F291275

General Info

Members Datasets Scaffolds Average Seq Length
189 141 378 179

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0682420|Ga0395901_0682420_160_795
Length 202
Sequence MDVEIHPVGPDRWTDMVTLFERRGPRGGHRNTPAYGCWCMYWRDRSLEHGEPKKRAMAKLVRDGCEPGLLAYADGEPVGWVAVAPRDEFQAIVDSPQYGPRGSALEAPAAKPPAPGAGRDEGVWSITCFVVDRPQWRRGVAGALLEAAVAHAFSRGAAAVEAYPHVSNGSDYMGPLALFERAGFAKVRDANKRAVVRIGRGF

Samples

Sample ID Description Type Environment
1 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
7 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
8 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
9 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
10 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
11 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
12 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
13 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
14 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
23 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
27 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
31 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
32 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
33 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
49 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
50 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
51 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
52 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
53 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
54 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
55 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
56 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
57 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
58 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
59 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
60 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
61 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
62 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
63 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
64 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
65 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
66 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
67 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
68 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
71 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
72 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
73 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
74 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
75 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
76 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
77 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
78 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
79 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
80 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
81 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
82 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
83 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
84 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
85 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
86 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
87 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
88 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
89 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
90 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
91 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
92 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
93 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
102 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
103 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
104 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
108 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
109 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
110 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
116 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
119 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
120 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
121 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
122 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
125 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
126 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
127 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
128 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
129 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
130 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
