F291159

General Info

Members Datasets Scaffolds Average Seq Length
189 96 378 170

Family's Representative Sequence

Representative Sequence 3300031250|Ga0265331_10096107|Ga0265331_100961072
Length 200
Sequence MWGGIFRAGKTGLSGVQFAFPVRGAILPLIQDMANSLKCDLCSKPATVHLTQIVNNKIHKVDLCEACAQAKGVTDPSGFSLADLLLKASLNPEPAGDARCESCGFTQQDFKKTGRFGCPSCYNHFGNLLEPMLDTMHKGIAHTGKIPQRALARRSLYERLTQLETELDQAIKAERYEDAARYRDEISQVRSATGLQPKED

Samples

Sample ID Description Type Environment
1 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
15 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
16 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
17 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
18 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
19 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
20 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
23 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
40 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
41 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
42 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
43 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
44 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
45 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
46 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
47 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
48 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
49 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
50 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
51 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
52 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
53 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
54 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
55 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
56 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
57 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
58 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
59 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
60 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
61 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
62 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
63 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
64 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
65 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
66 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
67 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
68 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
69 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
70 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
71 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
72 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
73 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
74 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
75 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
76 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
77 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
78 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
81 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
82 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
85 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
86 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
87 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
88 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
89 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
90 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
91 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
92 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
93 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
94 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
95 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
96 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.06
Isolates 0.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 94.18
Stem 0
Stem Tuber 0
Unclassified 2.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265331_10096107 3300031250 Bacteria 1367
2 rootH2_10020978 3300003320 Bacteria 4233
3 rootH2_10043567 3300003320 Bacteria 3704
4 rootH2_10253592 3300003320 Bacteria 1614
5 rootL2_10013302 3300003322 Bacteria 2617
6 rootL2_10215901 3300003322 Bacteria 4670
7 rootH1_10295887 3300003323 Bacteria 2092
8 Ga0058861_11060841 3300004800 Bacteria 630
9 Ga0070683_100001789 3300005329 Bacteria 16745
10 Ga0070683_100035756 3300005329 Bacteria 4541
11 Ga0068869_100000022 3300005334 Bacteria 65017
12 Ga0068868_100078115 3300005338 Bacteria 2649
13 Ga0070713_100005481 3300005436 Bacteria 8681
14 Ga0068867_100014127 3300005459 Bacteria 5657
15 Ga0070679_100258597 3300005530 Bacteria 1696
16 Ga0068855_100593659 3300005563 Bacteria 1195
17 Ga0068857_100023523 3300005577 Bacteria 5424
18 Ga0068856_100030988 3300005614 Bacteria 5231
19 Ga0068856_100103069 3300005614 Bacteria 2847
20 Ga0068863_100236976 3300005841 Bacteria 1761
21 Ga0070717_10000693 3300006028 Bacteria 21709
22 Ga0070712_100306918 3300006175 Bacteria 1286
23 Ga0097621_100044612 3300006237 Bacteria 3577
24 Ga0068871_100005705 3300006358 Bacteria 8738
25 Ga0068865_100054630 3300006881 Bacteria 2776
26 Ga0105243_10116864 3300009148 Bacteria 2241
27 Ga0105238_11701629 3300009551 Bacteria 662
28 Ga0157369_10214062 3300013105 Bacteria 2019
29 Ga0157372_12123150 3300013307 Unclassified 645
30 Ga0163163_10494209 3300014325 Bacteria 1285
31 Ga0163163_10594048 3300014325 Unclassified 1170
32 Ga0157379_10600112 3300014968 Bacteria 1028
33 Ga0206356_10006958 3300020070 Bacteria 3953
34 Ga0207652_10274731 3300025921 Bacteria 1520
35 Ga0207700_10003889 3300025928 Bacteria 8725
36 Ga0207704_10022781 3300025938 Bacteria 3363
37 Ga0207689_10000350 3300025942 Bacteria 43132
38 Ga0207661_10007969 3300025944 Bacteria 7551
39 Ga0207667_10591230 3300025949 Bacteria 1120
40 Ga0207677_10103363 3300026023 Bacteria 2103
41 Ga0207702_10002687 3300026078 Bacteria 16698
42 Ga0207648_10022302 3300026089 Bacteria 5689
43 Ga0207674_10218646 3300026116 Bacteria 1853
44 Ga0207683_10120542 3300026121 Bacteria 2354
45 Ga0207683_10259400 3300026121 Bacteria 1587
46 Ga0265337_1010022 3300028556 Bacteria 3343
47 Ga0265319_1000189 3300028563 Bacteria 46797
48 Ga0265319_1000928 3300028563 Bacteria 18370
49 Ga0265319_1004789 3300028563 Bacteria 6636
50 Ga0265319_1005676 3300028563 Bacteria 5927
51 Ga0265319_1025283 3300028563 Bacteria 2127
52 Ga0265334_10005000 3300028573 Bacteria 5827
53 Ga0265334_10007384 3300028573 Bacteria 4713
54 Ga0265318_10000007 3300028577 Bacteria 280699
55 Ga0265318_10000936 3300028577 Bacteria 18877
56 Ga0265318_10001081 3300028577 Bacteria 17122
57 Ga0265318_10004503 3300028577 Bacteria 6742
58 Ga0265318_10012475 3300028577 Bacteria 3617
59 Ga0265318_10024295 3300028577 Bacteria 2405
60 Ga0265318_10044677 3300028577 Bacteria 1676
61 Ga0265318_10093535 3300028577 Bacteria 1107
