F289806

General Info

Members Datasets Scaffolds Average Seq Length
188 136 188 136

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0002085|Ga0466967_0002085_11205_11663
Length 152
Sequence MSSGEVAGEREVSEGQVSLPITGGCNCGAVRFEVTEPFEASMYCHCTRCQRRTGTSASVNGRTRPEAFRIVKGRDRIRAWEPPDAGAAKHFCGDCGSALFSRSESSIGVRLGAVDGDPGIRPSYRQFVAYAAAWEPIPDDGLPRYPESRSSS

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
77 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
78 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
79 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
83 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
84 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
85 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
86 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
87 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
88 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
89 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
90 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
91 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
92 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
93 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
94 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
98 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
99 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
100 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
101 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
102 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
103 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
104 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
105 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
106 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
107 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
108 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
109 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
110 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
115 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
116 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
119 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
120 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
121 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
124 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
125 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
126 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
127 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
128 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
129 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
130 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
131 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
132 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
133 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
134 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
135 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
136 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 0
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10101918 3300002459 Bacteria 599
2 Ga0065707_10014266 3300005295 Bacteria 2282
3 Ga0070658_10144974 3300005327 Bacteria 1985
4 Ga0070676_10482258 3300005328 Bacteria 877
5 Ga0070683_100001475 3300005329 Bacteria 18118
6 Ga0070670_100942085 3300005331 Bacteria 784
