F290084

General Info

Members Datasets Scaffolds Average Seq Length
188 150 376 94

Family's Representative Sequence

Representative Sequence 3300053087|Ga0500643_000239|Ga0500643_000239_24094_24405
Length 103
Sequence MPELSGVAAHMATATWNGTVIAQSDDTVVVEGNHYFPREAVTAELVDSDTHTVCPWKGTASYFSVQVDAATNPDAAWYYPTPKDAAAEIKDRVAFWKGVVVTD

Samples

Sample ID Description Type Environment
1 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
31 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
32 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
36 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
40 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
41 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
42 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
43 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
64 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
65 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
66 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
67 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
68 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
69 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
70 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
71 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
72 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
73 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
74 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
75 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
76 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
85 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
89 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
90 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
91 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
92 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
93 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
94 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
95 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
103 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
104 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
105 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
106 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
107 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
108 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
109 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
112 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
113 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
114 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
117 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
118 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
119 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
120 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
121 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
122 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
125 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
128 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
129 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
130 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
133 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
134 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
135 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
136 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
137 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
138 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
139 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
140 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
141 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
145 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
146 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
147 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
149 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
150 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.94
Metatranscriptomes 0
Isolates 1.06

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.6
Nodule 0
Rhizoplane 3.72
Rhizosphere 93.09
Stem 0
Stem Tuber 0
Unclassified 11.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500643_000239 3300053087 Bacteria 51005
2 Ga0065712_10142608 3300005290 Bacteria 1436
3 Ga0065715_10243537 3300005293 Bacteria 1160
4 Ga0065707_10820550 3300005295 Bacteria 592
5 Ga0070670_100728289 3300005331 Bacteria 893
6 Ga0068869_100451960 3300005334 Bacteria 1065
7 Ga0070689_101418220 3300005340 Bacteria 628
8 Ga0070692_11188215 3300005345 Unclassified 542
9 Ga0070669_101714241 3300005353 Bacteria 548
10 Ga0070671_100787958 3300005355 Unclassified 827
11 Ga0070674_100151632 3300005356 Bacteria 1750
12 Ga0070674_100186146 3300005356 Bacteria 1594
13 Ga0070673_100177175 3300005364 Bacteria 1823
14 Ga0070709_10104520 3300005434 Bacteria 1893
15 Ga0070710_10332868 3300005437 Bacteria 1000
16 Ga0070705_101342026 3300005440 Unclassified 594
17 Ga0070662_100925845 3300005457 Unclassified 744
18 Ga0068867_101677310 3300005459 Bacteria 595
19 Ga0068867_102346556 3300005459 Bacteria 507
20 Ga0070685_11536852 3300005466 Bacteria 514
21 Ga0070707_101454564 3300005468 Bacteria 652
22 Ga0070707_102262063 3300005468 Bacteria 511
23 Ga0070699_100426455 3300005518 Bacteria 1201
24 Ga0070679_101286483 3300005530 Bacteria 677
25 Ga0070672_100715832 3300005543 Bacteria 877
26 Ga0070686_100805592 3300005544 Bacteria 757
27 Ga0070696_100458076 3300005546 Bacteria 1008
28 Ga0070696_100505334 3300005546 Bacteria 962
29 Ga0070704_101486371 3300005549 Unclassified 623
30 Ga0070702_101877746 3300005615 Unclassified 502
31 Ga0068863_100845685 3300005841 Bacteria 914
32 Ga0068860_102612455 3300005843 Unclassified 524
33 Ga0068862_100724715 3300005844 Unclassified 965
34 Ga0075428_100126689 3300006844 Unclassified 2779
35 Ga0075431_100497459 3300006847 Unclassified 1211
36 Ga0075434_102498346 3300006871 Unclassified 518
37 Ga0075429_101815787 3300006880 Bacteria 529
38 Ga0068865_100061332 3300006881 Bacteria 2636
39 Ga0075436_100717843 3300006914 Bacteria 741
40 Ga0075435_100600710 3300007076 Bacteria 954
41 Ga0111539_10560979 3300009094 Bacteria 1330
42 Ga0114129_10400219 3300009147 Bacteria 1809
43 Ga0105028_136648 3300009993 Bacteria 551
44 Ga0105246_12316259 3300011119 Unclassified 525
45 Ga0157380_10884092 3300014326 Unclassified 918
46 Ga0157379_10516278 3300014968 Bacteria 1108
47 Ga0207699_10228541 3300025906 Bacteria 1273
48 Ga0207645_11127050 3300025907 Bacteria 528
49 Ga0207693_10224928 3300025915 Bacteria 1474
50 Ga0207652_11330125 3300025921 Bacteria 621
51 Ga0207681_10097597 3300025923 Bacteria 2112
52 Ga0207709_10660449 3300025935 Bacteria 833
53 Ga0207670_10984400 3300025936 Bacteria 709
54 Ga0207669_10033650 3300025937 Bacteria 2895
55 Ga0207704_10270668 3300025938 Bacteria 1286
56 Ga0207691_10062420 3300025940 Bacteria 3381
57 Ga0207691_10440487 3300025940 Bacteria 1109
58 Ga0207691_10993923 3300025940 Bacteria 700
59 Ga0207689_11259246 3300025942 Bacteria 622
60 Ga0207668_10003287 3300025972 Bacteria 9475
61 Ga0207668_10264643 3300025972 Bacteria 1403
62 Ga0207703_10163859 3300026035 Bacteria 1949
63 Ga0207703_10704892 3300026035 Bacteria 960
64 Ga0207708_10161433 3300026075 Bacteria 1770
65 Ga0207648_11417746 3300026089 Bacteria 653
66 Ga0207676_12104986 3300026095 Bacteria 563
67 Ga0207674_10916891 3300026116 Bacteria 844
68 Ga0207675_100038577 3300026118 Bacteria 4457
