F291612

General Info

Members Datasets Scaffolds Average Seq Length
189 118 378 136

Family's Representative Sequence

Representative Sequence 3300049663|Ga0501223_006774|Ga0501223_006774_66_557
Length 163
Sequence MMRDFLRLKLAPLIGLLAVALLAGPPASAAIQNSVAARNARLDAFETAVGTSPILKIRTGAAPANCAAADSGTVLATMTLPSDWMAAASSGTKAKSGTWEDSAADAAGTAGHYRLYASDGTTCHEQGTVTATSGGGDIELQNTSIAVGQAITITSYTKTAGNQ

Samples

Sample ID Description Type Environment
1 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
10 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
11 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
12 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
13 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
14 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
15 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
18 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
19 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
20 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
23 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
24 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
25 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
26 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
27 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
28 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
29 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
30 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
31 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
32 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
45 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
46 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
49 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
50 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
51 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
52 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
53 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
54 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
55 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
56 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
57 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
58 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
59 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
60 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
61 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
62 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
63 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
64 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
65 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
66 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
67 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
68 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
69 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
70 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
71 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
72 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
73 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
74 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
75 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
76 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
77 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
78 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
79 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
80 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
81 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
82 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
83 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
84 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
85 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
86 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
87 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
88 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
89 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
90 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
91 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