7 Ga0070682_100670106 3300005337 Bacteria 828
8 Ga0070689_100494022 3300005340 Unclassified 1047
9 Ga0070691_10320739 3300005341 Bacteria 852
10 Ga0070691_10335015 3300005341 Bacteria 836
11 Ga0070661_100398571 3300005344 Bacteria 1088
12 Ga0070692_10173312 3300005345 Bacteria 1245
13 Ga0070668_100002789 3300005347 Bacteria 12852
14 Ga0070675_100088883 3300005354 Bacteria 2586
15 Ga0070674_101385662 3300005356 Bacteria 629
16 Ga0070659_100791726 3300005366 Bacteria 824
17 Ga0070714_100354285 3300005435 Bacteria 1379
18 Ga0070714_100807507 3300005435 Bacteria 909
19 Ga0070713_100066594 3300005436 Bacteria 3029
20 Ga0070713_100868141 3300005436 Bacteria 867
21 Ga0070710_10535216 3300005437 Bacteria 807
22 Ga0070700_100017709 3300005441 Bacteria 4081
23 Ga0070694_100603752 3300005444 Unclassified 884
24 Ga0070708_100069206 3300005445 Bacteria 3174
25 Ga0070663_100773511 3300005455 Bacteria 821
26 Ga0070662_100001417 3300005457 Bacteria 14785
27 Ga0068867_100259809 3300005459 Bacteria 1415
28 Ga0070685_10356291 3300005466 Bacteria 1002
29 Ga0070706_100488179 3300005467 Bacteria 1146
30 Ga0070707_100165119 3300005468 Bacteria 2158
31 Ga0070699_100558618 3300005518 Bacteria 1042
32 Ga0070684_100000300 3300005535 Bacteria 34313
33 Ga0070686_100163296 3300005544 Bacteria 1570
34 Ga0070695_100336783 3300005545 Bacteria 1126
35 Ga0070696_100005313 3300005546 Bacteria 8590
36 Ga0070664_100029746 3300005564 Bacteria 4555
37 Ga0068857_100002311 3300005577 Bacteria 15480
38 Ga0070702_100215726 3300005615 Bacteria 1280
39 Ga0070702_100339965 3300005615 Bacteria 1053
40 Ga0068852_101075764 3300005616 Bacteria 824
41 Ga0068859_100428613 3300005617 Bacteria 1419
42 Ga0068861_100009957 3300005719 Bacteria 6582
43 Ga0081455_10015868 3300005937 Bacteria 7293
44 Ga0081539_10000477 3300005985 Bacteria 84784
45 Ga0070717_10031792 3300006028 Bacteria 4249
46 Ga0070717_10032715 3300006028 Bacteria 4192
47 Ga0070717_10131498 3300006028 Bacteria 2152
48 Ga0070717_10131867 3300006028 Bacteria 2149
49 Ga0070712_100079205 3300006175 Bacteria 2374
50 Ga0075428_100179734 3300006844 Bacteria 2290
51 Ga0075428_101014727 3300006844 Bacteria 878
52 Ga0075429_100175108 3300006880 Bacteria 1880
53 Ga0097620_100428609 3300006931 Bacteria 1419
54 Ga0111539_10036979 3300009094 Bacteria 5899
55 Ga0111539_10119999 3300009094 Unclassified 3081
56 Ga0111539_10306007 3300009094 Bacteria 1850
57 Ga0111539_10947118 3300009094 Bacteria 1001
58 Ga0105245_10044830 3300009098 Bacteria 3948
59 Ga0105245_10114771 3300009098 Bacteria 2509
60 Ga0114129_10181810 3300009147 Bacteria 2860
61 Ga0114129_10254800 3300009147 Bacteria 2354
62 Ga0114129_10443727 3300009147 Bacteria 1703
63 Ga0114129_10876601 3300009147 Bacteria 1139
64 Ga0114129_10924674 3300009147 Bacteria 1104
65 Ga0114129_12789110 3300009147 Bacteria 581
66 Ga0105249_10025597 3300009553 Bacteria 5314
67 Ga0105249_10285659 3300009553 Bacteria 1649
68 Ga0105239_10454494 3300010375 Bacteria 1453
69 Ga0105239_10497834 3300010375 Bacteria 1385
70 Ga0105239_11717441 3300010375 Unclassified 727
71 Ga0105246_10023361 3300011119 Bacteria 4000
72 Ga0157371_10109597 3300013102 Bacteria 1960
73 Ga0163162_10749687 3300013306 Bacteria 1096
74 Ga0157372_10959274 3300013307 Bacteria 991
75 Ga0163161_10336635 3300017792 Bacteria 1196
76 Ga0224712_10184157 3300022467 Bacteria 942
77 Ga0207692_10885713 3300025898 Bacteria 587
78 Ga0207642_10728399 3300025899 Bacteria 626
