F290694

General Info

Members Datasets Scaffolds Average Seq Length
189 141 378 210

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10033838|Ga0081455_100338384
Length 224
Sequence MNTDELAAALSRHVEPVDRRLIRRSVGLALVAAFILALGLMAVSLGVRADLMTAHAAVFLVGKVAFAIAIVGIALIYLLRLARPGGEHKVTSRWPVAPFAAAILLAAVSLAFSPSSHWNGMILGDEWLECLLSIPIIAIVPFAVLVWAVRQAAPTNLVRTGAFTGLVAGGVSALAYALHCTTDSLPFVAVWYGGTIVLCTVAGAALGPRLLRWGSQIWTRFTSA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
8 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
17 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
18 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
19 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
20 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
21 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
22 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
23 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
24 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
25 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
27 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
30 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
31 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
32 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
33 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
34 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
35 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
38 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
55 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
56 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
57 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
58 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
59 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
60 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
61 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
62 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
63 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
64 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
65 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
66 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
67 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
68 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
69 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
70 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
71 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
72 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
73 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
74 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
77 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
82 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
83 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
84 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
85 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
86 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
87 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
88 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
89 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
90 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
93 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
94 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
95 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
96 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
97 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
98 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
99 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
100 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
101 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
102 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
103 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
104 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
105 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
106 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
107 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
109 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
110 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
111 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
112 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
113 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
114 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
115 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
116 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
117 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
118 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
119 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
120 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
121 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
