F292303

General Info

Members Datasets Scaffolds Average Seq Length
190 137 380 225

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100457342|Ga0068871_1004573422
Length 249
Sequence VGDTGRHQESGIGSRAWAKEEAGLPETRLRWTATCRLVPSRYPSVGVLDGITSPGDLDAVMELEAWTNDRLSVELGILNTIPRDEWVVGEPMASVVMAAFCHPRPGGSRFSAPDRGAWYAGRTLDTALAESIYHRTRELEEVGHFDARVQMRLYHADFAATFHDIRGGGRRWPRLYDPDSYVDSQRAGRSLLDGGANGVVYDSVRHPGGTCLACFRPPLVRRVRVAAHYEYAWTGGRTPAIRRLAHRGR

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
41 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
50 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
51 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
52 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
69 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
82 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
83 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
84 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
85 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
86 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
87 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
90 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
91 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
92 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
93 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
94 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
95 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
96 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
97 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
98 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
99 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
103 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
111 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
112 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
113 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
114 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
115 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
116 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
117 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
118 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
119 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
120 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
121 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
122 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
124 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
125 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
126 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
127 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
131 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
132 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
133 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
136 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
137 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.16
Rhizosphere 93.68
Stem 0
Stem Tuber 0
Unclassified 21.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100457342 3300006358 Bacteria 1145
2 Ga0070683_100003308 3300005329 Bacteria 13037
3 Ga0070670_100093173 3300005331 Bacteria 2591
4 Ga0070670_100190781 3300005331 Unclassified 1780
5 Ga0068869_100250839 3300005334 Bacteria 1413
6 Ga0070680_100119199 3300005336 Bacteria 2202
7 Ga0070660_100244485 3300005339 Bacteria 1462
8 Ga0070661_100226062 3300005344 Bacteria 1437
9 Ga0070692_10119373 3300005345 Unclassified 1469
10 Ga0070668_100751127 3300005347 Bacteria 863
11 Ga0070675_100085079 3300005354 Bacteria 2642
12 Ga0070675_100330052 3300005354 Unclassified 1349
13 Ga0070674_100043963 3300005356 Bacteria 3042
14 Ga0070674_100311819 3300005356 Unclassified 1258
15 Ga0070673_100047522 3300005364 Bacteria 3340
16 Ga0070700_100829156 3300005441 Unclassified 747
17 Ga0070708_100299121 3300005445 Unclassified 1515
18 Ga0070663_100435126 3300005455 Unclassified 1078
19 Ga0070678_100521440 3300005456 Unclassified 1051
20 Ga0070681_10003824 3300005458 Bacteria 14151
21 Ga0070698_100036136 3300005471 Bacteria 5106
22 Ga0070699_100203936 3300005518 Unclassified 1759