79 Ga0207643_10261006 3300025908 Bacteria 1069
80 Ga0207646_10269146 3300025922 Bacteria 1540
81 Ga0207650_10240618 3300025925 Bacteria 1462
82 Ga0207687_10034049 3300025927 Bacteria 3457
83 Ga0207687_10240934 3300025927 Bacteria 1433
84 Ga0207687_10444347 3300025927 Bacteria 1074
85 Ga0207700_10705210 3300025928 Bacteria 901
86 Ga0207700_10927671 3300025928 Bacteria 779
87 Ga0207664_10076463 3300025929 Bacteria 2710
88 Ga0207664_10242488 3300025929 Bacteria 1570
89 Ga0207664_10318241 3300025929 Bacteria 1372
90 Ga0207690_10350860 3300025932 Bacteria 1167
91 Ga0207690_10422489 3300025932 Bacteria 1067
92 Ga0207706_10001848 3300025933 Bacteria 20745
93 Ga0207706_11231177 3300025933 Unclassified 621
94 Ga0207670_10272556 3300025936 Bacteria 1316
95 Ga0207689_10532872 3300025942 Bacteria 985
96 Ga0207661_10004084 3300025944 Bacteria 10196
97 Ga0207712_10004096 3300025961 Bacteria 9201
98 Ga0207668_10046367 3300025972 Bacteria 2969
99 Ga0207640_11417478 3300025981 Bacteria 623
100 Ga0207708_10062929 3300026075 Bacteria 2835
101 Ga0207708_10782865 3300026075 Bacteria 820
102 Ga0207674_10008051 3300026116 Bacteria 12219
103 Ga0207675_100000091 3300026118 Bacteria 70559
104 Ga0207428_10143647 3300027907 Bacteria 1820
105 Ga0265340_10089729 3300031247 Bacteria 1438
106 Ga0373926_0239811 3300035083 Bacteria 702
107 Ga0373945_0222182 3300035116 Unclassified 790
108 Ga0373935_0387072 3300035692 Unclassified 1002
109 Ga0373947_0452166 3300035725 Bacteria 870
110 Ga0395899_0016768 3300037312 Bacteria 5585
111 Ga0395899_0196282 3300037312 Bacteria 1410
112 Ga0395900_0125595 3300037418 Unclassified 2631
113 Ga0395900_0168270 3300037418 Bacteria 2233
114 Ga0395898_0030469 3300037466 Bacteria 5398
115 Ga0395898_0207816 3300037466 Bacteria 1868
116 Ga0395898_0626388 3300037466 Unclassified 1018
117 Ga0395898_1479114 3300037466 Bacteria 606
118 Ga0395905_0056211 3300037471 Bacteria 3682
119 Ga0395905_0473100 3300037471 Bacteria 1152
120 Ga0436364_0673636 3300037853 Bacteria 835
121 Ga0395901_0029246 3300038443 Bacteria 5670
122 Ga0395901_0061572 3300038443 Bacteria 3905
123 Ga0395901_0192801 3300038443 Unclassified 2137
124 Ga0395901_0310791 3300038443 Bacteria 1632
125 Ga0395901_0693961 3300038443 Bacteria 1016
126 Ga0439441_003629 3300042001 Bacteria 2289
127 Ga0450917_002991 3300042120 Bacteria 1216
128 Ga0450905_043995 3300042142 Bacteria 715
129 Ga0466969_0090971 3300044656 Bacteria 1446
130 Ga0466966_0072677 3300044684 Bacteria 2153
131 Ga0466966_0186933 3300044684 Bacteria 1256
132 Ga0466964_0860041 3300044706 Bacteria 516
133 Ga0466960_0352790 3300044901 Unclassified 839
134 Ga0466959_0028450 3300045049 Bacteria 4145
135 Ga0466959_0047167 3300045049 Bacteria 3169
136 Ga0466967_0002085 3300045976 Bacteria 12244
137 Ga0495629_0000001 3300046459 Bacteria 807972
138 Ga0495629_0151614 3300046459 Bacteria 1611
139 Ga0495641_0026803 3300046461 Unclassified 2809
140 Ga0495641_0150857 3300046461 Bacteria 1039
141 Ga0495582_0015287 3300046473 Unclassified 4218
142 Ga0495582_0295333 3300046473 Bacteria 931
143 Ga0495605_0186859 3300046474 Unclassified 909
144 Ga0495584_0208076 3300046491 Unclassified 994
145 Ga0495585_0355804 3300046492 Unclassified 711
146 Ga0495594_0648452 3300046499 Bacteria 598
147 Ga0495596_0182396 3300046500 Bacteria 816
148 Ga0495618_0267224 3300046514 Bacteria 1070
149 Ga0495630_0511544 3300046517 Bacteria 921