122 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
123 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
124 2643221651 Afipia sp. Root123D2 Isolate Unclassified
125 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
126 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
127 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
128 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
129 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
130 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
131 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
132 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
133 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
134 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
135 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
136 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
137 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
138 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
139 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
140 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
141 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 88.89
Metatranscriptomes 0
Isolates 11.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.58
Nodule 8.99
Rhizoplane 2.65
Rhizosphere 69.31
Stem 0
Stem Tuber 0
Unclassified 1.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10033838 3300005937 Bacteria 4586
2 JGI25406J46586_10001843 3300003203 Bacteria 9956
3 Ga0070683_100030299 3300005329 Bacteria 4909
4 Ga0070714_100319112 3300005435 Bacteria 1452
5 Ga0070713_100026400 3300005436 Bacteria 4558
6 Ga0070705_100539518 3300005440 Bacteria 892
7 Ga0070708_100047860 3300005445 Plasmid 3778
8 Ga0070681_10025551 3300005458 Bacteria 5941
9 Ga0070681_10055296 3300005458 Bacteria 3952
10 Ga0070706_100005784 3300005467 Bacteria 11748
11 Ga0070706_100125845 3300005467 Bacteria 2390
12 Ga0070706_100185644 3300005467 Bacteria 1943
13 Ga0070706_100485191 3300005467 Bacteria 1150
14 Ga0070706_100543925 3300005467 Bacteria 1080
15 Ga0070706_100595468 3300005467 Bacteria 1027
16 Ga0070707_100257834 3300005468 Bacteria 1697
17 Ga0070698_100030554 3300005471 Bacteria 5585
18 Ga0070698_100105500 3300005471 Bacteria 2788
19 Ga0070698_100211078 3300005471 Bacteria 1876
20 Ga0070698_100484230 3300005471 Bacteria 1174
21 Ga0070699_100277706 3300005518 Bacteria 1500
22 Ga0070699_100562638 3300005518 Bacteria 1038
23 Ga0070679_100177638 3300005530 Bacteria 2102
24 Ga0070684_100031392 3300005535 Bacteria 4522
25 Ga0070697_100000527 3300005536 Bacteria 28763
26 Ga0070697_100117989 3300005536 Bacteria 2217
27 Ga0070697_100170273 3300005536 Bacteria 1843
28 Ga0070697_100316072 3300005536 Bacteria 1344
29 Ga0068854_100057399 3300005578 Bacteria 2808
30 Ga0068859_100021141 3300005617 Bacteria 6530
31 Ga0081455_10009434 3300005937 Bacteria 10039
32 Ga0081455_10013430 3300005937 Bacteria 8095
33 Ga0081455_10021425 3300005937 Bacteria 6063
34 Ga0081455_10085930 3300005937 Bacteria 2563
35 Ga0081539_10000848 3300005985 Bacteria 58499
36 Ga0070717_10004619 3300006028 Bacteria 9978
37 Ga0070717_10556127 3300006028 Bacteria 1039
38 Ga0075364_10105165 3300006051 Bacteria 1881
39 Ga0070712_100478407 3300006175 Bacteria 1041
40 Ga0075367_10049710 3300006178 Bacteria 2472
41 Ga0075366_10010627 3300006195 Bacteria 5170
42 Ga0075366_10404405 3300006195 Bacteria 840
43 Ga0097621_100190481 3300006237 Bacteria 1776
44 Ga0097620_100021141 3300006931 Bacteria 6530
45 Ga0099794_10008844 3300007265 Bacteria 4197
46 Ga0099794_10019288 3300007265 Bacteria 3069
47 Ga0099794_10025564 3300007265 Bacteria 2722
48 Ga0099794_10035466 3300007265 Bacteria 2354
49 Ga0099794_10040181 3300007265 Bacteria 2223
50 Ga0099794_10044488 3300007265 Bacteria 2122
51 Ga0099794_10175482 3300007265 Bacteria 1093
52 Ga0099794_10218821 3300007265 Unclassified 978
53 Ga0099795_10157982 3300007788 Bacteria 933
54 Ga0105240_10329686 3300009093 Bacteria 1737
55 Ga0114129_10309008 3300009147 Bacteria 2105
56 Ga0105241_10010001 3300009174 Bacteria 6966
57 Ga0105238_10047806 3300009551 Bacteria 4313
58 Ga0105238_10436981 3300009551 Bacteria 1305
59 Ga0099796_10007003 3300010159 Bacteria 2922
60 Ga0099796_10024338 3300010159 Bacteria 1900
61 Ga0099796_10033411 3300010159 Bacteria 1692
62 Ga0099796_10062704 3300010159 Bacteria 1322
63 Ga0163162_10944484 3300013306 Unclassified 974
64 Ga0163163_10032429 3300014325 Bacteria 5045
65 Ga0209148_1002226 3300025254 Bacteria 7096
66 Ga0209455_1004136 3300025272 Bacteria 4865
67 Ga0209758_1001615 3300025297 Bacteria 25719
68 Ga0207684_10007914 3300025910 Bacteria 9499
69 Ga0207684_10057879 3300025910 Bacteria 3289
70 Ga0207684_10121681 3300025910 Bacteria 2237
71 Ga0207684_10283299 3300025910 Bacteria 1429
72 Ga0207684_10352497 3300025910 Bacteria 1267