23 Ga0070699_100235874 3300005518 Unclassified 1632
24 Ga0070684_100319974 3300005535 Bacteria 1425
25 Ga0070672_100168928 3300005543 Bacteria 1818
26 Ga0070665_100164707 3300005548 Bacteria 2219
27 Ga0070664_100000447 3300005564 Bacteria 31176
28 Ga0070664_100053389 3300005564 Bacteria 3426
29 Ga0068854_100637078 3300005578 Unclassified 914
30 Ga0068852_100372619 3300005616 Bacteria 1399
31 Ga0068870_10271761 3300005840 Bacteria 1059
32 Ga0081539_10001343 3300005985 Bacteria 42874
33 Ga0081539_10003185 3300005985 Bacteria 20765
34 Ga0070717_10412727 3300006028 Unclassified 1214
35 Ga0075427_10021817 3300006194 Bacteria 1020
36 Ga0075428_100000131 3300006844 Bacteria 65649
37 Ga0075430_100000166 3300006846 Bacteria 43368
38 Ga0075430_100145033 3300006846 Unclassified 1978
39 Ga0075431_100021311 3300006847 Bacteria 6624
40 Ga0075431_100402243 3300006847 Unclassified 1370
41 Ga0075433_10001707 3300006852 Bacteria 16391
42 Ga0075429_100009134 3300006880 Bacteria 8606
43 Ga0105240_10194980 3300009093 Unclassified 2379
44 Ga0105240_10694149 3300009093 Bacteria 1112
45 Ga0111539_10000496 3300009094 Bacteria 49999
46 Ga0111539_10020490 3300009094 Bacteria 8144
47 Ga0111539_10203250 3300009094 Bacteria 2310
48 Ga0114129_10000773 3300009147 Bacteria 40845
49 Ga0114129_10031970 3300009147 Bacteria 7440
50 Ga0114129_10947304 3300009147 Bacteria 1088
51 Ga0105242_10169589 3300009176 Bacteria 1917
52 Ga0105248_10093033 3300009177 Bacteria 3395
53 Ga0105237_10029849 3300009545 Bacteria 5538
54 Ga0105238_10126715 3300009551 Unclassified 2531
55 Ga0157370_10068580 3300013104 Bacteria 3351
56 Ga0157370_10204186 3300013104 Bacteria 1833
57 Ga0157370_10324593 3300013104 Bacteria 1420
58 Ga0157374_10613818 3300013296 Bacteria 1098
59 Ga0157378_10076030 3300013297 Bacteria 3025
60 Ga0163162_10064350 3300013306 Bacteria 3712
61 Ga0163163_10015151 3300014325 Bacteria 7118
62 Ga0163163_10488127 3300014325 Bacteria 1293
63 Ga0157380_10607571 3300014326 Bacteria 1083
64 Ga0157376_10331238 3300014969 Bacteria 1451
65 Ga0213872_10094316 3300021361 Unclassified 1337
66 Ga0213872_10095496 3300021361 Unclassified 1328
67 Ga0213875_10002044 3300021388 Bacteria 12395
68 Ga0213871_10033231 3300021441 Bacteria 1356
69 Ga0207707_10024609 3300025912 Bacteria 5270
70 Ga0207695_10030825 3300025913 Bacteria 5899
71 Ga0207695_10330063 3300025913 Bacteria 1414
72 Ga0207660_10526727 3300025917 Unclassified 960
73 Ga0207694_10204651 3300025924 Unclassified 1606
74 Ga0207650_10318389 3300025925 Bacteria 1274
75 Ga0207706_10393935 3300025933 Bacteria 1201
76 Ga0207669_10034083 3300025937 Bacteria 2881
77 Ga0207669_10122465 3300025937 Bacteria 1769
78 Ga0207711_10113887 3300025941 Bacteria 2408
79 Ga0207661_10003176 3300025944 Bacteria 11397
80 Ga0207679_10099536 3300025945 Bacteria 2270
81 Ga0207651_10141723 3300025960 Bacteria 1858
82 Ga0207668_10781081 3300025972 Bacteria 844
83 Ga0207677_10615442 3300026023 Bacteria 954
84 Ga0207678_10135579 3300026067 Bacteria 2100
85 Ga0207675_100266941 3300026118 Bacteria 1660
86 Ga0207698_10229440 3300026142 Bacteria 1684
87 Ga0207428_10001568 3300027907 Bacteria 23818
88 Ga0207428_10033197 3300027907 Bacteria 4241
89 Ga0207428_10079163 3300027907 Bacteria 2570
90 Ga0307408_100014572 3300031548 Bacteria 5224
91 Ga0307408_100091952 3300031548 Bacteria 2292
92 Ga0307408_100226208 3300031548 Bacteria 1529
93 Ga0307405_10077766 3300031731 Bacteria 2157
94 Ga0307413_10022128 3300031824 Bacteria 3419
95 Ga0307410_10068146 3300031852 Bacteria 2456
96 Ga0307410_10827303 3300031852 Bacteria 789
97 Ga0307406_10259174 3300031901 Unclassified 1314
98 Ga0307407_10020476 3300031903 Bacteria 3391
99 Ga0307407_10234906 3300031903 Bacteria 1247
100 Ga0307407_10330679 3300031903 Bacteria 1072
101 Ga0307412_10085692 3300031911 Unclassified 2190
102 Ga0307409_100007329 3300031995 Bacteria 6589
103 Ga0307409_100084322 3300031995 Bacteria 2579
104 Ga0307409_100726581 3300031995 Unclassified 995
105 Ga0307409_101028980 3300031995 Unclassified 843
106 Ga0307416_100018854 3300032002 Bacteria 4875
107 Ga0307416_100080221 3300032002 Plasmid 2753
108 Ga0307416_100085274 3300032002 Bacteria 2688
109 Ga0307416_100446498 3300032002 Bacteria 1345
