F290074

General Info

Members Datasets Scaffolds Average Seq Length
188 150 376 374

Family's Representative Sequence

Representative Sequence 3300050513|nmdc:mga0rr50_323310_c1|nmdc:mga0rr50_323310_c1_34_1278
Length 414
Sequence MSTHSVHPSMHSDASMVTGTSDRLSISGTAPYCHIVDRLDRHSGMGVVLHWFLPTNGDSRTDLSLGNAVGAAGSRVTKSGTERAPDIGYMGQIARSAEQLGFAGALTPTSSWCEDAWIMTAGLSQVTERFKFLVAFRPGLLSPTLAAQMAATYQRISGGRLLLNVVTGGDDAEQQRFGDHLGKRDRYRRAGEFLHIVRELWHGDPVDFTGEHFDLRGAQIIPAPVRPQIYLGGSSPDALEVAASYADVYLTWGEPPDAVAEKLDRVRERAKAAGRELRFGIRLHVITRTRSDQAWAQAQELLDSLDPAAIESAQAIQRASASEGQRRMSELHGGRTDALEVSPNLWAGVGLVRGGAGTALVGSHEEVADRIAEYHELGIDEFILSGYPHLEEAYQVGEGVMPVLRRRGLLAGVP

Samples

Sample ID Description Type Environment
1 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
2 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
9 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
14 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
15 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
16 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
17 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
18 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
19 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
20 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
21 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
22 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
25 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
32 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
33 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
44 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
45 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
46 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
47 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
48 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
49 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
50 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
51 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
52 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
57 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
58 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
59 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
60 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
61 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
62 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
63 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
68 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
69 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
70 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
71 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
72 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
73 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
74 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
77 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
78 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
79 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
80 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
81 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
82 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
83 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
84 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
85 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
86 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
87 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
88 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
89 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
90 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
91 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
92 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
93 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
94 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
95 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
96 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
97 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
98 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
99 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
100 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
101 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
102 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
103 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
104 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
105 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
106 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
107 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
108 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
109 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
110 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
111 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
112 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
113 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