92 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
93 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
94 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
95 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
96 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
97 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
98 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
99 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
100 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
101 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
102 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
103 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
104 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
105 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
106 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
107 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
108 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
109 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
110 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
111 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
112 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
113 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
114 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
115 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
116 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
117 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
118 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.18
Metatranscriptomes 0
Isolates 5.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 17.99
Rhizoplane 3.17
Rhizosphere 76.19
Stem 0
Stem Tuber 0
Unclassified 21.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501223_006774 3300049663 Bacteria 2359
2 rootL2_10040550 3300003322 Bacteria 34356
3 Ga0070689_100476906 3300005340 Bacteria 1065
4 Ga0070668_100000008 3300005347 Bacteria 137948
5 Ga0070668_100000693 3300005347 Bacteria 22958
6 Ga0070669_100006989 3300005353 Bacteria 8110
7 Ga0070669_100027766 3300005353 Unclassified 4074
8 Ga0070671_100000371 3300005355 Bacteria 31072
9 Ga0070681_11223630 3300005458 Bacteria 673
10 Ga0070707_100770989 3300005468 Unclassified 925
11 Ga0070698_100001274 3300005471 Bacteria 28147
12 Ga0070679_100280712 3300005530 Bacteria 1618
13 Ga0068855_101718633 3300005563 Bacteria 639
14 Ga0068859_100066487 3300005617 Bacteria 3640
15 Ga0068863_100001163 3300005841 Bacteria 26281
16 Ga0068858_100031790 3300005842 Bacteria 4905
17 Ga0068860_100218541 3300005843 Unclassified 1850
18 Ga0068862_100002191 3300005844 Bacteria 17528
19 Ga0075432_10117876 3300006058 Unclassified 995
20 Ga0075428_100002384 3300006844 Bacteria 20399
21 Ga0075430_100102095 3300006846 Bacteria 2394
22 Ga0075430_100559063 3300006846 Unclassified 944
23 Ga0075431_100071228 3300006847 Bacteria 3587
24 Ga0075429_100003019 3300006880 Bacteria 14262
25 Ga0075436_100367687 3300006914 Unclassified 1038
26 Ga0097620_100066488 3300006931 Bacteria 3640
27 Ga0079104_1001595 3300006946 Bacteria 14795
28 Ga0079104_1019361 3300006946 Bacteria 1904
29 Ga0079104_1089708 3300006946 Bacteria 624
30 Ga0099826_10004811 3300006948 Bacteria 9540
31 Ga0099826_10028847 3300006948 Bacteria 4052
32 Ga0105245_10273378 3300009098 Bacteria 1649
33 Ga0105248_10215387 3300009177 Bacteria 2163
34 Ga0105246_10817955 3300011119 Unclassified 828
35 Ga0163162_10023454 3300013306 Bacteria 6089
36 Ga0228711_1000983 3300022739 Bacteria 39669
37 Ga0228711_1010478 3300022739 Bacteria 12171
38 Ga0228710_1017658 3300022740 Bacteria 7007
39 Ga0228710_1018837 3300022740 Bacteria 6397
40 Ga0228710_1023935 3300022740 Bacteria 4338
41 Ga0228710_1025326 3300022740 Bacteria 3898
42 Ga0228710_1062081 3300022740 Bacteria 553
43 Ga0207688_10022894 3300025901 Unclassified 3420
44 Ga0207707_10676832 3300025912 Bacteria 868
45 Ga0207660_10105159 3300025917 Bacteria 2115
46 Ga0207652_10297383 3300025921 Bacteria 1457
47 Ga0207646_10451387 3300025922 Unclassified 1160
48 Ga0207681_10003932 3300025923 Bacteria 9215
49 Ga0207681_10016424 3300025923 Unclassified 4632