110 Ga0307416_100795850 3300032002 Unclassified 1041
111 Ga0307416_100924160 3300032002 Bacteria 973
112 Ga0307414_10012034 3300032004 Bacteria 5102
113 Ga0307411_10028302 3300032005 Bacteria 3405
114 Ga0307411_10071963 3300032005 Bacteria 2346
115 Ga0307411_10145583 3300032005 Bacteria 1753
116 Ga0307411_10310599 3300032005 Unclassified 1268
117 Ga0307411_10375353 3300032005 Unclassified 1168
118 Ga0307411_10818476 3300032005 Unclassified 821
119 Ga0307415_100181431 3300032126 Bacteria 1652
120 Ga0436364_0705033 3300037853 Bacteria 19657
121 Ga0436364_1388030 3300037853 Bacteria 2680
122 Ga0436360_0312274 3300039438 Bacteria 2486
123 Ga0436361_0146595 3300039447 Bacteria 2395
124 Ga0436361_0503471 3300039447 Bacteria 3421
125 Ga0436363_1564419 3300039450 Bacteria 8188
126 Ga0436362_0571672 3300039453 Unclassified 1055
127 Ga0439450_005299 3300042008 Bacteria 2261
128 Ga0466960_0434981 3300044901 Unclassified 760
129 Ga0451576_0462873 3300045051 Unclassified 1332
130 Ga0451576_0992098 3300045051 Bacteria 880
131 Ga0495603_0196520 3300046455 Bacteria 1166
132 Ga0495594_0486641 3300046499 Bacteria 701
133 Ga0496104_0077587 3300048907 Bacteria 3165
134 Ga0496105_0065913 3300048908 Unclassified 2989
135 Ga0496108_0010136 3300048911 Bacteria 7647
136 Ga0496110_0006108 3300048913 Bacteria 9493
137 Ga0496111_0053851 3300048914 Bacteria 2907
138 Ga0496113_0316433 3300048916 Bacteria 1251
139 Ga0496126_0139845 3300048929 Bacteria 2085
140 Ga0501298_013467 3300049521 Bacteria 1449
141 Ga0501032_0000690 3300049569 Bacteria 27425
142 Ga0501034_0009011 3300049571 Bacteria 10481
143 Ga0501037_0033299 3300049573 Bacteria 3806
144 Ga0501038_0002803 3300049574 Bacteria 16230
145 Ga0501039_0060577 3300049575 Bacteria 2932
146 Ga0501043_0001340 3300049579 Bacteria 21554
147 Ga0501046_0000733 3300049580 Bacteria 31696
148 Ga0501047_0021967 3300049581 Bacteria 6129
149 Ga0501067_0015960 3300049583 Bacteria 4154
150 Ga0501067_0261110 3300049583 Unclassified 964
151 Ga0501068_0012697 3300049584 Bacteria 4780
152 Ga0501069_0018698 3300049585 Bacteria 3742
153 Ga0501070_0001523 3300049586 Bacteria 20642
154 Ga0501070_0045834 3300049586 Unclassified 3636
155 Ga0501071_0237241 3300049587 Unclassified 1375
156 Ga0501072_0008402 3300049588 Bacteria 7837
157 Ga0501073_0003583 3300049589 Bacteria 11677
158 Ga0501074_0055653 3300049590 Bacteria 2850
159 Ga0501074_0199622 3300049590 Unclassified 1426
160 Ga0501075_0454353 3300049591 Bacteria 977
161 Ga0501076_0314202 3300049592 Bacteria 1285
162 Ga0501077_0005285 3300049593 Bacteria 7845
163 Ga0501249_082098 3300049679 Bacteria 759
164 Ga0501079_0005856 3300049741 Bacteria 9196
165 Ga0501080_0000015 3300049742 Bacteria 98057
166 Ga0501280_010172 3300049776 Bacteria 1310
167 Ga0501035_0127289 3300049822 Unclassified 2223
168 Ga0501035_0983265 3300049822 Unclassified 664
169 Ga0501044_0002537 3300049823 Bacteria 20784
170 Ga0501044_0111897 3300049823 Bacteria 2737
171 nmdc:mga05p37_323430_c1 3300050507 Bacteria 1825
172 nmdc:mga05p37_752_c1 3300050507 Bacteria 35946
173 nmdc:mga09592_8336_c1 3300050508 Bacteria 8427
174 nmdc:mga0qj67_413378_c1 3300050509 Bacteria 1088
175 nmdc:mga06r32_389397_c1 3300050510 Unclassified 1376
176 nmdc:mga06r32_70710_c1 3300050510 Unclassified 3376
177 nmdc:mga08y16_159196_c1 3300050511 Bacteria 2346
178 nmdc:mga08y16_320_c1 3300050511 Bacteria 43519
179 nmdc:mga08y16_45023_c1 3300050511 Bacteria 4623
180 nmdc:mga0n895_1201112_c1 3300050512 Unclassified 732
181 nmdc:mga0a205_15663_c1 3300050515 Bacteria 7086
182 Ga0501084_0002217 3300054114 Bacteria 15594
183 Ga0590071_000087 3300059421 Bacteria 25447
184 Ga0590071_001932 3300059421 Bacteria 5302
185 Ga0590074_000032 3300059423 Bacteria 13226
186 Ga0590074_005007 3300059423 Bacteria 2190
187 Ga0590075_005377 3300059424 Bacteria 3023
188 Ga0590077_005622 3300059426 Bacteria 2565
189 2989777735 2989776772 Bacteria 4843317
190 8005247088 8005246636 Bacteria 4933972
191 Ga0068871_100457342
192 Ga0070683_100003308
193 Ga0070670_100093173
194 Ga0070670_100190781
195 Ga0068869_100250839
196 Ga0070680_100119199
197 Ga0070660_100244485
198 Ga0070661_100226062
199 Ga0070692_10119373