73 Ga0207654_10209760 3300025911 Bacteria 1287
74 Ga0207707_10005138 3300025912 Bacteria 11474
75 Ga0207707_10042767 3300025912 Bacteria 3953
76 Ga0207695_10241375 3300025913 Bacteria 1708
77 Ga0207693_10030083 3300025915 Bacteria 4287
78 Ga0207693_10133378 3300025915 Bacteria 1952
79 Ga0207660_10068877 3300025917 Bacteria 2568
80 Ga0207652_10010562 3300025921 Bacteria 7432
81 Ga0207646_10231368 3300025922 Bacteria 1670
82 Ga0207694_10080693 3300025924 Bacteria 2553
83 Ga0207700_10015001 3300025928 Bacteria 5094
84 Ga0207665_10029045 3300025939 Bacteria 3656
85 Ga0207661_10023330 3300025944 Bacteria 4674
86 Ga0207640_10176565 3300025981 Bacteria 1597
87 Ga0207676_10021017 3300026095 Bacteria 4784
88 Ga0209179_1086097 3300027512 Bacteria 695
89 Ga0209588_1007185 3300027671 Bacteria 3267
90 Ga0209588_1007566 3300027671 Bacteria 3199
91 Ga0209588_1012573 3300027671 Bacteria 2571
92 Ga0209588_1015178 3300027671 Bacteria 2367
93 Ga0209588_1087884 3300027671 Bacteria 1002
94 Ga0265337_1000505 3300028556 Bacteria 20744
95 Ga0265326_10000798 3300028558 Bacteria 11661
96 Ga0265319_1001254 3300028563 Bacteria 15467
97 Ga0265334_10000388 3300028573 Bacteria 23258
98 Ga0265318_10002792 3300028577 Bacteria 9141
99 Ga0265323_10000051 3300028653 Bacteria 64400
100 Ga0265322_10000771 3300028654 Bacteria 11516
101 Ga0265336_10000026 3300028666 Bacteria 182259
102 Ga0307515_10220115 3300028794 Bacteria 1719
103 Ga0265338_10000018 3300028800 Bacteria 338910
104 Ga0265324_10000143 3300029957 Bacteria 55192
105 Ga0307511_10000599 3300030521 Bacteria 38674
106 Ga0307511_10020929 3300030521 Bacteria 6182
107 Ga0307508_10392893 3300031616 Bacteria 978
108 Ga0307516_10001896 3300031730 Bacteria 28632
109 Ga0307510_10115476 3300033180 Bacteria 2409
110 Ga0315911_1000009 3300033442 Bacteria 379354
111 Ga0373925_0460404 3300037068 Bacteria 1042
112 Ga0395900_0097417 3300037418 Bacteria 3022
113 Ga0395898_0142560 3300037466 Bacteria 2294
114 Ga0395901_0244970 3300038443 Bacteria 1869
115 Ga0495592_0225651 3300046454 Bacteria 1250
116 Ga0495629_0042613 3300046459 Bacteria 3188
117 Ga0495653_0342142 3300046463 Bacteria 964
118 Ga0495664_0464767 3300046477 Bacteria 757
119 Ga0495583_0063610 3300046506 Bacteria 1639
120 Ga0495606_0018592 3300046507 Bacteria 5202
121 Ga0495616_0216892 3300046513 Bacteria 835
122 Ga0495648_0022346 3300046524 Bacteria 4358
123 Ga0495648_0027864 3300046524 Bacteria 3774
124 Ga0495648_0171542 3300046524 Bacteria 1111
125 Ga0495640_0032950 3300046533 Bacteria 3686
126 Ga0495645_0006035 3300046543 Bacteria 8380
127 Ga0495622_0015842 3300046557 Bacteria 3505
128 Ga0495667_0135186 3300046559 Bacteria 1589
129 Ga0495635_0061007 3300046663 Bacteria 2590
130 Ga0495657_0098358 3300046675 Bacteria 1867
131 Ga0495599_0087344 3300046678 Bacteria 1947
132 Ga0495613_0018802 3300046689 Bacteria 5149
133 Ga0495624_0111416 3300046690 Bacteria 1682
134 Ga0495649_0036252 3300046694 Bacteria 2709
135 Ga0495600_0068510 3300046809 Bacteria 2319
136 Ga0495604_0002947 3300047317 Bacteria 13625
137 Ga0495672_0226565 3300047320 Bacteria 920
138 Ga0495676_0034251 3300047321 Bacteria 4264
139 Ga0495673_0109113 3300047469 Bacteria 1109
140 Ga0495593_0023333 3300047673 Bacteria 3440
141 Ga0496104_0003445 3300048907 Bacteria 13632
142 Ga0496105_0017762 3300048908 Bacteria 5706
143 Ga0496105_0286212 3300048908 Bacteria 1328
144 Ga0496113_0020183 3300048916 Bacteria 4680
145 Ga0496113_0115282 3300048916 Bacteria 2096
146 Ga0496119_0006904 3300048922 Bacteria 10361
147 Ga0496120_0011535 3300048923 Bacteria 6071
148 Ga0496122_0066838 3300048925 Bacteria 2594
149 Ga0496124_0167027 3300048927 Bacteria 1709
150 Ga0496126_0108640 3300048929 Bacteria 2418
151 Ga0495682_0026609 3300049460 Bacteria 2146
152 Ga0501033_0459022 3300049570 Bacteria 884
153 Ga0501047_0766499 3300049581 Bacteria 780
154 nmdc:mga06z11_24989_c1 3300050494 Bacteria 2825
155 nmdc:mga0n895_213310_c1 3300050512 Bacteria 1960
156 Ga0495619_0050184 3300053085 Bacteria 2754
157 Ga0500578_0035988 3300053086 Bacteria 3181
158 Ga0500643_078215 3300053087 Bacteria 911
159 Ga0500595_005569 3300053119 Bacteria 5486
160 Ga0500595_107577 3300053119 Bacteria 795
161 Ga0500559_0047064 3300053136 Bacteria 1893
162 Ga0500588_0104057 3300053146 Bacteria 982
163 Ga0500638_048503 3300053162 Bacteria 2055
164 Ga0500636_0198888 3300053177 Bacteria 1062
165 Ga0500570_041611 3300053724 Bacteria 2397
166 Ga0500645_012630 3300053730 Bacteria 2728
167 Ga0500645_019242 3300053730 Bacteria 2125
168 Ga0500645_047428 3300053730 Bacteria 1259
169 2513646631 2513237095 Bacteria 8976980
170 2513679047 2513237098 Bacteria 9902361
171 2513861702 2513237137 Bacteria 9558895
172 2644291495 2643221651 Bacteria 4798932
173 2745077066 2744054633 Bacteria 8678936
174 2818240175 2816332527 Bacteria 8933356