131 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
132 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
135 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
136 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
137 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
138 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
139 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
140 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
141 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.83
Metatranscriptomes 3.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.06
Nodule 0
Rhizoplane 4.23
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 6.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395901_0682420 3300038443 Bacteria 1027
2 Ga0070683_100009662 3300005329 Bacteria 8258
3 Ga0070660_100168287 3300005339 Bacteria 1769
4 Ga0070714_100008658 3300005435 Bacteria 7956
5 Ga0070714_100450177 3300005435 Bacteria 1223
6 Ga0070714_101216340 3300005435 Unclassified 735
7 Ga0070713_100015975 3300005436 Bacteria 5633
8 Ga0070708_100601915 3300005445 Bacteria 1036
9 Ga0070681_10119553 3300005458 Bacteria 2571
10 Ga0070707_100002679 3300005468 Bacteria 16930
11 Ga0070679_100885545 3300005530 Bacteria 836
12 Ga0070684_100068643 3300005535 Bacteria 3116
13 Ga0070697_100177093 3300005536 Bacteria 1807
14 Ga0070695_100169785 3300005545 Unclassified 1538
15 Ga0070696_100054211 3300005546 Bacteria 2793
16 Ga0068857_101574271 3300005577 Unclassified 641
17 Ga0068856_100169621 3300005614 Bacteria 2194
18 Ga0068856_100504284 3300005614 Bacteria 1231
19 Ga0068852_100145400 3300005616 Bacteria 2199
20 Ga0081455_10004114 3300005937 Bacteria 16459
21 Ga0081455_10123898 3300005937 Bacteria 2032
22 Ga0081540_1014320 3300005983 Bacteria 5088
23 Ga0081540_1015922 3300005983 Bacteria 4738
24 Ga0081539_10007824 3300005985 Bacteria 9556
25 Ga0070717_10010747 3300006028 Bacteria 6929
26 Ga0070712_100143909 3300006175 Bacteria 1822
27 Ga0075428_101025873 3300006844 Bacteria 873
28 Ga0075433_10267206 3300006852 Bacteria 1516
29 Ga0105240_10007847 3300009093 Bacteria 15404
30 Ga0114129_11674657 3300009147 Bacteria 777
31 Ga0105241_11652236 3300009174 Bacteria 621
32 Ga0157373_10379025 3300013100 Bacteria 1012
33 Ga0157372_10765612 3300013307 Bacteria 1122
34 Ga0157375_10823437 3300013308 Bacteria 1076
35 Ga0182008_10005917 3300014497 Bacteria 6903
36 Ga0182008_10078679 3300014497 Unclassified 1622
37 Ga0182006_1034074 3300015261 Bacteria 2039
38 Ga0182007_10019668 3300015262 Bacteria 2424
39 Ga0197907_10562722 3300020069 Bacteria 3730
40 Ga0197907_11033777 3300020069 Bacteria 2017
41 Ga0206356_10226513 3300020070 Bacteria 3070
42 Ga0206356_10991689 3300020070 Unclassified 1022
43 Ga0206354_11233704 3300020081 Unclassified 1687
44 Ga0206353_10671812 3300020082 Bacteria 3587
45 Ga0207707_10039982 3300025912 Bacteria 4098
46 Ga0207693_10011954 3300025915 Bacteria 7018
47 Ga0207657_10213364 3300025919 Bacteria 1548
48 Ga0207652_10448854 3300025921 Bacteria 1163
49 Ga0207646_10005792 3300025922 Bacteria 12933
50 Ga0207700_10436290 3300025928 Bacteria 1152
51 Ga0207664_10040688 3300025929 Bacteria 3616
52 Ga0207664_10464301 3300025929 Bacteria 1131
53 Ga0207665_11035965 3300025939 Unclassified 653
54 Ga0207661_10004419 3300025944 Bacteria 9863
55 Ga0207674_11220333 3300026116 Unclassified 722
56 Ga0207698_10055419 3300026142 Bacteria 3056
57 Ga0207698_10794141 3300026142 Bacteria 948
58 Ga0265319_1004689 3300028563 Bacteria 6703
59 Ga0265334_10047852 3300028573 Bacteria 1648
60 Ga0265318_10031256 3300028577 Bacteria 2065
61 Ga0265323_10065544 3300028653 Bacteria 1253
62 Ga0265322_10032821 3300028654 Bacteria 1481
63 Ga0265336_10017413 3300028666 Bacteria 2340
64 Ga0265336_10110526 3300028666 Bacteria 818
65 Ga0265338_10046412 3300028800 Bacteria 3981
66 Ga0265338_10462992 3300028800 Bacteria 896
67 Ga0265330_10100186 3300031235 Bacteria 1240
68 Ga0265332_10046907 3300031238 Bacteria 1860
69 Ga0265328_10007818 3300031239 Bacteria 4443
70 Ga0265320_10110924 3300031240 Bacteria 1256
71 Ga0265325_10094584 3300031241 Bacteria 1469
72 Ga0265329_10019058 3300031242 Bacteria 2335
73 Ga0265340_10015524 3300031247 Bacteria 3955
74 Ga0265339_10082078 3300031249 Bacteria 1702
75 Ga0265331_10013307 3300031250 Bacteria 4429
76 Ga0265327_10017846 3300031251 Bacteria 4427
77 Ga0265316_10037566 3300031344 Bacteria 3907
78 Ga0265313_10034085 3300031595 Bacteria 2578
79 Ga0265314_10134363 3300031711 Bacteria 1538
80 Ga0265342_10298783 3300031712 Bacteria 848
81 Ga0307416_100092625 3300032002 Bacteria 2600
82 Ga0373936_0019153 3300035113 Bacteria 2651