200 Ga0070668_100751127
201 Ga0070675_100085079
202 Ga0070675_100330052
203 Ga0070674_100043963
204 Ga0070674_100311819
205 Ga0070673_100047522
206 Ga0070700_100829156
207 Ga0070708_100299121
208 Ga0070663_100435126
209 Ga0070678_100521440
210 Ga0070681_10003824
211 Ga0070698_100036136
212 Ga0070699_100203936
213 Ga0070699_100235874
214 Ga0070684_100319974
215 Ga0070672_100168928
216 Ga0070665_100164707
217 Ga0070664_100000447
218 Ga0070664_100053389
219 Ga0068854_100637078
220 Ga0068852_100372619
221 Ga0068870_10271761
222 Ga0081539_10001343
223 Ga0081539_10003185
224 Ga0070717_10412727
225 Ga0075427_10021817
226 Ga0075428_100000131
227 Ga0075430_100000166
228 Ga0075430_100145033
229 Ga0075431_100021311
230 Ga0075431_100402243
231 Ga0075433_10001707
232 Ga0075429_100009134
233 Ga0105240_10194980
234 Ga0105240_10694149
235 Ga0111539_10000496
236 Ga0111539_10020490
237 Ga0111539_10203250
238 Ga0114129_10000773
239 Ga0114129_10031970
240 Ga0114129_10947304
241 Ga0105242_10169589
242 Ga0105248_10093033
243 Ga0105237_10029849
244 Ga0105238_10126715
245 Ga0157370_10068580
246 Ga0157370_10204186
247 Ga0157370_10324593
248 Ga0157374_10613818
249 Ga0157378_10076030
250 Ga0163162_10064350
251 Ga0163163_10015151
252 Ga0163163_10488127
253 Ga0157380_10607571
254 Ga0157376_10331238
255 Ga0213872_10094316
256 Ga0213872_10095496
257 Ga0213875_10002044
258 Ga0213871_10033231
259 Ga0207707_10024609
260 Ga0207695_10030825
261 Ga0207695_10330063
262 Ga0207660_10526727
263 Ga0207694_10204651
264 Ga0207650_10318389
265 Ga0207706_10393935
266 Ga0207669_10034083
267 Ga0207669_10122465
268 Ga0207711_10113887
269 Ga0207661_10003176
270 Ga0207679_10099536
271 Ga0207651_10141723
272 Ga0207668_10781081
273 Ga0207677_10615442
274 Ga0207678_10135579
275 Ga0207675_100266941
276 Ga0207698_10229440
277 Ga0207428_10001568
278 Ga0207428_10033197
279 Ga0207428_10079163
280 Ga0307408_100014572
281 Ga0307408_100091952
282 Ga0307408_100226208
283 Ga0307405_10077766
284 Ga0307413_10022128
285 Ga0307410_10068146
286 Ga0307410_10827303
287 Ga0307406_10259174
288 Ga0307407_10020476
289 Ga0307407_10234906
290 Ga0307407_10330679
291 Ga0307412_10085692
292 Ga0307409_100007329
293 Ga0307409_100084322
294 Ga0307409_100726581
295 Ga0307409_101028980
296 Ga0307416_100018854
297 Ga0307416_100080221
298 Ga0307416_100085274
299 Ga0307416_100446498
300 Ga0307416_100795850
301 Ga0307416_100924160
302 Ga0307414_10012034
303 Ga0307411_10028302
304 Ga0307411_10071963
305 Ga0307411_10145583
306 Ga0307411_10310599
307 Ga0307411_10375353
308 Ga0307411_10818476
309 Ga0307415_100181431
310 Ga0436364_0705033
311 Ga0436364_1388030
312 Ga0436360_0312274
313 Ga0436361_0146595
314 Ga0436361_0503471
315 Ga0436363_1564419
316 Ga0436362_0571672
317 Ga0439450_005299
318 Ga0466960_0434981
319 Ga0451576_0462873
320 Ga0451576_0992098
321 Ga0495603_0196520
322 Ga0495594_0486641
323 Ga0496104_0077587
324 Ga0496105_0065913
325 Ga0496108_0010136
326 Ga0496110_0006108
327 Ga0496111_0053851
328 Ga0496113_0316433
329 Ga0496126_0139845
330 Ga0501298_013467
331 Ga0501032_0000690
332 Ga0501034_0009011
333 Ga0501037_0033299
334 Ga0501038_0002803
335 Ga0501039_0060577
336 Ga0501043_0001340
337 Ga0501046_0000733
338 Ga0501047_0021967
339 Ga0501067_0015960
340 Ga0501067_0261110
341 Ga0501068_0012697
342 Ga0501069_0018698
343 Ga0501070_0001523
344 Ga0501070_0045834
345 Ga0501071_0237241
346 Ga0501072_0008402
347 Ga0501073_0003583
348 Ga0501074_0055653
349 Ga0501074_0199622
350 Ga0501075_0454353
351 Ga0501076_0314202
352 Ga0501077_0005285
353 Ga0501249_082098
354 Ga0501079_0005856
355 Ga0501080_0000015
356 Ga0501280_010172
357 Ga0501035_0127289
358 Ga0501035_0983265
359 Ga0501044_0002537
360 Ga0501044_0111897
361 nmdc:mga05p37_323430_c1
362 nmdc:mga05p37_752_c1
363 nmdc:mga09592_8336_c1
364 nmdc:mga0qj67_413378_c1
365 nmdc:mga06r32_389397_c1
366 nmdc:mga06r32_70710_c1
367 nmdc:mga08y16_159196_c1
368 nmdc:mga08y16_320_c1
369 nmdc:mga08y16_45023_c1
370 nmdc:mga0n895_1201112_c1
371 nmdc:mga0a205_15663_c1
372 Ga0501084_0002217
373 Ga0590071_000087
374 Ga0590071_001932
375 Ga0590074_000032
376 Ga0590074_005007
377 Ga0590075_005377
378 Ga0590077_005622
379 2989777735
380 8005247088

