300048917 Bacteria 903
167 Ga0501034_0300926 3300049571 Bacteria 1541
168 Ga0501034_0734264 3300049571 Bacteria 884
169 Ga0501036_1498543 3300049572 Bacteria 546
170 Ga0501040_0020680 3300049576 Bacteria 4389
171 Ga0501043_0133476 3300049579 Bacteria 1946
172 Ga0501047_0005823 3300049581 Bacteria 11601
173 Ga0501048_0121685 3300049582 Bacteria 1844
174 Ga0501048_0247351 3300049582 Bacteria 1266
175 Ga0501070_0158533 3300049586 Bacteria 1866
176 Ga0501074_0476217 3300049590 Bacteria 885
177 Ga0501075_0794243 3300049591 Unclassified 720
178 Ga0501077_0633418 3300049593 Bacteria 687
179 Ga0501239_004680 3300049672 Unclassified 1353
180 Ga0501249_005739 3300049679 Bacteria 2537
181 Ga0501225_0014009 3300049705 Bacteria 2242
182 Ga0501080_0063555 3300049742 Bacteria 3435
183 Ga0501262_000089 3300049759 Bacteria 11464
184 Ga0501267_009988 3300049764 Unclassified 954
185 Ga0501268_015371 3300049765 Unclassified 1257
186 Ga0501269_025216 3300049766 Bacteria 749
187 Ga0501044_0000704 3300049823 Bacteria 40368
188 Ga0501082_0104136 3300060353 Bacteria 2455
189 2740031731 2739367866 Bacteria 4215900
190 2842679188 2842677519 Bacteria 5615038
191 Ga0265327_10036465
192 MRS1b_contig_3244769
193 MBSR1b_contig_13516173
194 rootH2_10220382
195 Ga0065715_10384410
196 Ga0070666_10037978
197 Ga0070680_100107395
198 Ga0070689_100130518
199 Ga0070689_100336125
200 Ga0070661_100003694
201 Ga0070669_100000002
202 Ga0070671_100039844
203 Ga0070673_100161440
204 Ga0070688_100339555
205 Ga0070667_100055478
206 Ga0070709_10016492
207 Ga0070713_100029212
208 Ga0070710_10294460
209 Ga0070701_10023899
210 Ga0070663_100004228
211 Ga0070663_100404314
212 Ga0070662_100061740
213 Ga0070662_100073378
214 Ga0070681_10028249
215 Ga0068867_101461434
216 Ga0070679_100080504
217 Ga0070684_100000273
218 Ga0070672_100358378
219 Ga0070686_100021177
220 Ga0070704_100572308
221 Ga0070704_100704009
222 Ga0068855_100106233
223 Ga0070664_100000589
224 Ga0068857_100082614
225 Ga0068854_100035204
226 Ga0068856_100269253
227 Ga0068852_101534056
228 Ga0068859_100336350
229 Ga0068864_100095922
230 Ga0068861_100888518
231 Ga0070717_10075958
232 Ga0070712_100203445
233 Ga0097621_100039148
234 Ga0097621_100413060
235 Ga0075431_100203159
236 Ga0068865_101119232
237 Ga0097620_100336316
238 Ga0099794_10146819
239 Ga0114129_10785802
240 Ga0105242_11023328
241 Ga0105248_10127528
242 Ga0105248_10157537
243 Ga0105249_11345815
244 Ga0105239_10524554
245 Ga0157370_10277779
246 Ga0157369_10156184
247 Ga0157374_10108132
248 Ga0157378_10451104
249 Ga0157378_11570815
250 Ga0157372_10354362
251 Ga0163163_10015214
252 Ga0163163_10185041
253 Ga0182008_10138887
254 Ga0157379_10142876
255 Ga0206356_10717832
256 Ga0206356_10909646
257 Ga0206349_1482835
258 Ga0206351_10311176
259 Ga0206352_10891485
260 Ga0206350_10034440
261 Ga0206350_10194990
262 Ga0206350_10563232
263 Ga0206350_11269011
264 Ga0206354_11578876
265 Ga0213876_10000104
266 Ga0224712_10007479
267 Ga0224712_10016456
268 Ga0224712_10075742
269 Ga0207697_10032866
270 Ga0207692_10113356
271 Ga0207680_10222149
272 Ga0207705_10001059
273 Ga0207649_10003814
274 Ga0207652_10082522
275 Ga0207681_10000009
276 Ga0207650_10314940
277 Ga0207650_10371626
278 Ga0207687_10863622
279 Ga0207700_10019961
280 Ga0207644_10122071
281 Ga0207706_10120523
282 Ga0207691_10080240
283 Ga0207711_10231220
284 Ga0207711_10814123