175 2841957964 2841957949 Bacteria 8652217
176 2844315296 2844315083 Bacteria 8138177
177 2876770750 2876761206 Bacteria 10111113
178 2885410458 2885409591 Bacteria 9235467
179 2888383303 2888378607 Bacteria 9652610
180 2935635568 2935630451 Bacteria 8169952
181 2935888135 2935883170 Bacteria 7964738
182 2935960474 2935959822 Bacteria 7869783
183 2941509217 2941507105 Bacteria 8166816
184 2941517046 2941515067 Bacteria 8166720
185 2941524859 2941523033 Bacteria 8169134
186 3005478904 3005474847 Bacteria 9259049
187 8016588329 8016583857 Bacteria 10421953
188 8019558199 8019555841 Bacteria 9642137
189 8019567095 8019565922 Bacteria 9639779
190 Ga0081455_10033838
191 JGI25406J46586_10001843
192 Ga0070683_100030299
193 Ga0070714_100319112
194 Ga0070713_100026400
195 Ga0070705_100539518
196 Ga0070708_100047860
197 Ga0070681_10025551
198 Ga0070681_10055296
199 Ga0070706_100005784
200 Ga0070706_100125845
201 Ga0070706_100185644
202 Ga0070706_100485191
203 Ga0070706_100543925
204 Ga0070706_100595468
205 Ga0070707_100257834
206 Ga0070698_100030554
207 Ga0070698_100105500
208 Ga0070698_100211078
209 Ga0070698_100484230
210 Ga0070699_100277706
211 Ga0070699_100562638
212 Ga0070679_100177638
213 Ga0070684_100031392
214 Ga0070697_100000527
215 Ga0070697_100117989
216 Ga0070697_100170273
217 Ga0070697_100316072
218 Ga0068854_100057399
219 Ga0068859_100021141
220 Ga0081455_10009434
221 Ga0081455_10013430
222 Ga0081455_10021425
223 Ga0081455_10085930
224 Ga0081539_10000848
225 Ga0070717_10004619
226 Ga0070717_10556127
227 Ga0075364_10105165
228 Ga0070712_100478407
229 Ga0075367_10049710
230 Ga0075366_10010627
231 Ga0075366_10404405
232 Ga0097621_100190481
233 Ga0097620_100021141
234 Ga0099794_10008844
235 Ga0099794_10019288
236 Ga0099794_10025564
237 Ga0099794_10035466
238 Ga0099794_10040181
239 Ga0099794_10044488
240 Ga0099794_10175482
241 Ga0099794_10218821
242 Ga0099795_10157982
243 Ga0105240_10329686
244 Ga0114129_10309008
245 Ga0105241_10010001
246 Ga0105238_10047806
247 Ga0105238_10436981
248 Ga0099796_10007003
249 Ga0099796_10024338
250 Ga0099796_10033411
251 Ga0099796_10062704
252 Ga0163162_10944484
253 Ga0163163_10032429
254 Ga0209148_1002226
255 Ga0209455_1004136
256 Ga0209758_1001615
257 Ga0207684_10007914
258 Ga0207684_10057879
259 Ga0207684_10121681
260 Ga0207684_10283299
261 Ga0207684_10352497
262 Ga0207654_10209760
263 Ga0207707_10005138
264 Ga0207707_10042767
265 Ga0207695_10241375
266 Ga0207693_10030083
267 Ga0207693_10133378
268 Ga0207660_10068877
269 Ga0207652_10010562
270 Ga0207646_10231368
271 Ga0207694_10080693
272 Ga0207700_10015001
273 Ga0207665_10029045
274 Ga0207661_10023330
275 Ga0207640_10176565
276 Ga0207676_10021017
277 Ga0209179_1086097
278 Ga0209588_1007185
279 Ga0209588_1007566
280 Ga0209588_1012573
281 Ga0209588_1015178
282 Ga0209588_1087884
283 Ga0265337_1000505
284 Ga0265326_10000798
285 Ga0265319_1001254
286 Ga0265334_10000388
287 Ga0265318_10002792
288 Ga0265323_10000051
289 Ga0265322_10000771
290 Ga0265336_10000026
291 Ga0307515_10220115
292 Ga0265338_10000018
293 Ga0265324_10000143
294 Ga0307511_10000599
295 Ga0307511_10020929
296 Ga0307508_10392893
297 Ga0307516_10001896
298 Ga0307510_10115476
299 Ga0315911_1000009
300 Ga0373925_0460404
301 Ga0395900_0097417
302 Ga0395898_0142560
303 Ga0395901_0244970
304 Ga0495592_0225651
305 Ga0495629_0042613
306 Ga0495653_0342142
307 Ga0495664_0464767
308 Ga0495583_0063610
309 Ga0495606_0018592
310 Ga0495616_0216892
311 Ga0495648_0022346
312 Ga0495648_0027864
313 Ga0495648_0171542
314 Ga0495640_0032950
315 Ga0495645_0006035
316 Ga0495622_0015842
317 Ga0495667_0135186
318 Ga0495635_0061007
319 Ga0495657_0098358
320 Ga0495599_0087344
321 Ga0495613_0018802
322 Ga0495624_0111416
323 Ga0495649_0036252
324 Ga0495600_0068510
325 Ga0495604_0002947
326 Ga0495672_0226565
327 Ga0495676_0034251
328 Ga0495673_0109113
329 Ga0495593_0023333
330 Ga0496104_0003445
331 Ga0496105_0017762
332 Ga0496105_0286212
333 Ga0496113_0020183
334 Ga0496113_0115282
335 Ga0496119_0006904
336 Ga0496120_0011535
337 Ga0496122_0066838
338 Ga0496124_0167027
339 Ga0496126_0108640
340 Ga0495682_0026609
341 Ga0501033_0459022
342 Ga0501047_0766499
343 nmdc:mga06z11_24989_c1
344 nmdc:mga0n895_213310_c1
345 Ga0495619_0050184
346 Ga0500578_0035988
347 Ga0500643_078215
348 Ga0500595_005569
349 Ga0500595_107577
350 Ga0500559_0047064
351 Ga0500588_0104057
352 Ga0500638_048503
353 Ga0500636_0198888
354 Ga0500570_041611
355 Ga0500645_012630
356 Ga0500645_019242
357 Ga0500645_047428
358 2513646631
359 2513679047
360 2513861702
361 2644291495
362 2745077066
363 2818240175
364 2841957964
365 2844315296
366 2876770750
367 2885410458
368 2888383303
369 2935635568
370 2935888135
371 2935960474
372 2941509217
373 2941517046
374 2941524859
375 3005478904
376 8016588329
377 8019558199
378 8019567095