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

80

234

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d0i-assembly2.cif.gz_C part: prs adp-ribosylating toxin bound to cognate antitoxin pars. l48m part, semet-substituted complex. 0.7055 88 206
6fkg-assembly1.cif.gz_B crystal structure of the m.tuberculosis mbct-mbca toxin-antitoxin complex. 0.7019 88 212
8gug-assembly1.cif.gz_A-2 structure of vpa0770 toxin bound to vpa0769 antitoxin in vibrio parahaemolyticus 0.6918 88 206
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.681 89 206
6gw6-assembly1.cif.gz_D structure of the pseudomonas putida res-xre toxin-antitoxin complex 0.5539 89 206
ID Description Score Start End Superfamily
af_K7N1I8_223_462_3.30.559.10 Alpha Beta;2-Layer Sandwich;Chloramphenicol Acetyltransferase;Chloramphenicol acetyltransferase-like domain 0.5958 176 194 3.30.559.10
af_O94582_1_484_3.60.120.10 Alpha Beta;4-Layer Sandwich;Anthranilate synthase;Anthranilate synthase 0.4928 97 138 3.60.120.10
af_P13437_5_396_2.60.40.420 Mainly Beta;Sandwich;Immunoglobulin-like;Cupredoxins - 0.4889 161 196 2.60.40.420
af_A0A0G2KML7_1_235_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.4775 161 196 3.40.47.10
af_D3Z955_236_353_3.40.120.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 3;Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3 0.4602 148 206 3.40.120.10
ID Description Score Start End GO Terms
AF-A0A3C0Y550-F1-model_v4 RES domain-containing protein 0.9631 128 224
AF-A0A7I8I081-F1-model_v4 deleted 0.9539 61 224
AF-A0A1Q7IXY4-F1-model_v4 RES domain-containing protein 0.9505 62 224
AF-A0A6L7S2M7-F1-model_v4 RES family NAD+ phosphorylase 0.9473 97 224
AF-A0A1Z8A7P0-F1-model_v4 RES domain-containing protein 0.9471 97 224

Map