50 Ga0207644_10038008 3300025931 Viruses 3388
51 Ga0207711_10472604 3300025941 Bacteria 1168
52 Ga0207667_11275291 3300025949 Bacteria 712
53 Ga0207668_10000120 3300025972 Bacteria 55519
54 Ga0207668_10000609 3300025972 Bacteria 22254
55 Ga0207703_10031118 3300026035 Bacteria 4218
56 Ga0207641_10026109 3300026088 Viruses 4819
57 Ga0209281_1001090 3300027111 Bacteria 19918
58 Ga0209281_1001504 3300027111 Bacteria 13292
59 Ga0209281_1002307 3300027111 Bacteria 7983
60 Ga0209281_1017793 3300027111 Bacteria 1435
61 Ga0209282_1003315 3300027666 Bacteria 9549
62 Ga0209282_1021665 3300027666 Bacteria 4060
63 Ga0268265_10000270 3300028380 Bacteria 58914
64 Ga0268264_10318036 3300028381 Bacteria 1471
65 Ga0307408_100009302 3300031548 Bacteria 6478
66 Ga0307408_100220336 3300031548 Bacteria 1548
67 Ga0307413_10715200 3300031824 Unclassified 833
68 Ga0307413_10821116 3300031824 Bacteria 783
69 Ga0315914_1002610 3300031967 Bacteria 27591
70 Ga0315914_1003165 3300031967 Bacteria 25089
71 Ga0307416_100436612 3300032002 Bacteria 1358
72 Ga0307414_11789724 3300032004 Unclassified 573
73 Ga0307411_11900271 3300032005 Bacteria 554
74 Ga0315913_1001629 3300033430 Bacteria 25089
75 Ga0315913_1009853 3300033430 Bacteria 11122
76 Ga0315915_1002049 3300033464 Bacteria 25089
77 Ga0315915_1005215 3300033464 Bacteria 16232
78 Ga0395899_0000063 3300037312 Unclassified 207642
79 Ga0395899_0000362 3300037312 Viruses 55271
80 Ga0395899_0170249 3300037312 Bacteria 1534
81 Ga0395899_0341220 3300037312 Unclassified 1004
82 Ga0395899_0422181 3300037312 Bacteria 878
83 Ga0395899_0898205 3300037312 Unclassified 540
84 Ga0395900_0000032 3300037418 Unclassified 261400
85 Ga0395900_0000040 3300037418 Unclassified 247333
86 Ga0395900_0000044 3300037418 Unclassified 232423
87 Ga0395900_0011933 3300037418 Bacteria 8884
88 Ga0395900_0014360 3300037418 Bacteria 8084
89 Ga0395900_0018372 3300037418 Viruses 7131
90 Ga0395900_0027541 3300037418 Bacteria 5822
91 Ga0395900_0044076 3300037418 Bacteria 4598
92 Ga0395900_0127877 3300037418 Viruses 2604
93 Ga0395900_0177117 3300037418 Unclassified 2168
94 Ga0395900_0281000 3300037418 Unclassified 1656
95 Ga0395900_1527908 3300037418 Unclassified 579
96 Ga0395898_0000066 3300037466 Unclassified 256052
97 Ga0395898_0000083 3300037466 Unclassified 242456
98 Ga0395898_0000128 3300037466 Unclassified 196141
99 Ga0395898_0001015 3300037466 Bacteria 43723
100 Ga0395898_0009557 3300037466 Viruses 10185
101 Ga0395898_0039685 3300037466 Bacteria 4658
102 Ga0395898_0054966 3300037466 Bacteria 3883
103 Ga0395898_0106186 3300037466 Bacteria 2693
104 Ga0395898_0124420 3300037466 Bacteria 2470
105 Ga0395898_0172328 3300037466 Bacteria 2068
106 Ga0395898_0455856 3300037466 Unclassified 1217
107 Ga0395898_0883390 3300037466 Bacteria 832
108 Ga0395905_0001153 3300037471 Viruses 33085
109 Ga0395905_0063153 3300037471 Viruses 3464
110 Ga0395905_0195746 3300037471 Unclassified 1895
111 Ga0395905_0379749 3300037471 Bacteria 1307
112 Ga0436364_0822838 3300037853 Unclassified 725
113 Ga0395901_0000029 3300038443 Unclassified 242456
114 Ga0395901_0009599 3300038443 Bacteria 9816
115 Ga0395901_0067662 3300038443 Bacteria 3720
116 Ga0395901_0144406 3300038443 Viruses 2501
117 Ga0395901_0618421 3300038443 Bacteria 1090
118 Ga0395901_0862517 3300038443 Bacteria 890
119 Ga0395901_1108114 3300038443 Unclassified 762
120 Ga0395901_1525478 3300038443 Unclassified 623
121 Ga0451807_0204539 3300041486 Unclassified 908
122 Ga0451577_0002174 3300042876 Bacteria 23944
123 Ga0451577_0370265 3300042876 Viruses 1300
124 Ga0466972_0000033 3300044658 Unclassified 153292
125 Ga0453683_0759501 3300044673 Unclassified 637
126 Ga0453684_0004706 3300044712 Bacteria 28237
127 Ga0453684_0072616 3300044712 Viruses 4343
128 Ga0466968_0114663 3300044735 Bacteria 1215
129 Ga0451576_0091939 3300045051 Viruses 3156
130 Ga0451576_0763657 3300045051 Bacteria 1015
131 Ga0495651_0772496 3300046462 Bacteria 594
132 Ga0495630_0010937 3300046517 Bacteria 6557
133 Ga0495630_0099823 3300046517 Unclassified 2196
134 Ga0495637_0107993 3300046520 Bacteria 1081
135 Ga0495660_0004033 3300046810 Bacteria 8966
136 Ga0495604_0006975 3300047317 Bacteria 8954