114 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
115 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
116 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
117 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
118 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
119 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
120 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
121 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
124 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
125 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
126 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
127 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
128 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
129 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
130 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
131 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
132 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
133 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
137 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
140 2626541554 Frankia sp. AvcI.1 Isolate Nodule
141 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
142 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
143 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
144 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
145 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
146 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
147 2891562705 Microbispora tritici MT50 Isolate Unclassified
148 2932398195 Dietzia sp. 2505 Isolate Rhizosphere
149 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
150 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.62
Metatranscriptomes 0
Isolates 6.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.36
Nodule 1.06
Rhizoplane 7.45
Rhizosphere 60.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0rr50_323310_c1 3300050513 Bacteria 1293
2 Ga0055540_1000081 3300003792 Bacteria 109820
3 Ga0070683_100194260 3300005329 Bacteria 1927
4 Ga0070670_100355850 3300005331 Bacteria 1287
5 Ga0070668_100082286 3300005347 Bacteria 2525
6 Ga0070668_100105013 3300005347 Bacteria 2243
7 Ga0070667_100016138 3300005367 Bacteria 6178
8 Ga0070714_100001833 3300005435 Bacteria 15453
9 Ga0070663_100239669 3300005455 Bacteria 1431
10 Ga0070678_100123209 3300005456 Bacteria 2048
11 Ga0068867_100192819 3300005459 Bacteria 1627
12 Ga0070707_100165634 3300005468 Bacteria 2154
13 Ga0070679_100068563 3300005530 Bacteria 3538
14 Ga0068861_100265421 3300005719 Bacteria 1472
15 Ga0068860_100070002 3300005843 Bacteria 3335
16 Ga0068862_100002575 3300005844 Bacteria 16012
17 Ga0075365_10024698 3300006038 Bacteria 3796
18 Ga0075365_10046262 3300006038 Bacteria 2857
19 Ga0075368_10021840 3300006042 Bacteria 2433
20 Ga0075363_100000823 3300006048 Bacteria 10754
21 Ga0075363_100040717 3300006048 Bacteria 2449
22 Ga0075364_10002364 3300006051 Bacteria 10600
23 Ga0075364_10066934 3300006051 Bacteria 2360
24 Ga0075362_10043088 3300006177 Bacteria 1997
25 Ga0075367_10010281 3300006178 Bacteria 4912
26 Ga0075370_10006722 3300006353 Bacteria 5801
27 Ga0075428_100053180 3300006844 Bacteria 4437
28 Ga0075430_100011094 3300006846 Bacteria 7637
29 Ga0075431_100007845 3300006847 Bacteria 10638
30 Ga0075429_100003839 3300006880 Bacteria 12830
31 Ga0114129_10211777 3300009147 Bacteria 2620
32 Ga0105249_10027077 3300009553 Bacteria 5172
33 Ga0105249_10027705 3300009553 Bacteria 5113
34 Ga0157375_10029541 3300013308 Bacteria 5157
35 Ga0157380_10093178 3300014326 Bacteria 2491
36 Ga0157379_10007699 3300014968 Bacteria 9326
37 Ga0163161_10045620 3300017792 Bacteria 3161
38 Ga0213876_10012202 3300021384 Bacteria 4576
39 Ga0213875_10000413 3300021388 Bacteria 37551
40 Ga0213875_10000634 3300021388 Bacteria 28091
41 Ga0213875_10029893 3300021388 Bacteria 2582
42 Ga0209051_1000076 3300025303 Bacteria 204355
43 Ga0207652_10075719 3300025921 Bacteria 2933
44 Ga0207700_10042683 3300025928 Bacteria 3327
45 Ga0207664_10001840 3300025929 Bacteria 13986
46 Ga0207664_10141858 3300025929 Bacteria 2033
47 Ga0207661_10030625 3300025944 Bacteria 4147
48 Ga0207712_10050659 3300025961 Bacteria 2900
49 Ga0207668_10063993 3300025972 Bacteria 2597
50 Ga0207658_10017570 3300025986 Bacteria 4931
51 Ga0207648_10393014 3300026089 Bacteria 1255
52 Ga0268265_10003751 3300028380 Bacteria 10804
53 Ga0268264_10042653 3300028381 Bacteria 3756
54 Ga0265334_10009565 3300028573 Bacteria 4101
55 Ga0265336_10003483 3300028666 Bacteria 6157
56 Ga0307515_10000044 3300028794 Bacteria 303041
57 Ga0265338_10003375 3300028800 Bacteria 22553
58 Ga0265338_10005889 3300028800 Bacteria 15812
59 Ga0265338_10018376 3300028800 Bacteria 7487
60 Ga0265338_10109460 3300028800 Bacteria 2229
61 Ga0265325_10012992 3300031241 Bacteria 4749
62 Ga0265327_10002753 3300031251 Bacteria 17873
63 Ga0265327_10014371 3300031251 Bacteria 5184
64 Ga0307509_10049145 3300031507 Bacteria 4525
65 Ga0307408_100353500 3300031548 Bacteria 1248