150 Ga0495630_1134405 3300046517 Bacteria 592
151 Ga0495663_0041704 3300046525 Bacteria 1397
152 Ga0495609_0448732 3300046538 Bacteria 513
153 Ga0495597_0300566 3300046542 Unclassified 623
154 Ga0495645_0198451 3300046543 Bacteria 1363
155 Ga0495667_0331301 3300046559 Bacteria 963
156 Ga0495656_0267498 3300046615 Bacteria 868
157 Ga0495635_0137453 3300046663 Bacteria 1665
158 Ga0495588_0131221 3300046674 Bacteria 1322
159 Ga0495658_0058995 3300046683 Unclassified 2196
160 Ga0495624_0131733 3300046690 Unclassified 1533
161 Ga0495624_0396844 3300046690 Bacteria 828
162 Ga0495671_0190860 3300046692 Unclassified 995
163 Ga0495581_0004353 3300047315 Bacteria 8174
164 Ga0495581_0374544 3300047315 Bacteria 831
165 Ga0495604_0277388 3300047317 Bacteria 1134
166 Ga0495676_0042270 3300047321 Unclassified 3743
167 Ga0501034_1159551 3300049571 Bacteria 652
168 Ga0501036_0333258 3300049572 Bacteria 1268
169 Ga0501067_0136595 3300049583 Bacteria 1365
170 Ga0501069_0069806 3300049585 Bacteria 1968
171 nmdc:mga05p37_405245_c1 3300050507 Bacteria 1591
172 nmdc:mga05p37_517543_c1 3300050507 Bacteria 1365
173 nmdc:mga05p37_593061_c1 3300050507 Bacteria 1252
174 nmdc:mga09592_630535_c1 3300050508 Bacteria 916
175 nmdc:mga0qj67_118272_c1 3300050509 Bacteria 2142
176 nmdc:mga08y16_1370338_c1 3300050511 Bacteria 672
177 nmdc:mga08y16_270450_c1 3300050511 Unclassified 1754
178 nmdc:mga08y16_563408_c1 3300050511 Bacteria 1152
179 nmdc:mga08y16_619714_c1 3300050511 Bacteria 1089
180 nmdc:mga0n895_1884058_c1 3300050512 Bacteria 557
181 nmdc:mga0n895_578208_c1 3300050512 Bacteria 1127
182 Ga0495601_0709219 3300053077 Bacteria 642
183 Ga0495619_0917461 3300053085 Bacteria 589
184 Ga0500566_0023631 3300053094 Bacteria 3609
185 Ga0590071_049957 3300059421 Bacteria 1013
186 Ga0590075_138442 3300059424 Bacteria 640
187 Ga0501082_1723324 3300060353 Unclassified 547
188 Ga0530510_0153400 3300061734 Bacteria 1702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042120 Ga0450917_002991 Ga0450917_002991_474_836 120
2 3300042142 Ga0450905_043995 Ga0450905_043995_203_565 120
3 3300037471 Ga0395905_0056211 Ga0395905_0056211_936_1307 121
4 3300038443 Ga0395901_0029246 Ga0395901_0029246_2485_2856 121
5 3300053085 Ga0495619_0917461 Ga0495619_0917461_194_562 121
6 3300060353 Ga0501082_1723324 Ga0501082_1723324_145_510 121
7 3300025899 Ga0207642_10728399 Ga0207642_107283992 122
8 3300035083 Ga0373926_0239811 Ga0373926_0239811_268_651 125
9 3300037312 Ga0395899_0196282 Ga0395899_0196282_27_404 125
10 3300037418 Ga0395900_0168270 Ga0395900_0168270_1124_1507 125
11 3300037466 Ga0395898_0626388 Ga0395898_0626388_89_472 125
12 3300037466 Ga0395898_1479114 Ga0395898_1479114_18_437 125
13 3300037471 Ga0395905_0473100 Ga0395905_0473100_639_1022 125
14 3300038443 Ga0395901_0693961 Ga0395901_0693961_294_677 125
15 3300046517 Ga0495630_1134405 Ga0495630_1134405_135_518 125
16 3300046683 Ga0495658_0058995 Ga0495658_0058995_1789_2172 125
17 3300005328 Ga0070676_10482258 Ga0070676_104822581 128
18 3300005341 Ga0070691_10335015 Ga0070691_103350152 128
19 3300005345 Ga0070692_10173312 Ga0070692_101733122 128
20 3300005347 Ga0070668_100002789 Ga0070668_10000278914 128
21 3300005356 Ga0070674_101385662 Ga0070674_1013856621 128
22 3300005366 Ga0070659_100791726 Ga0070659_1007917261 128
23 3300005441 Ga0070700_100017709 Ga0070700_1000177093 128
24 3300005457 Ga0070662_100001417 Ga0070662_1000014174 128
