F292432

General Info

Members Datasets Scaffolds Average Seq Length
190 153 188 390

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10133084|Ga0114129_101330842
Length 430
Sequence LNGSYSFFFLCQELITLSVLSRTFQTVFSQLYLSLFNHFFMSSNHGVAYIKPGEVEVQEIDYPKLALGNRKCEHGVILKIVSTNICGSDQHMVRGRTTAPSGLILGHEITGIVIEAGRDVEFIKVGDLVSVPFNIACGRCRNCKAGQTGICLNVNPSRPGAAYGYVDMGGWVGGQAEYVLVPYADFNLLKFPDKDQAMSKIKDLTLLSDIFPTGYHGAVTAGVGPGSIVYVALACAASCHLLGAAVVIVGDMIPERLQQAKSFGCEIIDLRQKTPIEEAIAAIIGVPEVDCVVDCVGFEAHGHGAHAGEELPATVLNTAMAITRAGGAIGIPGLYVTGDPGAKDESAKVGSLSIRIGLGWAKSHSFFTGQCPVMKYHRQLMNAILYDKIQIAKAVNVEVIRLNDAPGGYKDFDKGAAKKFVIDPHGMIAN

Samples

Sample ID Description Type Environment
1 2622736605 Geodermatophilus ruber DSM 45317 Isolate Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
67 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
68 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
72 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
81 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
113 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
114 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
115 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
122 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
129 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
132 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
139 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
140 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
143 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
144 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
145 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
146 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
152 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.11
Metatranscriptomes 6.84
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.26
Nodule 0
Rhizoplane 0
Rhizosphere 91.05
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1001408 3300000549 Bacteria 3598
2 JGI24740J21852_10022724 3300001979 Bacteria 2154
3 JGI25154J39366_1000094 3300002738 Bacteria 79323
4 JGI25157J39369_1005216 3300002741 Bacteria 2160
5 JGI25160J50197_1001971 3300003354 Bacteria 9787
6 JGI25160J50197_1011199 3300003354 Bacteria 3194
7 Ga0058863_11895196 3300004799 Bacteria 1737
8 Ga0058862_12764455 3300004803 Bacteria 1712
9 Ga0065165_1000130 3300005262 Bacteria 128998
10 Ga0065165_1014785 3300005262 Bacteria 3013
11 Ga0065712_10071913 3300005290 Bacteria 4996
12 Ga0070658_10112479 3300005327 Bacteria 2257
13 Ga0070676_10008220 3300005328 Bacteria 5617
14 Ga0070683_100000003 3300005329 Bacteria 375084
15 Ga0070670_100073438 3300005331 Bacteria 2938
16 Ga0070677_10013671 3300005333 Bacteria 2843
17 Ga0068869_100033803 3300005334 Bacteria 3612
18 Ga0070682_100076549 3300005337 Bacteria 2154
19 Ga0070668_100103225 3300005347 Bacteria 2261
20 Ga0070669_100020948 3300005353 Bacteria 4671
21 Ga0070675_100011051 3300005354 Bacteria 7065
22 Ga0070674_100023486 3300005356 Bacteria 3992
