F292514

General Info

Members Datasets Scaffolds Average Seq Length
190 127 190 88

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_11862326|Ga0157378_118623261
Length 109
Sequence MPQGIRRLSSAALIWNKKFMARICELTGVGPRKGSIIWRSGKPKKQGGIGTHITAITKRKFFPNLQRVKALIDGEVRYIRVSTRALKQGLVTKAPKRTWKKGDEAKKKA

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
26 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
27 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
28 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
29 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
30 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
31 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
32 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
33 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
34 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
35 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
43 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
44 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
45 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
48 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
60 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
61 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
62 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
63 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
70 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
71 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
72 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
73 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
74 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
75 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
76 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
77 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
78 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
79 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
82 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
83 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
88 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
89 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
90 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
91 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
92 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
93 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
94 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
97 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
98 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
99 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
100 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
101 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
102 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
103 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
106 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
107 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
108 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
109 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
110 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
111 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
112 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
113 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
114 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
115 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
116 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
122 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
123 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
124 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
125 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
126 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
127 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.11
Rhizosphere 95.79
Stem 0
Stem Tuber 0
Unclassified 2.11

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10845778 3300005289 Unclassified 511
2 Ga0065707_10830838 3300005295 Bacteria 555
3 Ga0070690_101493155 3300005330 Unclassified 546
4 Ga0070677_10330704 3300005333 Unclassified 783
5 Ga0068869_102081142 3300005334 Unclassified 510
6 Ga0070689_100007587 3300005340 Bacteria 7599
7 Ga0070689_100603647 3300005340 Bacteria 951
8 Ga0070689_101691059 3300005340 Unclassified 576
9 Ga0070675_101933595 3300005354 Unclassified 544