25 3300005546 Ga0070696_100005313 Ga0070696_1000053132 128
26 3300005615 Ga0070702_100215726 Ga0070702_1002157262 128
27 3300005615 Ga0070702_100339965 Ga0070702_1003399651 128
28 3300005616 Ga0068852_101075764 Ga0068852_1010757641 128
29 3300005719 Ga0068861_100009957 Ga0068861_1000099578 128
30 3300006844 Ga0075428_100179734 Ga0075428_1001797342 128
31 3300009094 Ga0111539_10306007 Ga0111539_103060072 128
32 3300009094 Ga0111539_10947118 Ga0111539_109471181 128
33 3300009098 Ga0105245_10044830 Ga0105245_100448305 128
34 3300009553 Ga0105249_10025597 Ga0105249_100255971 128
35 3300010375 Ga0105239_10454494 Ga0105239_104544942 128
36 3300013102 Ga0157371_10109597 Ga0157371_101095973 128
37 3300013306 Ga0163162_10749687 Ga0163162_107496871 128
38 3300013307 Ga0157372_10959274 Ga0157372_109592742 128
39 3300017792 Ga0163161_10336635 Ga0163161_103366352 128
40 3300025927 Ga0207687_10240934 Ga0207687_102409342 128
41 3300025932 Ga0207690_10350860 Ga0207690_103508603 128
42 3300025932 Ga0207690_10422489 Ga0207690_104224892 128
43 3300025933 Ga0207706_10001848 Ga0207706_1000184813 128
44 3300025961 Ga0207712_10004096 Ga0207712_1000409610 128
45 3300025972 Ga0207668_10046367 Ga0207668_100463674 128
46 3300025981 Ga0207640_11417478 Ga0207640_114174781 128
47 3300026075 Ga0207708_10062929 Ga0207708_100629294 128
48 3300026118 Ga0207675_100000091 Ga0207675_10000009147 128
49 3300046500 Ga0495596_0182396 Ga0495596_0182396_194_580 128
50 3300046538 Ga0495609_0448732 Ga0495609_0448732_117_503 128
51 3300046615 Ga0495656_0267498 Ga0495656_0267498_200_586 128
52 3300050511 nmdc:mga08y16_563408_c1 nmdc:mga08y16_563408_c1_560_946 128
53 3300050511 nmdc:mga08y16_619714_c1 nmdc:mga08y16_619714_c1_107_493 128
54 3300050512 nmdc:mga0n895_578208_c1 nmdc:mga0n895_578208_c1_183_569 128
55 3300005445 Ga0070708_100069206 Ga0070708_1000692063 129
56 3300005467 Ga0070706_100488179 Ga0070706_1004881791 129
57 3300005468 Ga0070707_100165119 Ga0070707_1001651193 129
58 3300005518 Ga0070699_100558618 Ga0070699_1005586182 129
59 3300025922 Ga0207646_10269146 Ga0207646_102691461 129
60 3300038443 Ga0395901_0192801 Ga0395901_0192801_1255_1650 131
61 3300037466 Ga0395898_0207816 Ga0395898_0207816_199_603 133
62 3300038443 Ga0395901_0061572 Ga0395901_0061572_480_884 133
63 3300005341 Ga0070691_10320739 Ga0070691_103207392 134
64 3300005459 Ga0068867_100259809 Ga0068867_1002598092 134
65 3300005544 Ga0070686_100163296 Ga0070686_1001632962 134
66 3300005545 Ga0070695_100336783 Ga0070695_1003367832 134
67 3300005564 Ga0070664_100029746 Ga0070664_1000297466 134
68 3300005617 Ga0068859_100428613 Ga0068859_1004286133 134
69 3300006844 Ga0075428_101014727 Ga0075428_1010147272 134
70 3300006931 Ga0097620_100428609 Ga0097620_1004286091 134
71 3300009098 Ga0105245_10114771 Ga0105245_101147713 134
72 3300009147 Ga0114129_10443727 Ga0114129_104437272 134
73 3300025927 Ga0207687_10034049 Ga0207687_100340495 134
74 3300025942 Ga0207689_10532872 Ga0207689_105328721 134
75 3300026075 Ga0207708_10782865 Ga0207708_107828652 134
76 3300035116 Ga0373945_0222182 Ga0373945_0222182_90_494 134
77 3300035692 Ga0373935_0387072 Ga0373935_0387072_218_622 134
78 3300035725 Ga0373947_0452166 Ga0373947_0452166_120_524 134
79 3300046459 Ga0495629_0000001 Ga0495629_0000001_102559_102963 134
80 3300046473 Ga0495582_0295333 Ga0495582_0295333_226_630 134
81 3300046690 Ga0495624_0396844 Ga0495624_0396844_383_787 134