285 Ga0207661_10054521
286 Ga0207667_10109407
287 Ga0207712_10844428
288 Ga0207658_10635687
289 Ga0207639_10411522
290 Ga0207678_10014243
291 Ga0207678_10024903
292 Ga0207676_10112484
293 Ga0207676_10949482
294 Ga0207674_10078109
295 Ga0316177_1074891
296 Ga0316176_1065436
297 Ga0314311_1070400
298 Ga0316179_1005344
299 Ga0316178_1089640
300 Ga0316180_1096745
301 Ga0316183_1008211
302 Ga0316181_1081212
303 Ga0316182_1020488
304 Ga0307408_100138735
305 Ga0307408_100391011
306 Ga0307405_10046426
307 Ga0307405_10972794
308 Ga0307413_10147993
309 Ga0307410_10109087
310 Ga0307410_11015808
311 Ga0307406_10180727
312 Ga0307406_10197960
313 Ga0307407_10241634
314 Ga0307412_10009144
315 Ga0307412_10770815
316 Ga0307409_100088684
317 Ga0307409_100141160
318 Ga0307416_100020396
319 Ga0307416_100061231
320 Ga0307414_10034065
321 Ga0307414_10336966
322 Ga0307411_10049075
323 Ga0307411_10296948
324 Ga0307411_10388903
325 Ga0395899_0000004
326 Ga0395900_0060652
327 Ga0395905_0005939
328 Ga0395901_0331945
329 Ga0436365_1195936
330 Ga0451807_1187479
331 Ga0439449_0013197
332 Ga0450890_021729
333 Ga0451577_0923511
334 Ga0466966_0091277
335 Ga0453684_0215460
336 Ga0466959_0019950
337 Ga0466959_0051772
338 Ga0451576_0036402
339 Ga0451576_1330950
340 Ga0466967_0589766
341 Ga0495603_0524181
342 Ga0496100_0385647
343 Ga0496101_0110058
344 Ga0496104_0161285
345 Ga0496104_0673896
346 Ga0496105_0083157
347 Ga0496106_0167983
348 Ga0496108_0004211
349 Ga0496109_0000569
350 Ga0496109_0089133
351 Ga0496110_0034026
352 Ga0496111_0006776
353 Ga0496112_0004899
354 Ga0496112_0061641
355 Ga0496113_0077034
356 Ga0496114_0680486
357 Ga0501034_0300926
358 Ga0501034_0734264
359 Ga0501036_1498543
360 Ga0501040_0020680
361 Ga0501043_0133476
362 Ga0501047_0005823
363 Ga0501048_0121685
364 Ga0501048_0247351
365 Ga0501070_0158533
366 Ga0501074_0476217
367 Ga0501075_0794243
368 Ga0501077_0633418
369 Ga0501239_004680
370 Ga0501249_005739
371 Ga0501225_0014009
372 Ga0501080_0063555
373 Ga0501262_000089
374 Ga0501267_009988
375 Ga0501268_015371
376 Ga0501269_025216
377 Ga0501044_0000704
378 Ga0501082_0104136
379 2740031731
380 2842679188

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

9

180

0.94

PF00117

GATase

Glutamine amidotransferase class-I

47

157

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9816 9 175
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9811 9 175
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9791 7 176
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9749 5 187
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9726 9 176
ID Description Score Start End Superfamily
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9816 9 175 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9729 5 187 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9598 8 176 3.40.50.880
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9573 5 187 3.40.50.880
4y1eA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9555 8 176 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A1Q7VJ80-F1-model_v4 Protease 0.9985 4 148 GO:0006508
GO:0008233
AF-A0A3N1PQS0-F1-model_v4 Protease I 0.9972 1 183 GO:0006508
GO:0008233
AF-A0A7Y2WZQ8-F1-model_v4 Type 1 glutamine amidotransferase 0.9972 3 179 GO:0016740
AF-A0A6A5L361-F1-model_v4 deleted 0.9961 4 182
AF-A0A1L6LC32-F1-model_v4 deleted 0.9961 2 182

Map