23 Ga0070673_100026557 3300005364 Bacteria 4278
24 Ga0070667_100050096 3300005367 Unclassified 3519
25 Ga0070713_100265509 3300005436 Bacteria 1570
26 Ga0070694_100011819 3300005444 Bacteria 5414
27 Ga0070678_100026557 3300005456 Bacteria 3917
28 Ga0070678_100238200 3300005456 Bacteria 1520
29 Ga0070706_100001668 3300005467 Bacteria 23092
30 Ga0070707_100001295 3300005468 Bacteria 24606
31 Ga0070698_100068479 3300005471 Bacteria 3566
32 Ga0070699_100060073 3300005518 Bacteria 3293
33 Ga0070684_100000111 3300005535 Bacteria 52800
34 Ga0070672_100072927 3300005543 Bacteria 2735
35 Ga0070665_100207970 3300005548 Bacteria 1957
36 Ga0070704_100063445 3300005549 Bacteria 2652
37 Ga0068855_100107514 3300005563 Bacteria 3205
38 Ga0068857_100047845 3300005577 Bacteria 3798
39 Ga0068857_100125415 3300005577 Bacteria 2314
40 Ga0068854_100043683 3300005578 Bacteria 3178
41 Ga0068856_100322917 3300005614 Bacteria 1561
42 Ga0068852_100087787 3300005616 Bacteria 2776
43 Ga0068859_100050703 3300005617 Bacteria 4169
44 Ga0068859_100140519 3300005617 Bacteria 2488
45 Ga0068864_100137202 3300005618 Bacteria 2204
46 Ga0068866_10054518 3300005718 Bacteria 2049
47 Ga0068861_100167107 3300005719 Bacteria 1820
48 Ga0068870_10066608 3300005840 Bacteria 1951
49 Ga0068862_100076496 3300005844 Bacteria 2896
50 Ga0068862_100137594 3300005844 Bacteria 2166
51 Ga0081455_10040563 3300005937 Bacteria 4103
52 Ga0070717_10038946 3300006028 Bacteria 3865
53 Ga0075428_100009284 3300006844 Bacteria 10905
54 Ga0075428_100101873 3300006844 Bacteria 3130
55 Ga0075431_100009055 3300006847 Bacteria 9983
56 Ga0075433_10073168 3300006852 Bacteria 3014
57 Ga0075429_100068716 3300006880 Bacteria 3084
58 Ga0075429_100121927 3300006880 Bacteria 2279
59 Ga0075429_100189912 3300006880 Bacteria 1800
60 Ga0068865_100064929 3300006881 Bacteria 2570
61 Ga0097620_100050703 3300006931 Bacteria 4169
62 Ga0097620_100140515 3300006931 Bacteria 2488
63 Ga0105240_10110240 3300009093 Bacteria 3332
64 Ga0105240_10379390 3300009093 Bacteria 1597
65 Ga0111539_10014595 3300009094 Bacteria 9806
66 Ga0111539_10037432 3300009094 Bacteria 5859
67 Ga0111539_10052639 3300009094 Bacteria 4846
68 Ga0111539_10157022 3300009094 Bacteria 2662
69 Ga0111539_10418961 3300009094 Bacteria 1560
70 Ga0105245_10299058 3300009098 Bacteria 1579
71 Ga0114129_10133084 3300009147 Bacteria 3414
72 Ga0105241_10105056 3300009174 Bacteria 2252
73 Ga0105248_10029816 3300009177 Bacteria 6088
74 Ga0105237_10001283 3300009545 Bacteria 33448
75 Ga0105238_10003078 3300009551 Bacteria 16635
76 Ga0105238_10059729 3300009551 Bacteria 3819
77 Ga0157369_10010621 3300013105 Bacteria 10481
78 Ga0157375_10220981 3300013308 Bacteria 2053
79 Ga0163163_10129899 3300014325 Bacteria 2559
80 Ga0163163_10414880 3300014325 Bacteria 1405
81 Ga0157380_10060129 3300014326 Bacteria 3035
82 Ga0157376_10157591 3300014969 Bacteria 2055
83 Ga0163161_10099647 3300017792 Bacteria 2161
84 Ga0197907_10617498 3300020069 Bacteria 1415