62 Ga0265323_10000053 3300028653 Bacteria 62400
63 Ga0265323_10006772 3300028653 Bacteria 4799
64 Ga0265323_10025516 3300028653 Bacteria 2235
65 Ga0265323_10040780 3300028653 Bacteria 1687
66 Ga0265322_10000856 3300028654 Bacteria 10835
67 Ga0265322_10001159 3300028654 Bacteria 9054
68 Ga0265322_10046713 3300028654 Bacteria 1231
69 Ga0265336_10048826 3300028666 Unclassified 1282
70 Ga0307515_10078271 3300028794 Bacteria 4351
71 Ga0265338_10000722 3300028800 Bacteria 56495
72 Ga0265338_10003379 3300028800 Bacteria 22532
73 Ga0265338_10007936 3300028800 Bacteria 13003
74 Ga0265338_10377179 3300028800 Bacteria 1015
75 Ga0265324_10003909 3300029957 Bacteria 6936
76 Ga0265324_10064042 3300029957 Bacteria 1255
77 Ga0265324_10212239 3300029957 Bacteria 657
78 Ga0265330_10017485 3300031235 Bacteria 3301
79 Ga0265330_10042255 3300031235 Bacteria 2021
80 Ga0265330_10153252 3300031235 Bacteria 979
81 Ga0265330_10167496 3300031235 Bacteria 932
82 Ga0265330_10174417 3300031235 Bacteria 911
83 Ga0265332_10028770 3300031238 Bacteria 2431
84 Ga0265332_10094277 3300031238 Bacteria 1265
85 Ga0265332_10104714 3300031238 Bacteria 1193
86 Ga0265328_10023204 3300031239 Bacteria 2356
87 Ga0265328_10067958 3300031239 Bacteria 1309
88 Ga0265320_10002140 3300031240 Bacteria 13860
89 Ga0265320_10002997 3300031240 Bacteria 11533
90 Ga0265320_10004016 3300031240 Bacteria 9681
91 Ga0265320_10009508 3300031240 Bacteria 5860
92 Ga0265320_10017181 3300031240 Bacteria 4027
93 Ga0265320_10020017 3300031240 Bacteria 3640
94 Ga0265320_10031018 3300031240 Bacteria 2749
95 Ga0265320_10102774 3300031240 Bacteria 1315
96 Ga0265325_10004027 3300031241 Bacteria 9385
97 Ga0265340_10045859 3300031247 Bacteria 2133
98 Ga0265339_10033815 3300031249 Bacteria 2876
99 Ga0265339_10087209 3300031249 Bacteria 1641
100 Ga0265331_10001298 3300031250 Bacteria 18592
101 Ga0265331_10083973 3300031250 Bacteria 1476
102 Ga0265327_10000057 3300031251 Bacteria 242754
103 Ga0265327_10001936 3300031251 Bacteria 23873
104 Ga0265327_10012628 3300031251 Bacteria 5682
105 Ga0265327_10044077 3300031251 Bacteria 2381
106 Ga0265316_10005564 3300031344 Bacteria 12212
107 Ga0265316_10029701 3300031344 Bacteria 4490
108 Ga0265316_10043173 3300031344 Bacteria 3597
109 Ga0265316_10064911 3300031344 Bacteria 2827
110 Ga0265316_10112509 3300031344 Bacteria 2060
111 Ga0265316_10181818 3300031344 Bacteria 1565
112 Ga0265316_10209153 3300031344 Bacteria 1444
113 Ga0265316_10257658 3300031344 Bacteria 1280
114 Ga0265316_10289558 3300031344 Bacteria 1195
115 Ga0265316_10402978 3300031344 Bacteria 985
116 Ga0265316_10433371 3300031344 Bacteria 944
117 Ga0265316_10580566 3300031344 Bacteria 796
118 Ga0307513_10745911 3300031456 Bacteria 685
119 Ga0307509_10505044 3300031507 Bacteria 893
120 Ga0307408_100000032 3300031548 Bacteria 213693
121 Ga0265313_10000235 3300031595 Bacteria 60074
122 Ga0265313_10000695 3300031595 Bacteria 34649
123 Ga0265313_10001806 3300031595 Bacteria 19570
124 Ga0265313_10145770 3300031595 Bacteria 1015
125 Ga0307508_10000054 3300031616 Bacteria 127800
126 Ga0265314_10002124 3300031711 Bacteria 20793
127 Ga0265314_10006105 3300031711 Bacteria 10706
128 Ga0265314_10011912 3300031711 Bacteria 7140
129 Ga0265314_10015863 3300031711 Bacteria 5966
130 Ga0265314_10217615 3300031711 Bacteria 1117
131 Ga0265342_10005920 3300031712 Bacteria 9210
132 Ga0265342_10034161 3300031712 Bacteria 3121
133 Ga0265342_10061184 3300031712 Bacteria 2219
134 Ga0307413_10746000 3300031824 Bacteria 818