10 Ga0070674_101727602 3300005356 Bacteria 566
11 Ga0070688_100111349 3300005365 Bacteria 1821
12 Ga0070688_101216887 3300005365 Bacteria 606
13 Ga0070688_101311623 3300005365 Unclassified 584
14 Ga0070701_10564135 3300005438 Bacteria 749
15 Ga0070711_100277363 3300005439 Bacteria 1325
16 Ga0070705_100104101 3300005440 Bacteria 1799
17 Ga0070700_100998284 3300005441 Unclassified 688
18 Ga0070708_101366349 3300005445 Bacteria 661
19 Ga0070708_102125386 3300005445 Bacteria 519
20 Ga0070685_10420019 3300005466 Bacteria 930
21 Ga0070707_100398731 3300005468 Bacteria 1336
22 Ga0070707_101486941 3300005468 Unclassified 644
23 Ga0070698_102097545 3300005471 Bacteria 519
24 Ga0070686_100084890 3300005544 Unclassified 2105
25 Ga0070686_100902738 3300005544 Unclassified 719
26 Ga0070704_101560519 3300005549 Bacteria 608
27 Ga0070704_102061422 3300005549 Unclassified 530
28 Ga0068857_100542823 3300005577 Unclassified 1095
29 Ga0068856_101639160 3300005614 Unclassified 656
30 Ga0068859_101362520 3300005617 Unclassified 782
31 Ga0068859_101818141 3300005617 Bacteria 673
32 Ga0068863_100112561 3300005841 Bacteria 2592
33 Ga0068863_100224416 3300005841 Unclassified 1811
34 Ga0068858_100885558 3300005842 Bacteria 873
35 Ga0070715_10538272 3300006163 Bacteria 675
36 Ga0097621_102397805 3300006237 Bacteria 505
37 Ga0075431_100277073 3300006847 Unclassified 1698
38 Ga0075433_11182481 3300006852 Bacteria 664
39 Ga0075436_101253985 3300006914 Unclassified 560
40 Ga0097620_101362654 3300006931 Unclassified 782
41 Ga0097620_101817791 3300006931 Bacteria 673
42 Ga0075435_100879410 3300007076 Unclassified 781
43 Ga0099795_10519664 3300007788 Bacteria 557
44 Ga0105240_10005016 3300009093 Bacteria 19863
45 Ga0111539_10063279 3300009094 Bacteria 4378
46 Ga0111539_10560207 3300009094 Bacteria 1331
47 Ga0111539_11565389 3300009094 Unclassified 764
48 Ga0111539_12215481 3300009094 Unclassified 637
49 Ga0114129_11311891 3300009147 Bacteria 897
50 Ga0105242_10016207 3300009176 Bacteria 5791
51 Ga0105242_10317104 3300009176 Bacteria 1429
52 Ga0105248_12180846 3300009177 Unclassified 630
53 Ga0105238_11562123 3300009551 Bacteria 689
54 Ga0105249_10233139 3300009553 Bacteria 1816
55 Ga0105249_10966627 3300009553 Bacteria 920
56 Ga0105246_12499338 3300011119 Unclassified 508
57 Ga0157371_10591849 3300013102 Unclassified 825
58 Ga0157378_10918028 3300013297 Bacteria 907
59 Ga0157378_11824437 3300013297 Bacteria 656
60 Ga0157378_11862326 3300013297 Unclassified 650
61 Ga0163162_10744450 3300013306 Bacteria 1100
62 Ga0157375_10954962 3300013308 Unclassified 999
63 Ga0163163_10219887 3300014325 Bacteria 1948
64 Ga0157376_10967442 3300014969 Unclassified 872
65 Ga0157376_12344364 3300014969 Unclassified 573
66 Ga0163161_10976671 3300017792 Unclassified 722
67 Ga0207642_11059812 3300025899 Unclassified 523
68 Ga0207685_10828292 3300025905 Bacteria 511
69 Ga0207695_10036195 3300025913 Bacteria 5339
70 Ga0207671_10484163 3300025914 Unclassified 986
71 Ga0207662_10363377 3300025918 Unclassified 975
72 Ga0207686_10382524 3300025934 Bacteria 1068
73 Ga0207670_10277377 3300025936 Bacteria 1305
74 Ga0207704_11799912 3300025938 Unclassified 527
75 Ga0207712_10777734 3300025961 Bacteria 840
76 Ga0207702_10425018 3300026078 Unclassified 1285
77 Ga0207641_10120680 3300026088 Bacteria 2339
78 Ga0207641_10188060 3300026088 Bacteria 1896
79 Ga0207641_10550024 3300026088 Bacteria 1126
80 Ga0207428_10393539 3300027907 Unclassified 1015
81 Ga0265337_1000208 3300028556 Bacteria 31510
82 Ga0265337_1047612 3300028556 Unclassified 1215
83 Ga0265326_10129589 3300028558 Bacteria 718
84 Ga0265319_1081246 3300028563 Unclassified 1029
85 Ga0265334_10016532 3300028573 Bacteria 3051
86 Ga0265336_10000716 3300028666 Bacteria 17526
87 Ga0265336_10018658 3300028666 Bacteria 2246
88 Ga0265338_10001360 3300028800 Bacteria 39784
89 Ga0265338_10003774 3300028800 Bacteria 21055
90 Ga0265338_10004733 3300028800 Bacteria 18206
91 Ga0265338_10005878 3300028800 Bacteria 15823
92 Ga0265338_10086269 3300028800 Bacteria 2613
93 Ga0265338_10356767 3300028800 Bacteria 1050
94 Ga0265338_10374563 3300028800 Unclassified 1019
95 Ga0265338_10763012 3300028800 Unclassified 664
96 Ga0265338_10789232 3300028800 Unclassified 651
97 Ga0265324_10000729 3300029957 Bacteria 21931
98 Ga0265324_10013739 3300029957 Bacteria 3013
99 Ga0265324_10045205 3300029957 Bacteria 1517
100 Ga0265324_10102350 3300029957 Unclassified 973