83 Ga0373945_0001008 3300035116 Bacteria 8421
84 Ga0373943_0004768 3300035170 Bacteria 6129
85 Ga0373946_0003247 3300035171 Bacteria 5774
86 Ga0373924_0029846 3300035410 Bacteria 2182
87 Ga0373927_0049161 3300035695 Bacteria 2727
88 Ga0373947_0000371 3300035725 Bacteria 25349
89 Ga0373925_0001462 3300037068 Bacteria 20386
90 Ga0395899_0004110 3300037312 Bacteria 11460
91 Ga0395899_0365993 3300037312 Bacteria 961
92 Ga0395899_0451226 3300037312 Unclassified 842
93 Ga0395900_0005422 3300037418 Bacteria 13365
94 Ga0395900_0039480 3300037418 Bacteria 4864
95 Ga0395900_0151481 3300037418 Bacteria 2369
96 Ga0395900_0617861 3300037418 Bacteria 1023
97 Ga0395900_0743483 3300037418 Bacteria 911
98 Ga0395900_0786735 3300037418 Bacteria 880
99 Ga0395898_0002841 3300037466 Bacteria 19817
100 Ga0395898_0215278 3300037466 Bacteria 1832
101 Ga0395898_0407013 3300037466 Bacteria 1297
102 Ga0395905_0009789 3300037471 Bacteria 9345
103 Ga0395905_0014795 3300037471 Bacteria 7440
104 Ga0395901_0011543 3300038443 Bacteria 8952
105 Ga0395901_0195549 3300038443 Bacteria 2121
106 Ga0395901_0203554 3300038443 Bacteria 2074
107 Ga0395901_0478266 3300038443 Bacteria 1271
108 Ga0395901_0928384 3300038443 Bacteria 850
109 Ga0395901_1546235 3300038443 Bacteria 618
110 Ga0439448_0004528 3300042005 Bacteria 3926
111 Ga0439448_0024160 3300042005 Bacteria 1899
112 Ga0439458_0003286 3300042157 Bacteria 3814
113 Ga0439460_0131508 3300042461 Bacteria 825
114 Ga0466966_0014288 3300044684 Bacteria 5256
115 Ga0466966_0187594 3300044684 Bacteria 1253
116 Ga0466961_0241965 3300044693 Bacteria 1109
117 Ga0466961_0429259 3300044693 Bacteria 800
118 Ga0466963_0011538 3300044694 Bacteria 5381
119 Ga0466963_0095923 3300044694 Bacteria 2025
120 Ga0466963_0140075 3300044694 Bacteria 1675
121 Ga0466964_0037669 3300044706 Bacteria 1943
122 Ga0466971_0002625 3300044719 Bacteria 7605
123 Ga0466971_0005657 3300044719 Bacteria 5431
124 Ga0466957_0015071 3300044842 Bacteria 4511
125 Ga0466957_0182414 3300044842 Unclassified 1371
126 Ga0466957_0196079 3300044842 Bacteria 1325
127 Ga0466959_0009826 3300045049 Bacteria 6817
128 Ga0466959_0183327 3300045049 Bacteria 1463
129 Ga0466958_0004148 3300045836 Bacteria 7607
130 Ga0466958_0008006 3300045836 Bacteria 5844
131 Ga0466958_0172906 3300045836 Bacteria 1368
132 Ga0466967_0029031 3300045976 Bacteria 4624
133 Ga0466967_0037494 3300045976 Bacteria 4149
134 Ga0466967_0057036 3300045976 Unclassified 3446
135 Ga0466967_0104355 3300045976 Bacteria 2595
136 Ga0466967_0171012 3300045976 Bacteria 2044
137 Ga0466967_0195723 3300045976 Bacteria 1912
138 Ga0466967_0888899 3300045976 Bacteria 886
139 Ga0495592_0084271 3300046454 Bacteria 2294
140 Ga0495603_0004590 3300046455 Bacteria 8240
141 Ga0495629_0006824 3300046459 Bacteria 8441
142 Ga0495641_0005829 3300046461 Bacteria 8165
143 Ga0495651_0271500 3300046462 Bacteria 1149
144 Ga0495580_0023209 3300046472 Bacteria 4558
145 Ga0495582_0003512 3300046473 Bacteria 8836
146 Ga0495582_0033336 3300046473 Bacteria 2831
147 Ga0495639_0000481 3300046475 Bacteria 19003
148 Ga0495662_0000359 3300046476 Bacteria 20037
149 Ga0495664_0006065 3300046477 Bacteria 6664
150 Ga0495608_0310158 3300046511 Bacteria 976
151 Ga0495618_0038173 3300046514 Bacteria 3017
152 Ga0495630_0000995 3300046517 Bacteria 19714
153 Ga0495666_0000688 3300046526 Bacteria 15346
154 Ga0495652_0008136 3300046529 Bacteria 9590
155 Ga0495665_0004703 3300046531 Bacteria 7364
156 Ga0495640_0014224 3300046533 Bacteria 6030
157 Ga0495667_0054069 3300046559 Bacteria 2643
158 Ga0495635_0108056 3300046663 Bacteria 1900
159 Ga0495599_0178756 3300046678 Bacteria 1308
160 Ga0495646_0109221 3300046680 Bacteria 1576
161 Ga0495647_0000670 3300046681 Bacteria 10187
162 Ga0495600_0172377 3300046809 Bacteria 1396
163 Ga0495581_0010524 3300047315 Bacteria 5346
164 Ga0495674_0031724 3300047319 Unclassified 4796
165 Ga0495674_0135852 3300047319 Bacteria 2069
166 Ga0495676_0019630 3300047321 Bacteria 5942
167 Ga0495680_0020304 3300047322 Bacteria 5592
168 Ga0495684_0012195 3300047471 Bacteria 6630
169 Ga0495593_0001863 3300047673 Bacteria 12556
170 Ga0496103_0025489 3300048906 Bacteria 3575
171 Ga0496104_1406468 3300048907 Bacteria 601
172 Ga0496106_0125716 3300048909 Bacteria 2007
173 Ga0496107_0000242 3300048910 Bacteria 28631
174 Ga0496108_0801951 3300048911 Bacteria 812
175 Ga0496109_0407430 3300048912 Bacteria 1285
176 Ga0496111_0375507 3300048914 Bacteria 1052
177 Ga0496112_0216503 3300048915 Bacteria 1872
178 Ga0501067_0077620 3300049583 Unclassified 1840
179 Ga0501069_0020825 3300049585 Bacteria 3556
180 nmdc:mga09592_815397_c1 3300050508 Bacteria 789
181 nmdc:mga0n895_412555_c1 3300050512 Bacteria 1365