85 Ga0197907_10859176 3300020069 Bacteria 2248
86 Ga0206356_11912484 3300020070 Bacteria 1385
87 Ga0206349_1910686 3300020075 Bacteria 1821
88 Ga0206355_1681264 3300020076 Bacteria 1526
89 Ga0206351_10487765 3300020077 Bacteria 1343
90 Ga0206352_11277879 3300020078 Bacteria 1387
91 Ga0206354_10330968 3300020081 Bacteria 1363
92 Ga0224712_10039008 3300022467 Bacteria 1778
93 Ga0224712_10073831 3300022467 Bacteria 1392
94 Ga0224572_1005394 3300024225 Bacteria 2278
95 Ga0209646_1000091 3300025246 Bacteria 188727
96 Ga0209026_1000643 3300025250 Bacteria 21527
97 Ga0209676_1000513 3300025292 Bacteria 60961
98 Ga0209758_1007527 3300025297 Bacteria 7375
99 Ga0209050_1001686 3300025298 Bacteria 22180
100 Ga0207426_1000093 3300025302 Bacteria 277663
101 Ga0207426_1000193 3300025302 Bacteria 151669
102 Ga0207697_10031105 3300025315 Bacteria 2184
103 Ga0207682_10029897 3300025893 Bacteria 2180
104 Ga0207688_10003753 3300025901 Bacteria 8292
105 Ga0207680_10142972 3300025903 Bacteria 1588
106 Ga0207647_10081894 3300025904 Bacteria 1934
107 Ga0207645_10004698 3300025907 Bacteria 10047
108 Ga0207643_10016513 3300025908 Bacteria 4028
109 Ga0207705_10075013 3300025909 Bacteria 2456
110 Ga0207684_10001164 3300025910 Bacteria 29355
111 Ga0207684_10025989 3300025910 Bacteria 4990
112 Ga0207695_10108123 3300025913 Bacteria 2766
113 Ga0207671_10000161 3300025914 Bacteria 104179
114 Ga0207671_10071915 3300025914 Bacteria 2580
115 Ga0207646_10000894 3300025922 Bacteria 38395
116 Ga0207646_10073274 3300025922 Bacteria 3059
117 Ga0207681_10006819 3300025923 Bacteria 7003
118 Ga0207694_10017558 3300025924 Bacteria 5409
119 Ga0207694_10101020 3300025924 Bacteria 2285
120 Ga0207659_10009730 3300025926 Bacteria 6013
121 Ga0207659_10073625 3300025926 Bacteria 2501
122 Ga0207659_10148985 3300025926 Bacteria 1825
123 Ga0207700_10152137 3300025928 Bacteria 1913
124 Ga0207691_10009459 3300025940 Bacteria 9359
125 Ga0207691_10052278 3300025940 Bacteria 3732
126 Ga0207711_10061177 3300025941 Bacteria 3247
127 Ga0207689_10005070 3300025942 Bacteria 11867
128 Ga0207689_10005558 3300025942 Bacteria 11256
129 Ga0207640_10282218 3300025981 Bacteria 1305
130 Ga0207658_10207504 3300025986 Bacteria 1640
131 Ga0207677_10032347 3300026023 Bacteria 3362
132 Ga0207677_10179528 3300026023 Bacteria 1664
133 Ga0207702_10188979 3300026078 Bacteria 1902
134 Ga0207648_10012456 3300026089 Bacteria 7962
135 Ga0207675_100039638 3300026118 Bacteria 4397
136 Ga0207683_10002445 3300026121 Bacteria 16201
137 Ga0207428_10051960 3300027907 Bacteria 3275
138 Ga0268265_10032135 3300028380 Bacteria 3799
139 Ga0268264_10099431 3300028381 Bacteria 2524
140 Ga0265318_10015769 3300028577 Bacteria 3135
141 Ga0316177_1193169 3300030731 Bacteria 7369
142 Ga0316176_1039384 3300030732 Bacteria 20936
143 Ga0265325_10046083 3300031241 Bacteria 2263
144 Ga0307513_10000513 3300031456 Bacteria 55719
145 Ga0265314_10000307 3300031711 Bacteria 70029
146 Ga0265314_10003862 3300031711 Bacteria 14284