137 Ga0495675_0720924 3300047444 Bacteria 557
138 Ga0495626_0003500 3300048091 Bacteria 10056
139 Ga0496101_0003235 3300048904 Bacteria 10109
140 Ga0496101_0713328 3300048904 Bacteria 792
141 Ga0496106_0002789 3300048909 Bacteria 12949
142 Ga0496106_0131251 3300048909 Viruses 1965
143 Ga0496110_1140714 3300048913 Bacteria 688
144 Ga0501034_0019558 3300049571 Bacteria 6925
145 Ga0501036_0045659 3300049572 Viruses 3711
146 Ga0501037_0137422 3300049573 Bacteria 1750
147 Ga0501038_0007748 3300049574 Bacteria 9899
148 Ga0501038_0102464 3300049574 Bacteria 2382
149 Ga0501038_0473035 3300049574 Bacteria 961
150 Ga0501042_0012963 3300049578 Bacteria 5663
151 Ga0501046_0044551 3300049580 Bacteria 3528
152 Ga0501048_0000109 3300049582 Bacteria 46357
153 Ga0501067_0634493 3300049583 Bacteria 599
154 Ga0501071_0029384 3300049587 Bacteria 3879
155 Ga0501073_0180653 3300049589 Bacteria 1460
156 Ga0501076_0022160 3300049592 Bacteria 4881
157 Ga0501227_089484 3300049665 Bacteria 812
158 Ga0501230_082657 3300049667 Unclassified 674
159 Ga0501219_000309 3300049703 Bacteria 8555
160 Ga0501225_0028028 3300049705 Unclassified 1548
161 Ga0501225_0075102 3300049705 Unclassified 965
162 Ga0501079_0088042 3300049741 Bacteria 2404
163 Ga0501079_1341625 3300049741 Bacteria 563
164 Ga0501080_0079890 3300049742 Bacteria 3040
165 Ga0501081_0007034 3300049743 Bacteria 7316
166 Ga0501035_0402304 3300049822 Bacteria 1139
167 Ga0501045_0040362 3300049824 Viruses 3397
168 nmdc:mga09592_164_c1 3300050508 Bacteria 46558
169 nmdc:mga09592_887_c1 3300050508 Bacteria 23445
170 nmdc:mga0qj67_100626_c1 3300050509 Bacteria 2330
171 nmdc:mga06r32_1878187_c1 3300050510 Unclassified 534
172 nmdc:mga06r32_246979_c1 3300050510 Unclassified 1772
173 nmdc:mga0a205_313641_c1 3300050515 Bacteria 1440
174 Ga0500646_0086230 3300053090 Unclassified 965
175 Ga0500655_012462 3300053133 Bacteria 1546
176 Ga0501084_0037761 3300054114 Bacteria 4036
177 Ga0501082_0763040 3300060353 Unclassified 846
178 Ga0530510_0259144 3300061734 Bacteria 1296
179 2514007175 2513237160 Bacteria 6650282
180 2517571196 2517487022 Bacteria 7227575
181 2643770582 2643221550 Bacteria 4619371
182 2855878666 2855872281 Bacteria 6964271
183 2916082151 2916076590 Bacteria 6596108
184 2937068938 2937063883 Bacteria 7199456
185 2957455413 2957450854 Bacteria 6765715
186 2967671779 2967671571 Bacteria 7021409
187 2967750698 2967748971 Bacteria 6733771
188 2970125266 2970122695 Bacteria 6625855
189 2970142751 2970136068 Bacteria 7207982
190 Ga0501223_006774
191 rootL2_10040550
192 Ga0070689_100476906
193 Ga0070668_100000008
194 Ga0070668_100000693
195 Ga0070669_100006989
196 Ga0070669_100027766
197 Ga0070671_100000371
198 Ga0070681_11223630
199 Ga0070707_100770989
200 Ga0070698_100001274
201 Ga0070679_100280712
202 Ga0068855_101718633
203 Ga0068859_100066487
204 Ga0068863_100001163
205 Ga0068858_100031790
206 Ga0068860_100218541
207 Ga0068862_100002191
208 Ga0075432_10117876
209 Ga0075428_100002384
210 Ga0075430_100102095
211 Ga0075430_100559063
212 Ga0075431_100071228
213 Ga0075429_100003019
214 Ga0075436_100367687
215 Ga0097620_100066488
216 Ga0079104_1001595
217 Ga0079104_1019361
218 Ga0079104_1089708
219 Ga0099826_10004811
220 Ga0099826_10028847
221 Ga0105245_10273378
222 Ga0105248_10215387
223 Ga0105246_10817955
224 Ga0163162_10023454
225 Ga0228711_1000983
226 Ga0228711_1010478
227 Ga0228710_1017658
228 Ga0228710_1018837
229 Ga0228710_1023935
230 Ga0228710_1025326
231 Ga0228710_1062081
232 Ga0207688_10022894
233 Ga0207707_10676832
234 Ga0207660_10105159
235 Ga0207652_10297383
236 Ga0207646_10451387
237 Ga0207681_10003932
238 Ga0207681_10016424
239 Ga0207644_10038008
240 Ga0207711_10472604
241 Ga0207667_11275291
242 Ga0207668_10000120
243 Ga0207668_10000609
244 Ga0207703_10031118
245 Ga0207641_10026109
246 Ga0209281_1001090
247 Ga0209281_1001504
248 Ga0209281_1002307
249 Ga0209281_1017793
250 Ga0209282_1003315
251 Ga0209282_1021665
252 Ga0268265_10000270
253 Ga0268264_10318036
254 Ga0307408_100009302
255 Ga0307408_100220336
256 Ga0307413_10715200
257 Ga0307413_10821116
258 Ga0315914_1002610
259 Ga0315914_1003165