182 nmdc:mga0a205_189985_c1 3300050515 Bacteria 1946
183 Ga0495601_0005907 3300053077 Bacteria 7136
184 Ga0495612_0000854 3300053078 Bacteria 12373
185 Ga0495619_0006918 3300053085 Bacteria 7171
186 Ga0500566_0010037 3300053094 Bacteria 5587
187 Ga0500608_206842 3300053122 Bacteria 806
188 Ga0466962_0003677 3300061719 Bacteria 7311
189 Ga0466962_0010778 3300061719 Bacteria 4392
190 Ga0395901_0682420
191 Ga0070683_100009662
192 Ga0070660_100168287
193 Ga0070714_100008658
194 Ga0070714_100450177
195 Ga0070714_101216340
196 Ga0070713_100015975
197 Ga0070708_100601915
198 Ga0070681_10119553
199 Ga0070707_100002679
200 Ga0070679_100885545
201 Ga0070684_100068643
202 Ga0070697_100177093
203 Ga0070695_100169785
204 Ga0070696_100054211
205 Ga0068857_101574271
206 Ga0068856_100169621
207 Ga0068856_100504284
208 Ga0068852_100145400
209 Ga0081455_10004114
210 Ga0081455_10123898
211 Ga0081540_1014320
212 Ga0081540_1015922
213 Ga0081539_10007824
214 Ga0070717_10010747
215 Ga0070712_100143909
216 Ga0075428_101025873
217 Ga0075433_10267206
218 Ga0105240_10007847
219 Ga0114129_11674657
220 Ga0105241_11652236
221 Ga0157373_10379025
222 Ga0157372_10765612
223 Ga0157375_10823437
224 Ga0182008_10005917
225 Ga0182008_10078679
226 Ga0182006_1034074
227 Ga0182007_10019668
228 Ga0197907_10562722
229 Ga0197907_11033777
230 Ga0206356_10226513
231 Ga0206356_10991689
232 Ga0206354_11233704
233 Ga0206353_10671812
234 Ga0207707_10039982
235 Ga0207693_10011954
236 Ga0207657_10213364
237 Ga0207652_10448854
238 Ga0207646_10005792
239 Ga0207700_10436290
240 Ga0207664_10040688
241 Ga0207664_10464301
242 Ga0207665_11035965
243 Ga0207661_10004419
244 Ga0207674_11220333
245 Ga0207698_10055419
246 Ga0207698_10794141
247 Ga0265319_1004689
248 Ga0265334_10047852
249 Ga0265318_10031256
250 Ga0265323_10065544
251 Ga0265322_10032821
252 Ga0265336_10017413
253 Ga0265336_10110526
254 Ga0265338_10046412
255 Ga0265338_10462992
256 Ga0265330_10100186
257 Ga0265332_10046907
258 Ga0265328_10007818
259 Ga0265320_10110924
260 Ga0265325_10094584
261 Ga0265329_10019058
262 Ga0265340_10015524
263 Ga0265339_10082078
264 Ga0265331_10013307
265 Ga0265327_10017846
266 Ga0265316_10037566
267 Ga0265313_10034085
268 Ga0265314_10134363
269 Ga0265342_10298783
270 Ga0307416_100092625
271 Ga0373936_0019153
272 Ga0373945_0001008
273 Ga0373943_0004768
274 Ga0373946_0003247
275 Ga0373924_0029846
276 Ga0373927_0049161
277 Ga0373947_0000371
278 Ga0373925_0001462
279 Ga0395899_0004110
280 Ga0395899_0365993
281 Ga0395899_0451226
282 Ga0395900_0005422
283 Ga0395900_0039480
284 Ga0395900_0151481
285 Ga0395900_0617861
286 Ga0395900_0743483
287 Ga0395900_0786735
288 Ga0395898_0002841
289 Ga0395898_0215278
290 Ga0395898_0407013
291 Ga0395905_0009789
292 Ga0395905_0014795
293 Ga0395901_0011543
294 Ga0395901_0195549
295 Ga0395901_0203554
296 Ga0395901_0478266
297 Ga0395901_0928384
298 Ga0395901_1546235
299 Ga0439448_0004528
300 Ga0439448_0024160
301 Ga0439458_0003286
302 Ga0439460_0131508
303 Ga0466966_0014288
304 Ga0466966_0187594
305 Ga0466961_0241965
306 Ga0466961_0429259
307 Ga0466963_0011538
308 Ga0466963_0095923
309 Ga0466963_0140075
310 Ga0466964_0037669
311 Ga0466971_0002625
312 Ga0466971_0005657
313 Ga0466957_0015071
314 Ga0466957_0182414
315 Ga0466957_0196079
316 Ga0466959_0009826
317 Ga0466959_0183327
318 Ga0466958_0004148
319 Ga0466958_0008006
320 Ga0466958_0172906
321 Ga0466967_0029031
322 Ga0466967_0037494
323 Ga0466967_0057036
324 Ga0466967_0104355
325 Ga0466967_0171012
326 Ga0466967_0195723
327 Ga0466967_0888899
328 Ga0495592_0084271
329 Ga0495603_0004590
330 Ga0495629_0006824
331 Ga0495641_0005829
332 Ga0495651_0271500
333 Ga0495580_0023209
334 Ga0495582_0003512
335 Ga0495582_0033336
336 Ga0495639_0000481
337 Ga0495662_0000359
338 Ga0495664_0006065
339 Ga0495608_0310158
340 Ga0495618_0038173
341 Ga0495630_0000995
342 Ga0495666_0000688
343 Ga0495652_0008136
344 Ga0495665_0004703
345 Ga0495640_0014224
346 Ga0495667_0054069
347 Ga0495635_0108056
348 Ga0495599_0178756
349 Ga0495646_0109221
350 Ga0495647_0000670
351 Ga0495600_0172377
352 Ga0495581_0010524
353 Ga0495674_0031724
354 Ga0495674_0135852
355 Ga0495676_0019630
356 Ga0495680_0020304
357 Ga0495684_0012195
358 Ga0495593_0001863
359 Ga0496103_0025489
360 Ga0496104_1406468
361 Ga0496106_0125716
362 Ga0496107_0000242
363 Ga0496108_0801951
364 Ga0496109_0407430
365 Ga0496111_0375507
366 Ga0496112_0216503
367 Ga0501067_0077620
368 Ga0501069_0020825
369 nmdc:mga09592_815397_c1
370 nmdc:mga0n895_412555_c1
371 nmdc:mga0a205_189985_c1
372 Ga0495601_0005907
373 Ga0495612_0000854
374 Ga0495619_0006918
375 Ga0500566_0010037
376 Ga0500608_206842
377 Ga0466962_0003677
378 Ga0466962_0010778