147 Ga0307405_10010895 3300031731 Bacteria 4738
148 Ga0307412_10023172 3300031911 Bacteria 3817
149 Ga0307414_10043605 3300032004 Bacteria 3057
150 Ga0373927_0000896 3300035695 Bacteria 22637
151 Ga0373933_0012211 3300035724 Bacteria 4745
152 Ga0373937_0129615 3300036401 Bacteria 2355
153 Ga0373925_0001161 3300037068 Bacteria 23340
154 Ga0395900_0044577 3300037418 Bacteria 4569
155 Ga0436365_0739766 3300039437 Bacteria 6525
156 Ga0436362_0450432 3300039453 Bacteria 1433
157 Ga0451853_0953818 3300041512 Bacteria 2170
158 Ga0453683_0099508 3300044673 Bacteria 1826
159 Ga0466960_0086111 3300044901 Bacteria 1592
160 Ga0451576_0168582 3300045051 Bacteria 2285
161 Ga0495627_005261 3300046453 Bacteria 5244
162 Ga0495650_0008453 3300046471 Bacteria 6008
163 Ga0495580_0024067 3300046472 Bacteria 4463
164 Ga0495618_0049453 3300046514 Bacteria 2655
165 Ga0495618_0189372 3300046514 Bacteria 1305
166 Ga0495633_0000576 3300046558 Bacteria 35568
167 Ga0495635_0058039 3300046663 Bacteria 2663
168 Ga0495646_0126232 3300046680 Bacteria 1444
169 Ga0495647_0063923 3300046681 Bacteria 1458
170 Ga0495686_0000111 3300047472 Bacteria 168708
171 Ga0495686_0033369 3300047472 Bacteria 3324
172 Ga0501043_0229058 3300049579 Bacteria 1436
173 Ga0501047_0012211 3300049581 Bacteria 8132
174 Ga0501047_0044884 3300049581 Bacteria 4272
175 Ga0501047_0086046 3300049581 Bacteria 3020
176 Ga0501069_0162060 3300049585 Bacteria 1288
177 Ga0501070_0000140 3300049586 Bacteria 65899
178 Ga0501225_0015310 3300049705 Bacteria 2137
179 Ga0501035_0114800 3300049822 Bacteria 2358
180 Ga0501044_0033911 3300049823 Bacteria 5359
181 nmdc:mga09592_54325_c1 3300050508 Bacteria 3384
182 nmdc:mga08y16_144190_c1 3300050511 Bacteria 2476
183 nmdc:mga08y16_14996_c1 3300050511 Bacteria 8151
184 nmdc:mga08y16_42844_c1 3300050511 Bacteria 4741
185 nmdc:mga0a205_22608_c1 3300050515 Bacteria 5959
186 nmdc:mga0a205_372241_c1 3300050515 Bacteria 1294
187 Ga0500557_001490 3300053105 Bacteria 3848
188 Ga0587078_004798 3300059646 Bacteria 1423

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005563 Ga0068855_100107514 Ga0068855_1001075142 336
2 3300005436 Ga0070713_100265509 Ga0070713_1002655092 344
3 3300009098 Ga0105245_10299058 Ga0105245_102990581 354
4 3300046680 Ga0495646_0126232 Ga0495646_0126232_281_1417 356
5 3300005616 Ga0068852_100087787 Ga0068852_1000877872 358
6 3300044673 Ga0453683_0099508 Ga0453683_0099508_248_1405 360
7 3300050515 nmdc:mga0a205_372241_c1 nmdc:mga0a205_372241_c1_70_1233 364
8 3300031456 Ga0307513_10000513 Ga0307513_1000051330 370
9 3300005444 Ga0070694_100011819 Ga0070694_1000118192 371
10 3300005549 Ga0070704_100063445 Ga0070704_1000634451 371
11 3300005617 Ga0068859_100140519 Ga0068859_1001405192 371
12 3300005844 Ga0068862_100076496 Ga0068862_1000764962 371
13 3300006931 Ga0097620_100140515 Ga0097620_1001405152 371
14 3300009093 Ga0105240_10110240 Ga0105240_101102403 372
15 3300009545 Ga0105237_10001283 Ga0105237_1000128318 372
16 3300009551 Ga0105238_10003078 Ga0105238_100030786 372