101 Ga0265324_10205575 3300029957 Bacteria 668
102 Ga0265324_10320966 3300029957 Unclassified 527
103 Ga0307511_10149035 3300030521 Bacteria 1349
104 Ga0265332_10348612 3300031238 Unclassified 611
105 Ga0265320_10004229 3300031240 Bacteria 9433
106 Ga0265320_10012154 3300031240 Bacteria 5027
107 Ga0265320_10093997 3300031240 Unclassified 1386
108 Ga0265320_10098439 3300031240 Bacteria 1349
109 Ga0265325_10098393 3300031241 Unclassified 1435
110 Ga0265340_10016712 3300031247 Bacteria 3797
111 Ga0265340_10081339 3300031247 Bacteria 1525
112 Ga0265340_10214709 3300031247 Unclassified 863
113 Ga0265331_10216591 3300031250 Unclassified 861
114 Ga0265327_10043472 3300031251 Bacteria 2403
115 Ga0265316_10748619 3300031344 Unclassified 687
116 Ga0265316_10817836 3300031344 Bacteria 653
117 Ga0265314_10427425 3300031711 Unclassified 710
118 Ga0265342_10129191 3300031712 Bacteria 1417
119 Ga0265342_10263524 3300031712 Unclassified 916
120 Ga0307516_10876472 3300031730 Unclassified 563
121 Ga0373923_0626497 3300035111 Unclassified 531
122 Ga0373953_0135711 3300035117 Bacteria 1051
123 Ga0373954_0065523 3300035118 Bacteria 1719
124 Ga0373955_0556922 3300035172 Bacteria 701
125 Ga0373931_1043081 3300035691 Unclassified 555
126 Ga0373927_0043998 3300035695 Unclassified 2890
127 Ga0373927_0821157 3300035695 Unclassified 614
128 Ga0373933_0050004 3300035724 Bacteria 2494
129 Ga0373933_0263195 3300035724 Bacteria 1112
130 Ga0373947_0714690 3300035725 Unclassified 684
131 Ga0373937_0159538 3300036401 Bacteria 2114
132 Ga0373937_0425628 3300036401 Bacteria 1260
133 Ga0373925_0473800 3300037068 Unclassified 1027
134 Ga0373925_0506853 3300037068 Bacteria 991
135 Ga0373925_0588539 3300037068 Unclassified 916
136 Ga0451798_0605957 3300041458 Bacteria 1497
137 Ga0451798_1018077 3300041458 Unclassified 570
138 Ga0451807_0199737 3300041486 Bacteria 691
139 Ga0451807_0201106 3300041486 Bacteria 1021
140 Ga0451833_0221895 3300041491 Unclassified 527
141 Ga0451853_1091639 3300041512 Bacteria 647
142 Ga0451577_0322992 3300042876 Bacteria 1400
143 Ga0451577_0969631 3300042876 Bacteria 764
144 Ga0453683_0194325 3300044673 Bacteria 1288
145 Ga0453684_0727914 3300044712 Unclassified 1076
146 Ga0453684_1187701 3300044712 Bacteria 802
147 Ga0453684_1416576 3300044712 Bacteria 720
148 Ga0453684_1518394 3300044712 Unclassified 690
149 Ga0451576_0107276 3300045051 Bacteria 2906
150 Ga0451576_0388432 3300045051 Unclassified 1463
151 Ga0451576_0668713 3300045051 Bacteria 1091
152 Ga0495653_0831961 3300046463 Bacteria 553
153 Ga0495582_0929443 3300046473 Unclassified 503
154 Ga0495618_0009679 3300046514 Bacteria 5818
155 Ga0495628_1060833 3300046516 Unclassified 555
156 Ga0495630_0780688 3300046517 Unclassified 730
157 Ga0495630_0841198 3300046517 Unclassified 700
158 Ga0495666_0178436 3300046526 Bacteria 981
159 Ga0495586_0000398 3300046535 Bacteria 26391
160 Ga0495586_0624606 3300046535 Bacteria 622
161 Ga0495587_0650433 3300046536 Unclassified 579
162 Ga0495587_0657915 3300046536 Unclassified 575
163 Ga0495645_0032603 3300046543 Unclassified 3801
164 Ga0495645_0618327 3300046543 Unclassified 665
165 Ga0495634_0000500 3300046642 Bacteria 38456
166 Ga0495635_0580163 3300046663 Bacteria 733
167 Ga0495657_0161072 3300046675 Bacteria 1388
168 Ga0495599_0532922 3300046678 Unclassified 689
169 Ga0495658_0905359 3300046683 Unclassified 564
170 Ga0495613_0003628 3300046689 Bacteria 11562
171 Ga0495604_0225535 3300047317 Unclassified 1288
172 Ga0495676_0449105 3300047321 Bacteria 851
173 Ga0495680_0006416 3300047322 Bacteria 10934
174 Ga0501034_0062130 3300049571 Bacteria 3751
175 Ga0501036_0348707 3300049572 Bacteria 1236
176 Ga0501043_0603592 3300049579 Unclassified 810
177 Ga0501047_0071675 3300049581 Bacteria 3335
178 Ga0501048_1323328 3300049582 Unclassified 518
179 Ga0501080_1363460 3300049742 Unclassified 606
180 Ga0501035_0498580 3300049822 Bacteria 1002
181 Ga0501044_0387496 3300049823 Bacteria 1312
182 nmdc:mga09592_350120_c1 3300050508 Unclassified 1278
183 nmdc:mga0qj67_1201174_c1 3300050509 Bacteria 590
184 nmdc:mga0qj67_223784_c1 3300050509 Bacteria 1527
185 nmdc:mga06r32_24479_c1 3300050510 Bacteria 5604
186 nmdc:mga06r32_414535_c1 3300050510 Bacteria 1328
187 nmdc:mga08y16_1527905_c1 3300050511 Unclassified 627
188 nmdc:mga08x19_854274_c1 3300050514 Unclassified 646
189 nmdc:mga0a205_1021301_c1 3300050515 Bacteria 674
190 nmdc:mga0a205_1308851_c1 3300050515 Bacteria 572