135 Ga0307410_10000013 3300031852 Bacteria 76345
136 Ga0307412_10016329 3300031911 Bacteria 4421
137 Ga0307409_100000031 3300031995 Bacteria 48910
138 Ga0307416_100000038 3300032002 Bacteria 136704
139 Ga0307414_10163346 3300032004 Bacteria 1772
140 Ga0307414_10446031 3300032004 Bacteria 1134
141 Ga0307411_10330199 3300032005 Bacteria 1235
142 Ga0373960_0132538 3300035121 Bacteria 837
143 Ga0373935_0091981 3300035692 Bacteria 1987
144 Ga0373933_0112265 3300035724 Bacteria 1701
145 Ga0395905_0000015 3300037471 Bacteria 393880
146 Ga0436361_1007654 3300039447 Bacteria 677
147 Ga0439431_0038236 3300041997 Bacteria 1214
148 Ga0439445_0003194 3300042004 Bacteria 3675
149 Ga0451577_0000012 3300042876 Bacteria 575467
150 Ga0451577_0093995 3300042876 Bacteria 2678
151 Ga0451577_0152426 3300042876 Bacteria 2080
152 Ga0451577_0289215 3300042876 Bacteria 1485
153 Ga0451577_0545964 3300042876 Bacteria 1052
154 Ga0451577_1050106 3300042876 Bacteria 730
155 Ga0453683_0004108 3300044673 Bacteria 10461
156 Ga0453683_0184068 3300044673 Bacteria 1325
157 Ga0453684_0039285 3300044712 Bacteria 6452
158 Ga0453684_0081828 3300044712 Bacteria 4025
159 Ga0453684_0135272 3300044712 Bacteria 2952
160 Ga0453684_0527086 3300044712 Bacteria 1304
161 Ga0453684_1455473 3300044712 Bacteria 708
162 Ga0451576_0000206 3300045051 Bacteria 147691
163 Ga0451576_0002143 3300045051 Bacteria 30592
164 Ga0451576_0014686 3300045051 Bacteria 8706
165 Ga0451576_0062493 3300045051 Bacteria 3882
166 Ga0451576_0071932 3300045051 Bacteria 3599
167 Ga0451576_0341052 3300045051 Bacteria 1569
168 Ga0451576_0819069 3300045051 Bacteria 977
169 Ga0495651_0508745 3300046462 Bacteria 770
170 Ga0495599_0485939 3300046678 Unclassified 728
171 Ga0501032_0002023 3300049569 Bacteria 15991
172 Ga0501032_0120230 3300049569 Bacteria 1736
173 Ga0501033_0001477 3300049570 Bacteria 20806
174 Ga0501034_0337670 3300049571 Bacteria 1437
175 Ga0501037_0035916 3300049573 Bacteria 3652
176 Ga0501043_0019209 3300049579 Bacteria 5365
177 Ga0501046_0004321 3300049580 Bacteria 12932
178 Ga0501046_0020250 3300049580 Bacteria 5505
179 Ga0501046_0107406 3300049580 Bacteria 2135
180 Ga0501047_0023587 3300049581 Bacteria 5905
181 Ga0501047_0037681 3300049581 Bacteria 4676
182 Ga0501047_0042174 3300049581 Bacteria 4410
183 Ga0501073_0322801 3300049589 Bacteria 1066
184 Ga0501243_002354 3300049675 Bacteria 2760
185 Ga0501035_0012755 3300049822 Bacteria 7765
186 Ga0501035_0049442 3300049822 Bacteria 3768
187 Ga0501044_0004247 3300049823 Bacteria 16083
188 Ga0501044_0022357 3300049823 Bacteria 6740
189 2788436664 2786546940 Bacteria 6396474
190 Ga0265331_10096107
191 rootH2_10020978
192 rootH2_10043567
193 rootH2_10253592
194 rootL2_10013302
195 rootL2_10215901
196 rootH1_10295887
197 Ga0058861_11060841
198 Ga0070683_100001789
199 Ga0070683_100035756
200 Ga0068869_100000022
201 Ga0068868_100078115
202 Ga0070713_100005481
203 Ga0068867_100014127
204 Ga0070679_100258597
205 Ga0068855_100593659
206 Ga0068857_100023523
207 Ga0068856_100030988
208 Ga0068856_100103069
209 Ga0068863_100236976
210 Ga0070717_10000693
211 Ga0070712_100306918
212 Ga0097621_100044612
213 Ga0068871_100005705
214 Ga0068865_100054630
215 Ga0105243_10116864
216 Ga0105238_11701629
217 Ga0157369_10214062
218 Ga0157372_12123150
219 Ga0163163_10494209
220 Ga0163163_10594048
221 Ga0157379_10600112
222 Ga0206356_10006958
223 Ga0207652_10274731
224 Ga0207700_10003889
225 Ga0207704_10022781
226 Ga0207689_10000350
227 Ga0207661_10007969
228 Ga0207667_10591230