17 3300009551 Ga0105238_10059729 Ga0105238_100597294 372
18 3300020075 Ga0206349_1910686 Ga0206349_19106861 372
19 3300020081 Ga0206354_10330968 Ga0206354_103309681 372
20 3300025913 Ga0207695_10108123 Ga0207695_101081233 372
21 3300025914 Ga0207671_10000161 Ga0207671_1000016169 372
22 3300025914 Ga0207671_10071915 Ga0207671_100719153 372
23 3300025924 Ga0207694_10017558 Ga0207694_100175581 372
24 3300025924 Ga0207694_10101020 Ga0207694_101010202 372
25 3300039437 Ga0436365_0739766 Ga0436365_0739766_2185_3372 372
26 3300005329 Ga0070683_100000003 Ga0070683_10000000330 373
27 3300005535 Ga0070684_100000111 Ga0070684_10000011122 373
28 3300005617 Ga0068859_100050703 Ga0068859_1000507033 373
29 3300006931 Ga0097620_100050703 Ga0097620_1000507032 373
30 3300041512 Ga0451853_0953818 Ga0451853_0953818_98_1303 373
31 3300005327 Ga0070658_10112479 Ga0070658_101124791 374
32 3300005543 Ga0070672_100072927 Ga0070672_1000729273 374
33 3300005618 Ga0068864_100137202 Ga0068864_1001372023 374
34 3300017792 Ga0163161_10099647 Ga0163161_100996472 374
35 3300020069 Ga0197907_10617498 Ga0197907_106174981 374
36 3300020070 Ga0206356_11912484 Ga0206356_119124841 374
37 3300020076 Ga0206355_1681264 Ga0206355_16812641 374
38 3300020078 Ga0206352_11277879 Ga0206352_112778791 374
39 3300022467 Ga0224712_10073831 Ga0224712_100738311 374
40 3300025909 Ga0207705_10075013 Ga0207705_100750132 374
41 3300025940 Ga0207691_10052278 Ga0207691_100522783 374
42 3300026023 Ga0207677_10179528 Ga0207677_101795281 374
43 3300026078 Ga0207702_10188979 Ga0207702_101889792 374
44 3300031711 Ga0265314_10000307 Ga0265314_1000030721 374
45 3300005468 Ga0070707_100001295 Ga0070707_1000012956 376
46 3300025922 Ga0207646_10000894 Ga0207646_1000089428 376
47 3300046514 Ga0495618_0049453 Ga0495618_0049453_294_1484 377
48 3300013308 Ga0157375_10220981 Ga0157375_102209812 379
49 3300005456 Ga0070678_100238200 Ga0070678_1002382002 380
50 3300024225 Ga0224572_1005394 Ga0224572_10053942 381
51 3300046514 Ga0495618_0189372 Ga0495618_0189372_78_1268 381
52 3300005518 Ga0070699_100060073 Ga0070699_1000600732 384
53 3300025910 Ga0207684_10025989 Ga0207684_100259896 384
54 3300030731 Ga0316177_1193169 Ga0316177_11931695 385
55 3300030732 Ga0316176_1039384 Ga0316176_103938417 385
56 3300004799 Ga0058863_11895196 Ga0058863_118951961 386
57 3300004803 Ga0058862_12764455 Ga0058862_127644552 386
58 3300005467 Ga0070706_100001668 Ga0070706_1000016687 386
59 3300009094 Ga0111539_10418961 Ga0111539_104189611 386
60 3300025910 Ga0207684_10001164 Ga0207684_1000116434 386
61 3300005262 Ga0065165_1000130 Ga0065165_100013036 387
62 3300009177 Ga0105248_10029816 Ga0105248_100298164 387
63 3300025292 Ga0209676_1000513 Ga0209676_10005139 387
64 3300025941 Ga0207711_10061177 Ga0207711_100611772 387
65 3300031241 Ga0265325_10046083 Ga0265325_100460832 387
66 3300031731 Ga0307405_10010895 Ga0307405_100108953 387
67 3300031911 Ga0307412_10023172 Ga0307412_100231723 387