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300030521 Ga0307511_10149035 Ga0307511_101490351 75
2 3300025914 Ga0207671_10484163 Ga0207671_104841631 76
3 3300026078 Ga0207702_10425018 Ga0207702_104250181 76
4 3300028800 Ga0265338_10001360 Ga0265338_100013604 76
5 3300031247 Ga0265340_10081339 Ga0265340_100813392 76
6 3300031711 Ga0265314_10427425 Ga0265314_104274252 76
7 3300041491 Ga0451833_0221895 Ga0451833_0221895_191_424 76
8 3300044712 Ga0453684_1187701 Ga0453684_1187701_522_755 76
9 3300006163 Ga0070715_10538272 Ga0070715_105382721 77
10 3300028800 Ga0265338_10003774 Ga0265338_1000377413 77
11 3300028800 Ga0265338_10004733 Ga0265338_100047332 77
12 3300029957 Ga0265324_10013739 Ga0265324_100137393 77
13 3300029957 Ga0265324_10102350 Ga0265324_101023501 77
14 3300031240 Ga0265320_10004229 Ga0265320_100042292 77
15 3300031250 Ga0265331_10216591 Ga0265331_102165911 77
16 3300031712 Ga0265342_10129191 Ga0265342_101291913 77
17 3300046517 Ga0495630_0780688 Ga0495630_0780688_29_268 77
18 3300046536 Ga0495587_0657915 Ga0495587_0657915_202_438 77
19 3300005471 Ga0070698_102097545 Ga0070698_1020975451 84
20 3300005295 Ga0065707_10830838 Ga0065707_108308381 86
21 3300005365 Ga0070688_101311623 Ga0070688_1013116231 86
22 3300005468 Ga0070707_100398731 Ga0070707_1003987312 86
23 3300009094 Ga0111539_10063279 Ga0111539_100632794 86
24 3300027907 Ga0207428_10393539 Ga0207428_103935392 86
25 3300005334 Ga0068869_102081142 Ga0068869_1020811421 87
26 3300005441 Ga0070700_100998284 Ga0070700_1009982841 87
27 3300005468 Ga0070707_101486941 Ga0070707_1014869412 87
28 3300005617 Ga0068859_101818141 Ga0068859_1018181411 87
29 3300006931 Ga0097620_101817791 Ga0097620_1018177911 87
30 3300009094 Ga0111539_12215481 Ga0111539_122154812 87
31 3300009176 Ga0105242_10016207 Ga0105242_100162073 87
32 3300013297 Ga0157378_11824437 Ga0157378_118244371 87
33 3300014325 Ga0163163_10219887 Ga0163163_102198872 87
34 3300049571 Ga0501034_0062130 Ga0501034_0062130_500_766 87
35 3300049572 Ga0501036_0348707 Ga0501036_0348707_643_909 87
36 3300049579 Ga0501043_0603592 Ga0501043_0603592_104_370 87
37 3300049581 Ga0501047_0071675 Ga0501047_0071675_2011_2277 87
38 3300049582 Ga0501048_1323328 Ga0501048_1323328_169_435 87
39 3300049742 Ga0501080_1363460 Ga0501080_1363460_216_482 87
40 3300049822 Ga0501035_0498580 Ga0501035_0498580_690_956 87
41 3300049823 Ga0501044_0387496 Ga0501044_0387496_772_1038 87
42 3300005330 Ga0070690_101493155 Ga0070690_1014931551 88
43 3300005340 Ga0070689_100007587 Ga0070689_1000075876 88
44 3300005340 Ga0070689_100603647 Ga0070689_1006036472 88
45 3300005340 Ga0070689_101691059 Ga0070689_1016910592 88
46 3300005365 Ga0070688_100111349 Ga0070688_1001113492 88
47 3300005365 Ga0070688_101216887 Ga0070688_1012168871 88
48 3300005439 Ga0070711_100277363 Ga0070711_1002773632 88
49 3300005440 Ga0070705_100104101 Ga0070705_1001041012 88