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06532

NrsF

Negative regulator of sigma F

10

213

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sc9-assembly1.cif.gz_BP synechocystis pcc 6803 phycobilisome core, complex with ocp 0.3163 2 172
8f6k-assembly1.cif.gz_C cryo-em structure of a zinc-loaded h263a/d287a mutant of the yiip-fab complex 0.3098 20 210
8h1d-assembly1.cif.gz_A solid-state nmr structure of aquaporin z in its native cellular membranes 0.3015 24 211
7sc9-assembly1.cif.gz_BP synechocystis pcc 6803 phycobilisome core, complex with ocp 0.2935 2 172
7y5h-assembly1.cif.gz_A cryo-em structure of a eukaryotic znt8 at a low ph 0.2919 4 209
ID Description Score Start End Superfamily
af_A0A0R4IDZ8_661_785_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3378 57 178 1.20.120.230
af_D3ZA84_664_788_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3362 57 178 1.20.120.230
af_Q71LX4_665_789_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3324 57 178 1.20.120.230
af_D3ZA84_664_788_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3313 57 178 1.20.120.230
af_I1KYI2_192_382_2.60.120.200 Mainly Beta;Sandwich;Jelly Rolls; 0.3297 48 211 2.60.120.200
ID Description Score Start End GO Terms
AF-A0A1Q7B473-F1-model_v4 Anti-sigma F factor 0.9586 63 213 GO:0016020
AF-K8P022-F1-model_v4 DUF1109 domain-containing protein 0.9528 1 213 GO:0016020
AF-A0A0Q6A5R7-F1-model_v4 DUF1109 domain-containing protein 0.9526 1 213 GO:0016020
AF-A0A1Q7B473-F1-model_v4 Anti-sigma F factor 0.9525 63 213 GO:0016020
AF-A0A7W6PWM3-F1-model_v4 DUF1109 domain-containing protein 0.9493 1 213 GO:0016020

Map