66 Ga0307516_10000470 3300031730 Bacteria 53445
67 Ga0307516_10003830 3300031730 Bacteria 19054
68 Ga0307410_10051346 3300031852 Bacteria 2779
69 Ga0307416_100231305 3300032002 Bacteria 1782
70 Ga0373934_0058652 3300035086 Bacteria 1532
71 Ga0373955_0134867 3300035172 Bacteria 1443
72 Ga0373924_0056233 3300035410 Bacteria 1639
73 Ga0373937_0025320 3300036401 Bacteria 5356
74 Ga0373925_0001832 3300037068 Bacteria 17731
75 Ga0373925_0009324 3300037068 Bacteria 7144
76 Ga0373925_0054300 3300037068 Bacteria 2996
77 Ga0395899_0010890 3300037312 Bacteria 6969
78 Ga0395900_0000021 3300037418 Bacteria 351144
79 Ga0395905_0000912 3300037471 Bacteria 38176
80 Ga0436364_0085267 3300037853 Bacteria 2549
81 Ga0436364_0377740 3300037853 Bacteria 7741
82 Ga0436364_0507746 3300037853 Bacteria 25113
83 Ga0436364_0856907 3300037853 Bacteria 71959
84 Ga0436364_1050387 3300037853 Bacteria 10276
85 Ga0436364_1103421 3300037853 Bacteria 3206
86 Ga0395901_0014520 3300038443 Bacteria 8009
87 Ga0436365_0619897 3300039437 Bacteria 4955
88 Ga0436365_1232454 3300039437 Bacteria 6569
89 Ga0436365_1430088 3300039437 Bacteria 1400
90 Ga0439448_0043149 3300042005 Bacteria 1463
91 Ga0466972_0025256 3300044658 Bacteria 2946
92 Ga0466972_0040708 3300044658 Bacteria 2263
93 Ga0466961_0193164 3300044693 Bacteria 1261
94 Ga0466963_0123667 3300044694 Bacteria 1782
95 Ga0466971_0011066 3300044719 Bacteria 3951
96 Ga0466970_0072040 3300044765 Bacteria 1859
97 Ga0466960_0000145 3300044901 Bacteria 24328
98 Ga0466960_0000183 3300044901 Bacteria 21512
99 Ga0466959_0016427 3300045049 Bacteria 5408
100 Ga0466959_0025338 3300045049 Bacteria 4396
101 Ga0466958_0009035 3300045836 Bacteria 5534
102 Ga0466967_0000756 3300045976 Bacteria 16684
103 Ga0495592_0011613 3300046454 Bacteria 6670
104 Ga0495638_0024255 3300046460 Bacteria 3958
105 Ga0495651_0015252 3300046462 Bacteria 5940
106 Ga0495653_0011468 3300046463 Bacteria 7242
107 Ga0495650_0000266 3300046471 Bacteria 100706
108 Ga0495608_0044814 3300046511 Bacteria 2950
109 Ga0495618_0113343 3300046514 Bacteria 1736
110 Ga0495628_0158098 3300046516 Bacteria 1723
111 Ga0495652_0051063 3300046529 Bacteria 3533
112 Ga0495640_0090621 3300046533 Bacteria 2018
113 Ga0495587_0009604 3300046536 Bacteria 6192
114 Ga0495645_0050249 3300046543 Bacteria 3036
115 Ga0495667_0001075 3300046559 Bacteria 17675
116 Ga0495634_0187998 3300046642 Bacteria 1290
117 Ga0495635_0004848 3300046663 Bacteria 9362
118 Ga0495657_0003821 3300046675 Bacteria 12176
119 Ga0495599_0007212 3300046678 Bacteria 6735
120 Ga0495646_0080975 3300046680 Bacteria 1893
121 Ga0495600_0017387 3300046809 Bacteria 4574
122 Ga0495674_0010570 3300047319 Bacteria 8735
123 Ga0495674_0102149 3300047319 Bacteria 2438
124 Ga0495672_0137091 3300047320 Bacteria 1282
125 Ga0495680_0011128 3300047322 Bacteria 7988
126 Ga0495684_0037947 3300047471 Bacteria 3695
127 Ga0495602_0027707 3300048088 Bacteria 5441
128 Ga0496100_0000053 3300048903 Bacteria 70913
129 Ga0496100_0030129 3300048903 Bacteria 3363
130 Ga0496101_0000057 3300048904 Bacteria 134204
131 Ga0496103_0000773 3300048906 Bacteria 23600
132 Ga0496106_0000721 3300048909 Bacteria 23837
133 Ga0496106_0220007 3300048909 Bacteria 1514
134 Ga0496107_0000167 3300048910 Bacteria 33889
135 Ga0496107_0061573 3300048910 Bacteria 2717
136 Ga0496108_0012354 3300048911 Bacteria 6949
137 Ga0496109_0000144 3300048912 Bacteria 71522
138 Ga0496110_0006486 3300048913 Bacteria 9276
139 Ga0496111_0013480 3300048914 Bacteria 5565
140 Ga0496114_0000756 3300048917 Bacteria 24105
141 Ga0496114_0264694 3300048917 Bacteria 1514
142 Ga0496116_0069702 3300048919 Bacteria 2234
143 Ga0496117_0065126 3300048920 Bacteria 2479
144 Ga0496119_0002563 3300048922 Bacteria 19767
145 Ga0496121_0000068 3300048924 Bacteria 259210
146 Ga0496122_0000085 3300048925 Bacteria 208310
147 Ga0496123_0053532 3300048926 Bacteria 2666
148 Ga0496124_0000065 3300048927 Bacteria 223594
149 Ga0496125_0000008 3300048928 Bacteria 704677
150 Ga0496126_0000062 3300048929 Bacteria 259210
151 Ga0496126_0036122 3300048929 Bacteria 4623
152 Ga0501037_0172225 3300049573 Bacteria 1538
153 Ga0501047_0027980 3300049581 Bacteria 5433
154 Ga0501070_0201062 3300049586 Bacteria 1636
155 Ga0501080_0360694 3300049742 Bacteria 1311
156 Ga0501044_0205874 3300049823 Bacteria 1924
157 nmdc:mga03683_16370_c1 3300050489 Bacteria 2784
158 nmdc:mga03683_62499_c1 3300050489 Bacteria 1577
159 nmdc:mga03n38_15092_c1 3300050490 Bacteria 2977
160 nmdc:mga03n38_185_c1 3300050490 Bacteria 14051
161 nmdc:mga00v17_101966_c1 3300050491 Bacteria 1812
162 nmdc:mga00v17_12834_c1 3300050491 Bacteria 4633
163 nmdc:mga00v17_1297_c1 3300050491 Bacteria 13104
164 nmdc:mga0yw44_38685_c1 3300050492 Bacteria 2824
165 nmdc:mga06z11_23814_c1 3300050494 Bacteria 2881
166 nmdc:mga07m45_1606_c1 3300050496 Bacteria 8324
167 nmdc:mga07m45_917_c1 3300050496 Bacteria 4265
168 nmdc:mga05p37_233071_c1 3300050507 Bacteria 2217
169 nmdc:mga09592_3849_c1 3300050508 Bacteria 12085
170 nmdc:mga0qj67_12653_c1 3300050509 Bacteria 6362