229 Ga0207677_10103363
230 Ga0207702_10002687
231 Ga0207648_10022302
232 Ga0207674_10218646
233 Ga0207683_10120542
234 Ga0207683_10259400
235 Ga0265337_1010022
236 Ga0265319_1000189
237 Ga0265319_1000928
238 Ga0265319_1004789
239 Ga0265319_1005676
240 Ga0265319_1025283
241 Ga0265334_10005000
242 Ga0265334_10007384
243 Ga0265318_10000007
244 Ga0265318_10000936
245 Ga0265318_10001081
246 Ga0265318_10004503
247 Ga0265318_10012475
248 Ga0265318_10024295
249 Ga0265318_10044677
250 Ga0265318_10093535
251 Ga0265323_10000053
252 Ga0265323_10006772
253 Ga0265323_10025516
254 Ga0265323_10040780
255 Ga0265322_10000856
256 Ga0265322_10001159
257 Ga0265322_10046713
258 Ga0265336_10048826
259 Ga0307515_10078271
260 Ga0265338_10000722
261 Ga0265338_10003379
262 Ga0265338_10007936
263 Ga0265338_10377179
264 Ga0265324_10003909
265 Ga0265324_10064042
266 Ga0265324_10212239
267 Ga0265330_10017485
268 Ga0265330_10042255
269 Ga0265330_10153252
270 Ga0265330_10167496
271 Ga0265330_10174417
272 Ga0265332_10028770
273 Ga0265332_10094277
274 Ga0265332_10104714
275 Ga0265328_10023204
276 Ga0265328_10067958
277 Ga0265320_10002140
278 Ga0265320_10002997
279 Ga0265320_10004016
280 Ga0265320_10009508
281 Ga0265320_10017181
282 Ga0265320_10020017
283 Ga0265320_10031018
284 Ga0265320_10102774
285 Ga0265325_10004027
286 Ga0265340_10045859
287 Ga0265339_10033815
288 Ga0265339_10087209
289 Ga0265331_10001298
290 Ga0265331_10083973
291 Ga0265327_10000057
292 Ga0265327_10001936
293 Ga0265327_10012628
294 Ga0265327_10044077
295 Ga0265316_10005564
296 Ga0265316_10029701
297 Ga0265316_10043173
298 Ga0265316_10064911
299 Ga0265316_10112509
300 Ga0265316_10181818
301 Ga0265316_10209153
302 Ga0265316_10257658
303 Ga0265316_10289558
304 Ga0265316_10402978
305 Ga0265316_10433371
306 Ga0265316_10580566
307 Ga0307513_10745911
308 Ga0307509_10505044
309 Ga0307408_100000032
310 Ga0265313_10000235
311 Ga0265313_10000695
312 Ga0265313_10001806
313 Ga0265313_10145770
314 Ga0307508_10000054
315 Ga0265314_10002124
316 Ga0265314_10006105
317 Ga0265314_10011912
318 Ga0265314_10015863
319 Ga0265314_10217615
320 Ga0265342_10005920
321 Ga0265342_10034161
322 Ga0265342_10061184
323 Ga0307413_10746000
324 Ga0307410_10000013
325 Ga0307412_10016329
326 Ga0307409_100000031
327 Ga0307416_100000038
328 Ga0307414_10163346
329 Ga0307414_10446031
330 Ga0307411_10330199
331 Ga0373960_0132538
332 Ga0373935_0091981
333 Ga0373933_0112265
334 Ga0395905_0000015
335 Ga0436361_1007654
336 Ga0439431_0038236
337 Ga0439445_0003194
338 Ga0451577_0000012
339 Ga0451577_0093995
340 Ga0451577_0152426
341 Ga0451577_0289215
342 Ga0451577_0545964
343 Ga0451577_1050106
344 Ga0453683_0004108
345 Ga0453683_0184068
346 Ga0453684_0039285
347 Ga0453684_0081828
348 Ga0453684_0135272
349 Ga0453684_0527086
350 Ga0453684_1455473
351 Ga0451576_0000206
352 Ga0451576_0002143
353 Ga0451576_0014686
354 Ga0451576_0062493
355 Ga0451576_0071932
356 Ga0451576_0341052
357 Ga0451576_0819069
358 Ga0495651_0508745
359 Ga0495599_0485939
360 Ga0501032_0002023
361 Ga0501032_0120230
362 Ga0501033_0001477
363 Ga0501034_0337670
364 Ga0501037_0035916
365 Ga0501043_0019209
366 Ga0501046_0004321
367 Ga0501046_0020250
368 Ga0501046_0107406
369 Ga0501047_0023587
370 Ga0501047_0037681
371 Ga0501047_0042174
372 Ga0501073_0322801
373 Ga0501243_002354
374 Ga0501035_0012755
375 Ga0501035_0049442
376 Ga0501044_0004247
377 Ga0501044_0022357
378 2788436664

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02151

UVR

UvrB/uvrC motif

158

192

0.94

Map