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

34

184

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zbp-assembly1.cif.gz_A crystal structure of the ampcpr-bound atnudt7 0.7937 106 183
1s60-assembly1.cif.gz_A-2 aminoglycoside n-acetyltransferase aac(6')-iy in complex with coa and n-terminal his(6)-tag (crystal form 2) 0.7785 2 141
4zbp-assembly1.cif.gz_B crystal structure of the ampcpr-bound atnudt7 0.7713 101 183
3f8k-assembly1.cif.gz_A crystal structure of protein acetyltransferase (pat) from sulfolobus solfataricus 0.7594 4 184
7r6o-assembly2.cif.gz_D-2 pyrrolysyl-trna synthetase from methanogenic archaeon iso4-g1 (g1pylrs) 0.7578 68 85
ID Description Score Start End Superfamily
2pkhA01 Alpha Beta;3-Layer(aba) Sandwich;Chorismate lyase;Chorismate lyase-like 0.8352 68 83 3.40.1410.10
af_A0A1D6LYK2_621_771_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8323 68 138 3.40.630.30
af_K7LHF0_767_874_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8228 70 138 3.40.630.30
af_A0A0P0WGU7_189_301_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8142 70 138 3.40.630.30
af_Q2FWC9_161_285_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8123 68 183 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A537AIJ3-F1-model_v4 GNAT family N-acetyltransferase 0.9557 64 183 GO:0016747
AF-A0A538MAU7-F1-model_v4 GNAT family N-acetyltransferase 0.9495 2 184 GO:0016747
AF-A0A238X637-F1-model_v4 Acetyltransferase (GNAT) family protein 0.9416 2 184 GO:0016747
AF-A0A538MAU7-F1-model_v4 GNAT family N-acetyltransferase 0.9394 2 184 GO:0016747
AF-A0A538HSN2-F1-model_v4 GNAT family N-acetyltransferase 0.9359 51 183 GO:0016747

Map