50 3300005445 Ga0070708_101366349 Ga0070708_1013663492 88
51 3300005445 Ga0070708_102125386 Ga0070708_1021253862 88
52 3300005466 Ga0070685_10420019 Ga0070685_104200192 88
53 3300005549 Ga0070704_101560519 Ga0070704_1015605191 88
54 3300005549 Ga0070704_102061422 Ga0070704_1020614221 88
55 3300005614 Ga0068856_101639160 Ga0068856_1016391601 88
56 3300005617 Ga0068859_101362520 Ga0068859_1013625202 88
57 3300005841 Ga0068863_100112561 Ga0068863_1001125612 88
58 3300005842 Ga0068858_100885558 Ga0068858_1008855581 88
59 3300006852 Ga0075433_11182481 Ga0075433_111824812 88
60 3300006914 Ga0075436_101253985 Ga0075436_1012539852 88
61 3300006931 Ga0097620_101362654 Ga0097620_1013626542 88
62 3300007076 Ga0075435_100879410 Ga0075435_1008794102 88
63 3300009176 Ga0105242_10317104 Ga0105242_103171043 88
64 3300009177 Ga0105248_12180846 Ga0105248_121808462 88
65 3300009553 Ga0105249_10233139 Ga0105249_102331392 88
66 3300009553 Ga0105249_10966627 Ga0105249_109666272 88
67 3300011119 Ga0105246_12499338 Ga0105246_124993381 88
68 3300013102 Ga0157371_10591849 Ga0157371_105918492 88
69 3300013297 Ga0157378_10918028 Ga0157378_109180281 88
70 3300013306 Ga0163162_10744450 Ga0163162_107444501 88
71 3300013308 Ga0157375_10954962 Ga0157375_109549622 88
72 3300014969 Ga0157376_10967442 Ga0157376_109674422 88
73 3300014969 Ga0157376_12344364 Ga0157376_123443641 88
74 3300017792 Ga0163161_10976671 Ga0163161_109766712 88
75 3300025899 Ga0207642_11059812 Ga0207642_110598122 88
76 3300025905 Ga0207685_10828292 Ga0207685_108282922 88
77 3300025934 Ga0207686_10382524 Ga0207686_103825242 88
78 3300025936 Ga0207670_10277377 Ga0207670_102773772 88
79 3300025938 Ga0207704_11799912 Ga0207704_117999122 88
80 3300025961 Ga0207712_10777734 Ga0207712_107777342 88
81 3300026088 Ga0207641_10188060 Ga0207641_101880602 88
82 3300026088 Ga0207641_10550024 Ga0207641_105500241 88
83 3300028556 Ga0265337_1000208 Ga0265337_100020818 88
84 3300028563 Ga0265319_1081246 Ga0265319_10812461 88
85 3300028666 Ga0265336_10000716 Ga0265336_1000071612 88
86 3300028800 Ga0265338_10005878 Ga0265338_100058785 88
87 3300028800 Ga0265338_10086269 Ga0265338_100862692 88
88 3300031238 Ga0265332_10348612 Ga0265332_103486122 88
89 3300031240 Ga0265320_10012154 Ga0265320_100121544 88
90 3300031240 Ga0265320_10093997 Ga0265320_100939971 88
91 3300031240 Ga0265320_10098439 Ga0265320_100984392 88
92 3300031247 Ga0265340_10016712 Ga0265340_100167122 88
93 3300031712 Ga0265342_10263524 Ga0265342_102635242 88
94 3300031730 Ga0307516_10876472 Ga0307516_108764721 88
95 3300035111 Ga0373923_0626497 Ga0373923_0626497_214_483 88
96 3300035117 Ga0373953_0135711 Ga0373953_0135711_357_626 88
97 3300035118 Ga0373954_0065523 Ga0373954_0065523_981_1250 88
98 3300035172 Ga0373955_0556922 Ga0373955_0556922_331_600 88
99 3300035695 Ga0373927_0821157 Ga0373927_0821157_337_603 88
100 3300035724 Ga0373933_0050004 Ga0373933_0050004_782_1051 88