68 3300032004 Ga0307414_10043605 Ga0307414_100436052 387
69 3300039453 Ga0436362_0450432 Ga0436362_0450432_171_1370 387
70 3300049705 Ga0501225_0015310 Ga0501225_0015310_513_1700 387
71 3300003354 JGI25160J50197_1001971 JGI25160J50197_10019718 388
72 3300025298 Ga0209050_1001686 Ga0209050_10016861 388
73 3300025302 Ga0207426_1000093 Ga0207426_1000093213 388
74 3300053105 Ga0500557_001490 Ga0500557_001490_2597_3787 388
75 3300001979 JGI24740J21852_10022724 JGI24740J21852_100227242 389
76 3300002738 JGI25154J39366_1000094 JGI25154J39366_100009455 389
77 3300002741 JGI25157J39369_1005216 JGI25157J39369_10052161 389
78 3300003354 JGI25160J50197_1011199 JGI25160J50197_10111993 389
79 3300005262 Ga0065165_1014785 Ga0065165_10147852 389
80 3300009094 Ga0111539_10037432 Ga0111539_100374325 389
81 3300009147 Ga0114129_10133084 Ga0114129_101330842 389
82 3300025246 Ga0209646_1000091 Ga0209646_100009172 389
83 3300025250 Ga0209026_1000643 Ga0209026_10006436 389
84 3300025297 Ga0209758_1007527 Ga0209758_10075274 389
85 3300025302 Ga0207426_1000193 Ga0207426_10001936 389
86 3300025926 Ga0207659_10148985 Ga0207659_101489852 389
87 3300046453 Ga0495627_005261 Ga0495627_005261_941_2131 389
88 3300046558 Ga0495633_0000576 Ga0495633_0000576_29450_30640 389
89 iso_pu_bacteria 8002745576 8002748229 392
90 3300005337 Ga0070682_100076549 Ga0070682_1000765493 393
91 3300005614 Ga0068856_100322917 Ga0068856_1003229172 393
92 3300020077 Ga0206351_10487765 Ga0206351_104877651 393
93 3300022467 Ga0224712_10039008 Ga0224712_100390081 393
94 3300025904 Ga0207647_10081894 Ga0207647_100818942 393
95 3300005290 Ga0065712_10071913 Ga0065712_100719132 395
96 3300005328 Ga0070676_10008220 Ga0070676_100082204 395
97 3300005331 Ga0070670_100073438 Ga0070670_1000734383 395
98 3300005333 Ga0070677_10013671 Ga0070677_100136712 395
99 3300005334 Ga0068869_100033803 Ga0068869_1000338033 395
100 3300005347 Ga0070668_100103225 Ga0070668_1001032252 395
101 3300005353 Ga0070669_100020948 Ga0070669_1000209483 395
102 3300005354 Ga0070675_100011051 Ga0070675_1000110513 395
103 3300005356 Ga0070674_100023486 Ga0070674_1000234863 395
104 3300005364 Ga0070673_100026557 Ga0070673_1000265572 395
105 3300005367 Ga0070667_100050096 Ga0070667_1000500961 395
106 3300005456 Ga0070678_100026557 Ga0070678_1000265572 395
107 3300005548 Ga0070665_100207970 Ga0070665_1002079702 395
108 3300005577 Ga0068857_100047845 Ga0068857_1000478452 395
109 3300005578 Ga0068854_100043683 Ga0068854_1000436832 395
110 3300005718 Ga0068866_10054518 Ga0068866_100545181 395
111 3300005840 Ga0068870_10066608 Ga0068870_100666082 395
112 3300006880 Ga0075429_100121927 Ga0075429_1001219271 395
113 3300006881 Ga0068865_100064929 Ga0068865_1000649292 395
114 3300009093 Ga0105240_10379390 Ga0105240_103793901 395
115 3300009094 Ga0111539_10014595 Ga0111539_100145953 395
116 3300009174 Ga0105241_10105056 Ga0105241_101050562 395
117 3300014325 Ga0163163_10414880 Ga0163163_104148802 395