69 Ga0268265_10012253 3300028380 Bacteria 5810
70 Ga0268264_10833597 3300028381 Bacteria 923
71 Ga0307515_10545205 3300028794 Bacteria 770
72 Ga0307511_10223478 3300030521 Bacteria 942
73 Ga0265327_10256567 3300031251 Bacteria 777
74 Ga0307405_10992806 3300031731 Bacteria 716
75 Ga0307405_11296233 3300031731 Bacteria 633
76 Ga0307413_10948091 3300031824 Unclassified 734
77 Ga0307410_10031041 3300031852 Bacteria 3423
78 Ga0307410_10287904 3300031852 Bacteria 1292
79 Ga0307410_10630017 3300031852 Bacteria 897
80 Ga0307410_10806449 3300031852 Bacteria 799
81 Ga0326468_10038173 3300031889 Bacteria 673
82 Ga0307406_10295507 3300031901 Bacteria 1242
83 Ga0307406_10310749 3300031901 Bacteria 1215
84 Ga0307406_10801382 3300031901 Unclassified 795
85 Ga0307407_10343407 3300031903 Bacteria 1055
86 Ga0307407_10363927 3300031903 Unclassified 1028
87 Ga0307409_100037403 3300031995 Bacteria 3578
88 Ga0307409_100313870 3300031995 Unclassified 1464
89 Ga0307409_100406800 3300031995 Bacteria 1301
90 Ga0307409_101630685 3300031995 Bacteria 673
91 Ga0307416_100551928 3300032002 Bacteria 1225
92 Ga0307416_100666945 3300032002 Bacteria 1126
93 Ga0307416_100999831 3300032002 Bacteria 939
94 Ga0307416_102482007 3300032002 Bacteria 617
95 Ga0307414_10214464 3300032004 Bacteria 1576
96 Ga0307414_10240570 3300032004 Bacteria 1498
97 Ga0307411_10302001 3300032005 Bacteria 1284
98 Ga0307411_10797264 3300032005 Bacteria 831
99 Ga0307411_11341251 3300032005 Bacteria 653
100 Ga0307415_100120659 3300032126 Bacteria 1965
101 Ga0307415_100209248 3300032126 Bacteria 1554
102 Ga0307415_100229928 3300032126 Bacteria 1493
103 Ga0307415_100263913 3300032126 Bacteria 1407
104 Ga0307415_101549435 3300032126 Bacteria 635
105 Ga0373926_0135045 3300035083 Bacteria 935
106 Ga0373934_0442323 3300035086 Unclassified 545
107 Ga0373944_0276673 3300035089 Bacteria 625
108 Ga0373936_0030077 3300035113 Bacteria 2142
109 Ga0373945_0199681 3300035116 Bacteria 830
110 Ga0373953_0469297 3300035117 Bacteria 557
111 Ga0373943_0232763 3300035170 Bacteria 1030
112 Ga0373955_0699522 3300035172 Bacteria 622
113 Ga0316574_0417164 3300035398 Unclassified 844
114 Ga0373935_0530788 3300035692 Bacteria 856
115 Ga0373927_0057176 3300035695 Bacteria 2522
116 Ga0373947_0021017 3300035725 Bacteria 3775
117 Ga0373947_0166406 3300035725 Bacteria 1428
118 Ga0373937_0030024 3300036401 Bacteria 4924
119 Ga0373925_0024253 3300037068 Bacteria 4428
120 Ga0373925_0156196 3300037068 Bacteria 1794
121 Ga0451795_0709185 3300041456 Bacteria 562
122 Ga0451806_362635 3300041462 Bacteria 517
123 Ga0451577_0199692 3300042876 Bacteria 1805
124 Ga0451577_1486255 3300042876 Bacteria 599
125 Ga0453683_0075750 3300044673 Bacteria 2106
126 Ga0453683_0083666 3300044673 Bacteria 1999
127 Ga0466965_0349904 3300044683 Bacteria 809
128 Ga0466963_0220523 3300044694 Bacteria 1328
129 Ga0466964_0216753 3300044706 Bacteria 927
130 Ga0453684_0001881 3300044712 Bacteria 54555
131 Ga0453684_0006056 3300044712 Bacteria 23371
132 Ga0466968_0384376 3300044735 Bacteria 686
133 Ga0466957_0103618 3300044842 Bacteria 1797
134 Ga0466959_0099040 3300045049 Bacteria 2088
135 Ga0451576_0049906 3300045051 Bacteria 4391
136 Ga0451576_0180484 3300045051 Bacteria 2204
137 Ga0466958_0713942 3300045836 Bacteria 653
138 Ga0466967_0102164 3300045976 Bacteria 2622
139 Ga0466967_1210995 3300045976 Bacteria 752
140 Ga0495638_0564805 3300046460 Bacteria 564
141 Ga0495580_0001102 3300046472 Bacteria 23722
142 Ga0495664_0074265 3300046477 Bacteria 2034
143 Ga0495583_0109869 3300046506 Bacteria 1169
144 Ga0495616_0404105 3300046513 Bacteria 561
145 Ga0495628_0296579 3300046516 Bacteria 1197
146 Ga0495652_0069622 3300046529 Bacteria 2944
147 Ga0495654_0027954 3300046530 Bacteria 2887
148 Ga0495598_0007795 3300046537 Bacteria 2470