260 Ga0307416_100436612
261 Ga0307414_11789724
262 Ga0307411_11900271
263 Ga0315913_1001629
264 Ga0315913_1009853
265 Ga0315915_1002049
266 Ga0315915_1005215
267 Ga0395899_0000063
268 Ga0395899_0000362
269 Ga0395899_0170249
270 Ga0395899_0341220
271 Ga0395899_0422181
272 Ga0395899_0898205
273 Ga0395900_0000032
274 Ga0395900_0000040
275 Ga0395900_0000044
276 Ga0395900_0011933
277 Ga0395900_0014360
278 Ga0395900_0018372
279 Ga0395900_0027541
280 Ga0395900_0044076
281 Ga0395900_0127877
282 Ga0395900_0177117
283 Ga0395900_0281000
284 Ga0395900_1527908
285 Ga0395898_0000066
286 Ga0395898_0000083
287 Ga0395898_0000128
288 Ga0395898_0001015
289 Ga0395898_0009557
290 Ga0395898_0039685
291 Ga0395898_0054966
292 Ga0395898_0106186
293 Ga0395898_0124420
294 Ga0395898_0172328
295 Ga0395898_0455856
296 Ga0395898_0883390
297 Ga0395905_0001153
298 Ga0395905_0063153
299 Ga0395905_0195746
300 Ga0395905_0379749
301 Ga0436364_0822838
302 Ga0395901_0000029
303 Ga0395901_0009599
304 Ga0395901_0067662
305 Ga0395901_0144406
306 Ga0395901_0618421
307 Ga0395901_0862517
308 Ga0395901_1108114
309 Ga0395901_1525478
310 Ga0451807_0204539
311 Ga0451577_0002174
312 Ga0451577_0370265
313 Ga0466972_0000033
314 Ga0453683_0759501
315 Ga0453684_0004706
316 Ga0453684_0072616
317 Ga0466968_0114663
318 Ga0451576_0091939
319 Ga0451576_0763657
320 Ga0495651_0772496
321 Ga0495630_0010937
322 Ga0495630_0099823
323 Ga0495637_0107993
324 Ga0495660_0004033
325 Ga0495604_0006975
326 Ga0495675_0720924
327 Ga0495626_0003500
328 Ga0496101_0003235
329 Ga0496101_0713328
330 Ga0496106_0002789
331 Ga0496106_0131251
332 Ga0496110_1140714
333 Ga0501034_0019558
334 Ga0501036_0045659
335 Ga0501037_0137422
336 Ga0501038_0007748
337 Ga0501038_0102464
338 Ga0501038_0473035
339 Ga0501042_0012963
340 Ga0501046_0044551
341 Ga0501048_0000109
342 Ga0501067_0634493
343 Ga0501071_0029384
344 Ga0501073_0180653
345 Ga0501076_0022160
346 Ga0501227_089484
347 Ga0501230_082657
348 Ga0501219_000309
349 Ga0501225_0028028
350 Ga0501225_0075102
351 Ga0501079_0088042
352 Ga0501079_1341625
353 Ga0501080_0079890
354 Ga0501081_0007034
355 Ga0501035_0402304
356 Ga0501045_0040362
357 nmdc:mga09592_164_c1
358 nmdc:mga09592_887_c1
359 nmdc:mga0qj67_100626_c1
360 nmdc:mga06r32_1878187_c1
361 nmdc:mga06r32_246979_c1
362 nmdc:mga0a205_313641_c1
363 Ga0500646_0086230
364 Ga0500655_012462
365 Ga0501084_0037761
366 Ga0501082_0763040
367 Ga0530510_0259144
368 2514007175
369 2517571196
370 2643770582
371 2855878666
372 2916082151
373 2937068938
374 2957455413
375 2967671779
376 2967750698
377 2970125266
378 2970142751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hhk-assembly2.cif.gz_C structure of gp105 of listeria bacteriophage a511 0.5342 3 132
6lrs-assembly1.cif.gz_S cryo-em structure of rbcl8-rbcs4 from anabaena sp. pcc 7120 0.5205 3 37
6hhk-assembly2.cif.gz_C structure of gp105 of listeria bacteriophage a511 0.5152 3 132
8pv3-assembly1.cif.gz_CM chaetomium thermophilum pre-60s state 9 - pre-5s rotation - immature h68/h69 - composite structure 0.465 8 36
3fb9-assembly1.cif.gz_A the crystal structure of the protein with unknown function from streptococcus pneumoniae tigr4 0.4006 6 71
ID Description Score Start End Superfamily
af_Q99426_149_241_2.30.30.190 Mainly Beta;Roll;SH3 type barrels.;CAP Gly-rich-like domain 0.4926 12 58 2.30.30.190
af_Q4CZD1_144_302_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.4741 8 38 3.30.450.40
af_A0A1D6KMX1_356_430_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.4717 22 107 2.60.40.1120
af_A0A2R8QHQ6_157_257_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.4715 19 98 2.60.40.10
af_A0A1D6KMX1_356_430_2.60.40.1120 Mainly Beta;Sandwich;Immunoglobulin-like;Carboxypeptidase-like, regulatory domain 0.4543 22 107 2.60.40.1120
ID Description Score Start End GO Terms
AF-A0A4S0WC72-F1-model_v4 Uncharacterized protein 0.9897 3 135
AF-A0A508WWH2-F1-model_v4 Uncharacterized protein 0.9893 1 135
AF-A0A350I7G6-F1-model_v4 Uncharacterized protein 0.9808 1 135
AF-A0A1T5BVT1-F1-model_v4 Protein activator of alkane oxidation PraB 0.978 3 134
AF-A0A4S0WC72-F1-model_v4 Uncharacterized protein 0.9748 3 135

Map