101 3300035724 Ga0373933_0263195 Ga0373933_0263195_231_497 88
102 3300035725 Ga0373947_0714690 Ga0373947_0714690_363_629 88
103 3300036401 Ga0373937_0159538 Ga0373937_0159538_1504_1773 88
104 3300036401 Ga0373937_0425628 Ga0373937_0425628_546_812 88
105 3300037068 Ga0373925_0473800 Ga0373925_0473800_297_563 88
106 3300041458 Ga0451798_0605957 Ga0451798_0605957_750_1019 88
107 3300041458 Ga0451798_1018077 Ga0451798_1018077_211_477 88
108 3300041486 Ga0451807_0199737 Ga0451807_0199737_137_409 88
109 3300041486 Ga0451807_0201106 Ga0451807_0201106_617_886 88
110 3300042876 Ga0451577_0322992 Ga0451577_0322992_341_607 88
111 3300044712 Ga0453684_0727914 Ga0453684_0727914_700_966 88
112 3300044712 Ga0453684_1416576 Ga0453684_1416576_313_579 88
113 3300045051 Ga0451576_0668713 Ga0451576_0668713_103_369 88
114 3300046514 Ga0495618_0009679 Ga0495618_0009679_3948_4217 88
115 3300046526 Ga0495666_0178436 Ga0495666_0178436_54_323 88
116 3300046535 Ga0495586_0000398 Ga0495586_0000398_15845_16114 88
117 3300046535 Ga0495586_0624606 Ga0495586_0624606_311_580 88
118 3300046642 Ga0495634_0000500 Ga0495634_0000500_12045_12314 88
119 3300046663 Ga0495635_0580163 Ga0495635_0580163_238_507 88
120 3300046675 Ga0495657_0161072 Ga0495657_0161072_684_953 88
121 3300046683 Ga0495658_0905359 Ga0495658_0905359_14_280 88
122 3300046689 Ga0495613_0003628 Ga0495613_0003628_9279_9548 88
123 3300047321 Ga0495676_0449105 Ga0495676_0449105_332_598 88
124 3300047322 Ga0495680_0006416 Ga0495680_0006416_10210_10479 88
125 3300050515 nmdc:mga0a205_1308851_c1 nmdc:mga0a205_1308851_c1_131_397 88
126 3300005289 Ga0065704_10845778 Ga0065704_108457781 89
127 3300005333 Ga0070677_10330704 Ga0070677_103307042 89
128 3300005354 Ga0070675_101933595 Ga0070675_1019335952 89
129 3300005356 Ga0070674_101727602 Ga0070674_1017276021 89
130 3300005438 Ga0070701_10564135 Ga0070701_105641352 89
131 3300005544 Ga0070686_100084890 Ga0070686_1000848903 89
132 3300005544 Ga0070686_100902738 Ga0070686_1009027382 89
133 3300005577 Ga0068857_100542823 Ga0068857_1005428231 89
134 3300005841 Ga0068863_100224416 Ga0068863_1002244162 89
135 3300006237 Ga0097621_102397805 Ga0097621_1023978052 89
136 3300006847 Ga0075431_100277073 Ga0075431_1002770733 89
137 3300007788 Ga0099795_10519664 Ga0099795_105196642 89
138 3300009093 Ga0105240_10005016 Ga0105240_1000501610 89
139 3300009094 Ga0111539_10560207 Ga0111539_105602072 89
140 3300009094 Ga0111539_11565389 Ga0111539_115653891 89
141 3300009147 Ga0114129_11311891 Ga0114129_113118912 89
142 3300009551 Ga0105238_11562123 Ga0105238_115621232 89
143 3300013297 Ga0157378_11862326 Ga0157378_118623261 89
144 3300025913 Ga0207695_10036195 Ga0207695_100361956 89
145 3300025918 Ga0207662_10363377 Ga0207662_103633772 89
146 3300026088 Ga0207641_10120680 Ga0207641_101206802 89
147 3300028556 Ga0265337_1047612 Ga0265337_10476124 89