149 Ga0495645_0045906 3300046543 Bacteria 3186
150 Ga0495668_0003604 3300046616 Bacteria 11484
151 Ga0495625_0015512 3300046660 Bacteria 6033
152 Ga0495661_0349057 3300046665 Bacteria 729
153 Ga0495623_0047735 3300046679 Bacteria 2718
154 Ga0495646_0273467 3300046680 Bacteria 899
155 Ga0495670_0022190 3300046691 Bacteria 3134
156 Ga0495636_0164844 3300047318 Bacteria 1000
157 Ga0495615_0075164 3300048090 Bacteria 918
158 Ga0496102_0033789 3300048905 Bacteria 4598
159 Ga0496103_0037355 3300048906 Bacteria 2976
160 Ga0496104_0747007 3300048907 Bacteria 885
161 Ga0496109_1828864 3300048912 Bacteria 540
162 Ga0496115_1107056 3300048918 Bacteria 600
163 Ga0496121_0034221 3300048924 Bacteria 4577
164 Ga0501298_154990 3300049521 Bacteria 562
165 Ga0501038_1271547 3300049574 Bacteria 532
166 Ga0501040_1070199 3300049576 Bacteria 585
167 Ga0501071_0020627 3300049587 Bacteria 4582
168 Ga0501071_0967800 3300049587 Bacteria 657
169 Ga0501072_0198367 3300049588 Bacteria 1600
170 Ga0501075_0422998 3300049591 Bacteria 1016
171 Ga0501077_0055129 3300049593 Unclassified 2524
172 Ga0501235_218685 3300049669 Bacteria 522
173 Ga0501248_046515 3300049678 Unclassified 547
174 Ga0501261_041968 3300049690 Bacteria 725
175 Ga0501225_0089166 3300049705 Bacteria 892
176 Ga0501080_0424915 3300049742 Bacteria 1193
177 Ga0501045_1180705 3300049824 Bacteria 559
178 nmdc:mga05p37_167400_c1 3300050507 Bacteria 2682
179 nmdc:mga09592_1094321_c1 3300050508 Bacteria 663
180 nmdc:mga06r32_147133_c1 3300050510 Unclassified 2333
181 Ga0495601_0192852 3300053077 Bacteria 1331
182 Ga0495601_0241777 3300053077 Bacteria 1178
183 Ga0495612_0309272 3300053078 Bacteria 709
184 Ga0500643_020714 3300053087 Bacteria 2143
185 Ga0500645_133036 3300053730 Bacteria 690
186 Ga0530510_0592399 3300061734 Bacteria 843
187 2799185065 2799112218 Bacteria 4315149
188 2819689807 2818991462 Bacteria 4320267
189 Ga0500643_000239
190 Ga0065712_10142608
191 Ga0065715_10243537
192 Ga0065707_10820550
193 Ga0070670_100728289
194 Ga0068869_100451960
195 Ga0070689_101418220
196 Ga0070692_11188215
197 Ga0070669_101714241
198 Ga0070671_100787958
199 Ga0070674_100151632
200 Ga0070674_100186146
201 Ga0070673_100177175
202 Ga0070709_10104520
203 Ga0070710_10332868
204 Ga0070705_101342026
205 Ga0070662_100925845
206 Ga0068867_101677310
207 Ga0068867_102346556
208 Ga0070685_11536852
209 Ga0070707_101454564
210 Ga0070707_102262063
211 Ga0070699_100426455
212 Ga0070679_101286483
213 Ga0070672_100715832
214 Ga0070686_100805592
215 Ga0070696_100458076
216 Ga0070696_100505334
217 Ga0070704_101486371
218 Ga0070702_101877746
219 Ga0068863_100845685
220 Ga0068860_102612455
221 Ga0068862_100724715
222 Ga0075428_100126689
223 Ga0075431_100497459
224 Ga0075434_102498346
225 Ga0075429_101815787
226 Ga0068865_100061332
227 Ga0075436_100717843
228 Ga0075435_100600710
229 Ga0111539_10560979
230 Ga0114129_10400219
231 Ga0105028_136648
232 Ga0105246_12316259
233 Ga0157380_10884092
234 Ga0157379_10516278
235 Ga0207699_10228541
236 Ga0207645_11127050
237 Ga0207693_10224928
238 Ga0207652_11330125
239 Ga0207681_10097597
240 Ga0207709_10660449
241 Ga0207670_10984400
242 Ga0207669_10033650
243 Ga0207704_10270668
244 Ga0207691_10062420
245 Ga0207691_10440487
246 Ga0207691_10993923
247 Ga0207689_11259246
248 Ga0207668_10003287
249 Ga0207668_10264643
250 Ga0207703_10163859
251 Ga0207703_10704892
252 Ga0207708_10161433
253 Ga0207648_11417746
254 Ga0207676_12104986
255 Ga0207674_10916891
256 Ga0207675_100038577
257 Ga0268265_10012253
258 Ga0268264_10833597
259 Ga0307515_10545205
260 Ga0307511_10223478
261 Ga0265327_10256567
262 Ga0307405_10992806
263 Ga0307405_11296233
264 Ga0307413_10948091
265 Ga0307410_10031041
266 Ga0307410_10287904
267 Ga0307410_10630017