118 3300014969 Ga0157376_10157591 Ga0157376_101575912 395
119 3300025315 Ga0207697_10031105 Ga0207697_100311053 395
120 3300025893 Ga0207682_10029897 Ga0207682_100298972 395
121 3300025901 Ga0207688_10003753 Ga0207688_100037535 395
122 3300025903 Ga0207680_10142972 Ga0207680_101429722 395
123 3300025907 Ga0207645_10004698 Ga0207645_100046988 395
124 3300025908 Ga0207643_10016513 Ga0207643_100165133 395
125 3300025923 Ga0207681_10006819 Ga0207681_100068193 395
126 3300025926 Ga0207659_10009730 Ga0207659_100097302 395
127 3300025926 Ga0207659_10073625 Ga0207659_100736252 395
128 3300025940 Ga0207691_10009459 Ga0207691_100094592 395
129 3300025942 Ga0207689_10005070 Ga0207689_100050707 395
130 3300025942 Ga0207689_10005558 Ga0207689_100055583 395
131 3300025981 Ga0207640_10282218 Ga0207640_102822181 395
132 3300025986 Ga0207658_10207504 Ga0207658_102075042 395
133 3300026023 Ga0207677_10032347 Ga0207677_100323471 395
134 3300026089 Ga0207648_10012456 Ga0207648_100124568 395
135 3300026118 Ga0207675_100039638 Ga0207675_1000396382 395
136 3300026121 Ga0207683_10002445 Ga0207683_100024457 395
137 3300028381 Ga0268264_10099431 Ga0268264_100994311 395
138 3300035724 Ga0373933_0012211 Ga0373933_0012211_3407_4615 395
139 3300046471 Ga0495650_0008453 Ga0495650_0008453_3822_5012 395
140 3300047472 Ga0495686_0000111 Ga0495686_0000111_136897_138087 395
141 3300047472 Ga0495686_0033369 Ga0495686_0033369_587_1777 395
142 3300049579 Ga0501043_0229058 Ga0501043_0229058_34_1224 395
143 3300049581 Ga0501047_0044884 Ga0501047_0044884_2755_3945 395
144 3300049822 Ga0501035_0114800 Ga0501035_0114800_592_1782 395
145 3300049823 Ga0501044_0033911 Ga0501044_0033911_609_1799 395
146 3300050511 nmdc:mga08y16_42844_c1 nmdc:mga08y16_42844_c1_2936_4126 395
147 3300059646 Ga0587078_004798 Ga0587078_004798_14_1204 395
148 3300005471 Ga0070698_100068479 Ga0070698_1000684791 396
149 3300005844 Ga0068862_100137594 Ga0068862_1001375942 396
150 3300006028 Ga0070717_10038946 Ga0070717_100389463 396
151 3300006844 Ga0075428_100009284 Ga0075428_1000092847 396
152 3300006847 Ga0075431_100009055 Ga0075431_1000090555 396
153 3300006852 Ga0075433_10073168 Ga0075433_100731682 396
154 3300006880 Ga0075429_100068716 Ga0075429_1000687161 396
155 3300009094 Ga0111539_10052639 Ga0111539_100526392 396
156 3300009094 Ga0111539_10157022 Ga0111539_101570222 396
157 3300013105 Ga0157369_10010621 Ga0157369_100106214 396
158 3300014326 Ga0157380_10060129 Ga0157380_100601292 396
159 3300025922 Ga0207646_10073274 Ga0207646_100732743 396
160 3300025928 Ga0207700_10152137 Ga0207700_101521371 396
161 3300027907 Ga0207428_10051960 Ga0207428_100519602 396
162 3300028380 Ga0268265_10032135 Ga0268265_100321351 396
163 3300031711 Ga0265314_10003862 Ga0265314_100038626 396
164 3300035695 Ga0373927_0000896 Ga0373927_0000896_4828_6060 396
165 3300036401 Ga0373937_0129615 Ga0373937_0129615_757_1950 396
166 3300037068 Ga0373925_0001161 Ga0373925_0001161_13900_15132 396
167 3300045051 Ga0451576_0168582 Ga0451576_0168582_1021_2214 396