171 nmdc:mga06r32_920_c1 3300050510 Bacteria 26138
172 Ga0500643_005258 3300053087 Bacteria 5617
173 Ga0500616_0000491 3300053153 Bacteria 51066
174 Ga0500616_0006449 3300053153 Bacteria 7683
175 Ga0500616_0032941 3300053153 Bacteria 2830
176 Ga0466962_0067555 3300061719 Bacteria 1707
177 2579854206 2579778521 Bacteria 7624758
178 2626634244 2626541554 Bacteria 7741902
179 2738669377 2738541264 Bacteria 5935393
180 2739148501 2738541356 Bacteria 5935017
181 2776374901 2775506925 Bacteria 7237746
182 2837274251 2837268691 Bacteria 7850704
183 2856744323 2856741275 Bacteria 8096094
184 2863073299 2863067949 Bacteria 8541735
185 2891564640 2891562705 Bacteria 8039471
186 2932400303 2932398195 Bacteria 3847976
187 2939588573 2939582691 Bacteria 7088898
188 3004271553 3004268573 Bacteria 7043476
189 nmdc:mga0rr50_323310_c1
190 Ga0055540_1000081
191 Ga0070683_100194260
192 Ga0070670_100355850
193 Ga0070668_100082286
194 Ga0070668_100105013
195 Ga0070667_100016138
196 Ga0070714_100001833
197 Ga0070663_100239669
198 Ga0070678_100123209
199 Ga0068867_100192819
200 Ga0070707_100165634
201 Ga0070679_100068563
202 Ga0068861_100265421
203 Ga0068860_100070002
204 Ga0068862_100002575
205 Ga0075365_10024698
206 Ga0075365_10046262
207 Ga0075368_10021840
208 Ga0075363_100000823
209 Ga0075363_100040717
210 Ga0075364_10002364
211 Ga0075364_10066934
212 Ga0075362_10043088
213 Ga0075367_10010281
214 Ga0075370_10006722
215 Ga0075428_100053180
216 Ga0075430_100011094
217 Ga0075431_100007845
218 Ga0075429_100003839
219 Ga0114129_10211777
220 Ga0105249_10027077
221 Ga0105249_10027705
222 Ga0157375_10029541
223 Ga0157380_10093178
224 Ga0157379_10007699
225 Ga0163161_10045620
226 Ga0213876_10012202
227 Ga0213875_10000413
228 Ga0213875_10000634
229 Ga0213875_10029893
230 Ga0209051_1000076
231 Ga0207652_10075719
232 Ga0207700_10042683
233 Ga0207664_10001840
234 Ga0207664_10141858
235 Ga0207661_10030625
236 Ga0207712_10050659
237 Ga0207668_10063993
238 Ga0207658_10017570
239 Ga0207648_10393014
240 Ga0268265_10003751
241 Ga0268264_10042653
242 Ga0265334_10009565
243 Ga0265336_10003483
244 Ga0307515_10000044
245 Ga0265338_10003375
246 Ga0265338_10005889
247 Ga0265338_10018376
248 Ga0265338_10109460
249 Ga0265325_10012992
250 Ga0265327_10002753
251 Ga0265327_10014371
252 Ga0307509_10049145
253 Ga0307408_100353500
254 Ga0307516_10000470
255 Ga0307516_10003830
256 Ga0307410_10051346
257 Ga0307416_100231305
258 Ga0373934_0058652
259 Ga0373955_0134867
260 Ga0373924_0056233
261 Ga0373937_0025320
262 Ga0373925_0001832
263 Ga0373925_0009324
264 Ga0373925_0054300
265 Ga0395899_0010890
266 Ga0395900_0000021
267 Ga0395905_0000912
268 Ga0436364_0085267
269 Ga0436364_0377740
270 Ga0436364_0507746
271 Ga0436364_0856907
272 Ga0436364_1050387
273 Ga0436364_1103421
274 Ga0395901_0014520
275 Ga0436365_0619897
276 Ga0436365_1232454
277 Ga0436365_1430088
278 Ga0439448_0043149
279 Ga0466972_0025256
280 Ga0466972_0040708
281 Ga0466961_0193164
282 Ga0466963_0123667
283 Ga0466971_0011066
284 Ga0466970_0072040
285 Ga0466960_0000145
286 Ga0466960_0000183
287 Ga0466959_0016427
288 Ga0466959_0025338
289 Ga0466958_0009035
290 Ga0466967_0000756
291 Ga0495592_0011613
292 Ga0495638_0024255
293 Ga0495651_0015252
294 Ga0495653_0011468
295 Ga0495650_0000266
296 Ga0495608_0044814
297 Ga0495618_0113343
298 Ga0495628_0158098
299 Ga0495652_0051063
300 Ga0495640_0090621
301 Ga0495587_0009604
302 Ga0495645_0050249
303 Ga0495667_0001075
304 Ga0495634_0187998
305 Ga0495635_0004848
306 Ga0495657_0003821
307 Ga0495599_0007212
308 Ga0495646_0080975
309 Ga0495600_0017387
310 Ga0495674_0010570
311 Ga0495674_0102149
312 Ga0495672_0137091
313 Ga0495680_0011128
314 Ga0495684_0037947
315 Ga0495602_0027707
316 Ga0496100_0000053
317 Ga0496100_0030129
318 Ga0496101_0000057
319 Ga0496103_0000773
320 Ga0496106_0000721
321 Ga0496106_0220007
322 Ga0496107_0000167
323 Ga0496107_0061573
324 Ga0496108_0012354
325 Ga0496109_0000144
326 Ga0496110_0006486
327 Ga0496111_0013480
328 Ga0496114_0000756
329 Ga0496114_0264694
330 Ga0496116_0069702
331 Ga0496117_0065126
332 Ga0496119_0002563
333 Ga0496121_0000068
334 Ga0496122_0000085
335 Ga0496123_0053532
336 Ga0496124_0000065
337 Ga0496125_0000008
338 Ga0496126_0000062
339 Ga0496126_0036122
340 Ga0501037_0172225
341 Ga0501047_0027980
342 Ga0501070_0201062
343 Ga0501080_0360694
344 Ga0501044_0205874
345 nmdc:mga03683_16370_c1
346 nmdc:mga03683_62499_c1
347 nmdc:mga03n38_15092_c1
348 nmdc:mga03n38_185_c1
349 nmdc:mga00v17_101966_c1
350 nmdc:mga00v17_12834_c1
351 nmdc:mga00v17_1297_c1
352 nmdc:mga0yw44_38685_c1
353 nmdc:mga06z11_23814_c1
354 nmdc:mga07m45_1606_c1
355 nmdc:mga07m45_917_c1
356 nmdc:mga05p37_233071_c1
357 nmdc:mga09592_3849_c1
358 nmdc:mga0qj67_12653_c1
359 nmdc:mga06r32_920_c1
360 Ga0500643_005258
361 Ga0500616_0000491
362 Ga0500616_0006449
363 Ga0500616_0032941
364 Ga0466962_0067555
365 2579854206
366 2626634244
367 2738669377
368 2739148501
369 2776374901
370 2837274251
371 2856744323
372 2863073299
373 2891564640
374 2932400303
375 2939588573
376 3004271553