268 Ga0307410_10806449
269 Ga0326468_10038173
270 Ga0307406_10295507
271 Ga0307406_10310749
272 Ga0307406_10801382
273 Ga0307407_10343407
274 Ga0307407_10363927
275 Ga0307409_100037403
276 Ga0307409_100313870
277 Ga0307409_100406800
278 Ga0307409_101630685
279 Ga0307416_100551928
280 Ga0307416_100666945
281 Ga0307416_100999831
282 Ga0307416_102482007
283 Ga0307414_10214464
284 Ga0307414_10240570
285 Ga0307411_10302001
286 Ga0307411_10797264
287 Ga0307411_11341251
288 Ga0307415_100120659
289 Ga0307415_100209248
290 Ga0307415_100229928
291 Ga0307415_100263913
292 Ga0307415_101549435
293 Ga0373926_0135045
294 Ga0373934_0442323
295 Ga0373944_0276673
296 Ga0373936_0030077
297 Ga0373945_0199681
298 Ga0373953_0469297
299 Ga0373943_0232763
300 Ga0373955_0699522
301 Ga0316574_0417164
302 Ga0373935_0530788
303 Ga0373927_0057176
304 Ga0373947_0021017
305 Ga0373947_0166406
306 Ga0373937_0030024
307 Ga0373925_0024253
308 Ga0373925_0156196
309 Ga0451795_0709185
310 Ga0451806_362635
311 Ga0451577_0199692
312 Ga0451577_1486255
313 Ga0453683_0075750
314 Ga0453683_0083666
315 Ga0466965_0349904
316 Ga0466963_0220523
317 Ga0466964_0216753
318 Ga0453684_0001881
319 Ga0453684_0006056
320 Ga0466968_0384376
321 Ga0466957_0103618
322 Ga0466959_0099040
323 Ga0451576_0049906
324 Ga0451576_0180484
325 Ga0466958_0713942
326 Ga0466967_0102164
327 Ga0466967_1210995
328 Ga0495638_0564805
329 Ga0495580_0001102
330 Ga0495664_0074265
331 Ga0495583_0109869
332 Ga0495616_0404105
333 Ga0495628_0296579
334 Ga0495652_0069622
335 Ga0495654_0027954
336 Ga0495598_0007795
337 Ga0495645_0045906
338 Ga0495668_0003604
339 Ga0495625_0015512
340 Ga0495661_0349057
341 Ga0495623_0047735
342 Ga0495646_0273467
343 Ga0495670_0022190
344 Ga0495636_0164844
345 Ga0495615_0075164
346 Ga0496102_0033789
347 Ga0496103_0037355
348 Ga0496104_0747007
349 Ga0496109_1828864
350 Ga0496115_1107056
351 Ga0496121_0034221
352 Ga0501298_154990
353 Ga0501038_1271547
354 Ga0501040_1070199
355 Ga0501071_0020627
356 Ga0501071_0967800
357 Ga0501072_0198367
358 Ga0501075_0422998
359 Ga0501077_0055129
360 Ga0501235_218685
361 Ga0501248_046515
362 Ga0501261_041968
363 Ga0501225_0089166
364 Ga0501080_0424915
365 Ga0501045_1180705
366 nmdc:mga05p37_167400_c1
367 nmdc:mga09592_1094321_c1
368 nmdc:mga06r32_147133_c1
369 Ga0495601_0192852
370 Ga0495601_0241777
371 Ga0495612_0309272
372 Ga0500643_020714
373 Ga0500645_133036
374 Ga0530510_0592399
375 2799185065
376 2819689807

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

12

98

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.9001 2 85
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8168 2 85
7sfz-assembly2.cif.gz_D crystal structure of mis18a-yippee domain 0.7085 12 84
7shp-assembly2.cif.gz_C crystal structure of hsting in complex with c[2',3'-(ribo-2'-g, xylo-3'-a)-mp](rj244) 0.5731 32 61
4d55-assembly1.cif.gz_A focal adhesion kinase catalytic domain 0.5674 29 66
ID Description Score Start End Superfamily
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9703 1 89 2.170.150.40
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9288 1 89 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9063 1 85 2.170.150.40
3djmD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8719 2 85 2.170.150.40
af_O53404_128_241_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.862 3 85 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A522P416-F1-model_v4 DUF427 domain-containing protein 0.9987 1 89
AF-A0A4R2K4W6-F1-model_v4 Uncharacterized protein (DUF427 family) 0.9986 1 92
AF-H8GW82-F1-model_v4 DUF427 domain-containing protein 0.9983 1 91
AF-A0A536D0L0-F1-model_v4 DUF427 domain-containing protein 0.998 1 89
AF-A0A7W0T7E6-F1-model_v4 DUF427 domain-containing protein 0.9972 1 92

Map