168 3300046472 Ga0495580_0024067 Ga0495580_0024067_236_1429 396
169 3300049581 Ga0501047_0012211 Ga0501047_0012211_731_2005 396
170 3300049585 Ga0501069_0162060 Ga0501069_0162060_38_1228 396
171 3300050508 nmdc:mga09592_54325_c1 nmdc:mga09592_54325_c1_532_1725 396
172 3300050511 nmdc:mga08y16_144190_c1 nmdc:mga08y16_144190_c1_912_2105 396
173 3300050511 nmdc:mga08y16_14996_c1 nmdc:mga08y16_14996_c1_4534_5727 396
174 3300050515 nmdc:mga0a205_22608_c1 nmdc:mga0a205_22608_c1_2156_3349 396
175 3300005577 Ga0068857_100125415 Ga0068857_1001254152 397
176 3300005719 Ga0068861_100167107 Ga0068861_1001671072 397
177 3300046681 Ga0495647_0063923 Ga0495647_0063923_36_1238 398
178 iso_pu_bacteria 2622736605 2623501047 402
179 3300020069 Ga0197907_10859176 Ga0197907_108591762 403
180 3300028577 Ga0265318_10015769 Ga0265318_100157693 403
181 3300046663 Ga0495635_0058039 Ga0495635_0058039_826_2040 403
182 3300005937 Ga0081455_10040563 Ga0081455_100405631 404
183 3300006844 Ga0075428_100101873 Ga0075428_1001018732 404
184 3300006880 Ga0075429_100189912 Ga0075429_1001899122 404
185 3300014325 Ga0163163_10129899 Ga0163163_101298992 404
186 3300037418 Ga0395900_0044577 Ga0395900_0044577_215_1429 404
187 3300044901 Ga0466960_0086111 Ga0466960_0086111_14_1228 404
188 3300049581 Ga0501047_0086046 Ga0501047_0086046_406_1623 405
189 3300049586 Ga0501070_0000140 Ga0501070_0000140_558_1775 405
190 3300000549 LJQas_1001408 LJQas_10014082 406

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

73

193

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5iq4-assembly1.cif.gz_B crystal structure of rntmm mutant y207s soaking 0.9368 195 227
5iq1-assembly1.cif.gz_B crystal structure of rntmm mutant y207s 0.9364 195 227
4jlw-assembly1.cif.gz_D crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa 0.935 4 404
1kol-assembly1.cif.gz_A crystal structure of formaldehyde dehydrogenase 0.9335 4 405
4jlw-assembly1.cif.gz_D crystal structure of formaldehyde dehydrogenase from pseudomonas aeruginosa 0.9305 4 404
ID Description Score Start End Superfamily
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9668 194 226 3.50.50.60
2dphB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9254 182 345 3.40.50.720
af_Q2G0U1_287_486_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9106 195 227 3.50.50.60
2dphB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9095 182 345 3.40.50.720
4jlwB01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9078 4 404 3.90.180.10
ID Description Score Start End GO Terms
AF-A0A061NPQ5-F1-model_v4 Threonine dehydrogenase 0.98 151 275
AF-T1BI29-F1-model_v4 Glutathione-independent formaldehyde dehydrogenase 0.9707 141 278
AF-A0A351CTX9-F1-model_v4 deleted 0.9647 167 405
AF-A0A351CTX9-F1-model_v4 deleted 0.9608 167 405
AF-A0A4R5F2F0-F1-model_v4 Glutathione-dependent formaldehyde dehydrogenase 0.9605 176 260

Feature Viewer

pLDDT pTM Quality
82.66 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map