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

64

381

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7jv3-assembly2.cif.gz_H crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9407 38 402
7jv3-assembly2.cif.gz_G crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9393 38 402
7k64-assembly2.cif.gz_E binary titrated soak structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens with fmn 0.9384 38 407
7jv3-assembly1.cif.gz_B crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9378 38 402
7jv3-assembly1.cif.gz_A crystal structure of alkanesulfonate monooxygenase msud from pseudomonas fluorescens 0.9375 38 402
ID Description Score Start End Superfamily
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9144 38 402 3.20.20.30
1m41A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8764 38 402 3.20.20.30
af_I6X9T8_35_343_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8712 108 402 3.20.20.30
af_P75898_18_373_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8068 37 401 3.20.20.30
3raoB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.7989 37 408 3.20.20.30
ID Description Score Start End GO Terms
AF-Q32E56-F1-model_v4 Luciferase-like domain-containing protein 0.9775 284 400 GO:0008726
GO:0046306
AF-A0A6B3FJF0-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.973 211 413 GO:0008726
GO:0046306
AF-A0A2X3JLM7-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9716 216 400 GO:0008726
GO:0046306
AF-A0A376JXQ5-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9712 216 400 GO:0008726
GO:0046306
AF-A0A379Z4V6-F1-model_v4 Alkanesulfonate monooxygenase (EC 1.14.14.5) 0.9706 78 195 GO:0008726
GO:0046306

Map