148 3300028558 Ga0265326_10129589 Ga0265326_101295892 89
149 3300028573 Ga0265334_10016532 Ga0265334_100165322 89
150 3300028666 Ga0265336_10018658 Ga0265336_100186583 89
151 3300028800 Ga0265338_10356767 Ga0265338_103567672 89
152 3300028800 Ga0265338_10374563 Ga0265338_103745632 89
153 3300028800 Ga0265338_10763012 Ga0265338_107630122 89
154 3300028800 Ga0265338_10789232 Ga0265338_107892322 89
155 3300029957 Ga0265324_10000729 Ga0265324_1000072911 89
156 3300029957 Ga0265324_10045205 Ga0265324_100452052 89
157 3300029957 Ga0265324_10205575 Ga0265324_102055752 89
158 3300029957 Ga0265324_10320966 Ga0265324_103209661 89
159 3300031241 Ga0265325_10098393 Ga0265325_100983933 89
160 3300031247 Ga0265340_10214709 Ga0265340_102147092 89
161 3300031251 Ga0265327_10043472 Ga0265327_100434723 89
162 3300031344 Ga0265316_10748619 Ga0265316_107486192 89
163 3300031344 Ga0265316_10817836 Ga0265316_108178362 89
164 3300035691 Ga0373931_1043081 Ga0373931_1043081_244_519 89
165 3300035695 Ga0373927_0043998 Ga0373927_0043998_2149_2424 89
166 3300037068 Ga0373925_0506853 Ga0373925_0506853_205_474 89
167 3300037068 Ga0373925_0588539 Ga0373925_0588539_466_741 89
168 3300041512 Ga0451853_1091639 Ga0451853_1091639_65_334 89
169 3300042876 Ga0451577_0969631 Ga0451577_0969631_457_735 89
170 3300044673 Ga0453683_0194325 Ga0453683_0194325_33_344 89
171 3300044712 Ga0453684_1518394 Ga0453684_1518394_292_561 89
172 3300045051 Ga0451576_0107276 Ga0451576_0107276_1194_1466 89
173 3300045051 Ga0451576_0388432 Ga0451576_0388432_254_565 89
174 3300046463 Ga0495653_0831961 Ga0495653_0831961_30_302 89
175 3300046473 Ga0495582_0929443 Ga0495582_0929443_20_292 89
176 3300046516 Ga0495628_1060833 Ga0495628_1060833_149_421 89
177 3300046517 Ga0495630_0841198 Ga0495630_0841198_354_629 89
178 3300046536 Ga0495587_0650433 Ga0495587_0650433_19_294 89
179 3300046543 Ga0495645_0032603 Ga0495645_0032603_1037_1309 89
180 3300046543 Ga0495645_0618327 Ga0495645_0618327_120_392 89
181 3300046678 Ga0495599_0532922 Ga0495599_0532922_220_492 89
182 3300047317 Ga0495604_0225535 Ga0495604_0225535_868_1140 89
183 3300050508 nmdc:mga09592_350120_c1 nmdc:mga09592_350120_c1_985_1254 89
184 3300050509 nmdc:mga0qj67_1201174_c1 nmdc:mga0qj67_1201174_c1_98_373 89
185 3300050509 nmdc:mga0qj67_223784_c1 nmdc:mga0qj67_223784_c1_20_289 89
186 3300050510 nmdc:mga06r32_24479_c1 nmdc:mga06r32_24479_c1_4581_4856 89
187 3300050510 nmdc:mga06r32_414535_c1 nmdc:mga06r32_414535_c1_20_289 89
188 3300050511 nmdc:mga08y16_1527905_c1 nmdc:mga08y16_1527905_c1_310_582 89
189 3300050514 nmdc:mga08x19_854274_c1 nmdc:mga08x19_854274_c1_330_602 89
190 3300050515 nmdc:mga0a205_1021301_c1 nmdc:mga0a205_1021301_c1_17_286 89

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00830

Ribosomal_L28

Ribosomal L28 family

22

90

0.87

Feature Viewer

pLDDT pTM Quality
68.65 0.41 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map