82 3300050507 nmdc:mga05p37_405245_c1 nmdc:mga05p37_405245_c1_713_1117 134
83 3300050508 nmdc:mga09592_630535_c1 nmdc:mga09592_630535_c1_116_520 134
84 3300053094 Ga0500566_0023631 Ga0500566_0023631_1870_2274 134
85 3300049583 Ga0501067_0136595 Ga0501067_0136595_232_639 135
86 3300059421 Ga0590071_049957 Ga0590071_049957_361_768 135
87 3300059424 Ga0590075_138442 Ga0590075_138442_212_619 135
88 3300061734 Ga0530510_0153400 Ga0530510_0153400_377_784 135
89 3300046674 Ga0495588_0131221 Ga0495588_0131221_265_681 136
90 3300005327 Ga0070658_10144974 Ga0070658_101449742 137
91 3300005344 Ga0070661_100398571 Ga0070661_1003985713 137
92 3300005444 Ga0070694_100603752 Ga0070694_1006037521 137
93 3300005985 Ga0081539_10000477 Ga0081539_100004778 137
94 3300006880 Ga0075429_100175108 Ga0075429_1001751083 137
95 3300009094 Ga0111539_10119999 Ga0111539_1011999915 137
96 3300009147 Ga0114129_10181810 Ga0114129_101818102 137
97 3300009147 Ga0114129_10876601 Ga0114129_108766012 137
98 3300027907 Ga0207428_10143647 Ga0207428_101436472 137
99 3300037853 Ga0436364_0673636 Ga0436364_0673636_285_698 137
100 3300042001 Ga0439441_003629 Ga0439441_003629_1428_1841 137
101 3300044901 Ga0466960_0352790 Ga0466960_0352790_409_825 137
102 3300050507 nmdc:mga05p37_517543_c1 nmdc:mga05p37_517543_c1_681_1094 137
103 3300050507 nmdc:mga05p37_593061_c1 nmdc:mga05p37_593061_c1_745_1158 137
104 3300050511 nmdc:mga08y16_1370338_c1 nmdc:mga08y16_1370338_c1_187_600 137
105 3300053077 Ga0495601_0709219 Ga0495601_0709219_194_613 137
106 3300005295 Ga0065707_10014266 Ga0065707_100142662 138
107 3300005340 Ga0070689_100494022 Ga0070689_1004940222 138
108 3300009147 Ga0114129_10254800 Ga0114129_102548003 138
109 3300009147 Ga0114129_10924674 Ga0114129_109246742 138
110 3300025933 Ga0207706_11231177 Ga0207706_112311771 138
111 3300025936 Ga0207670_10272556 Ga0207670_102725562 138
112 3300037312 Ga0395899_0016768 Ga0395899_0016768_76_498 138
113 3300037418 Ga0395900_0125595 Ga0395900_0125595_227_649 138
114 3300037466 Ga0395898_0030469 Ga0395898_0030469_2493_2915 138
115 3300046461 Ga0495641_0026803 Ga0495641_0026803_2223_2645 138
116 3300046473 Ga0495582_0015287 Ga0495582_0015287_2210_2632 138
117 3300046474 Ga0495605_0186859 Ga0495605_0186859_228_650 138
118 3300046491 Ga0495584_0208076 Ga0495584_0208076_44_466 138
119 3300046499 Ga0495594_0648452 Ga0495594_0648452_14_436 138
120 3300046690 Ga0495624_0131733 Ga0495624_0131733_628_1050 138
121 3300047315 Ga0495581_0004353 Ga0495581_0004353_4224_4646 138
122 3300047321 Ga0495676_0042270 Ga0495676_0042270_710_1132 138
123 3300050509 nmdc:mga0qj67_118272_c1 nmdc:mga0qj67_118272_c1_1448_1864 138
124 3300005435 Ga0070714_100354285 Ga0070714_1003542852 139
125 3300005435 Ga0070714_100807507 Ga0070714_1008075071 139
126 3300005436 Ga0070713_100066594 Ga0070713_1000665943 139
127 3300005436 Ga0070713_100868141 Ga0070713_1008681412 139
128 3300005437 Ga0070710_10535216 Ga0070710_105352162 139
129 3300005937 Ga0081455_10015868 Ga0081455_100158685 139
130 3300006028 Ga0070717_10031792 Ga0070717_100317923 139
131 3300006028 Ga0070717_10032715 Ga0070717_100327153 139
132 3300006028 Ga0070717_10131498 Ga0070717_101314983 139
133 3300006028 Ga0070717_10131867 Ga0070717_101318672 139
134 3300009094 Ga0111539_10036979 Ga0111539_100369793 139
135 3300009147 Ga0114129_12789110 Ga0114129_127891101 139
136 3300010375 Ga0105239_11717441 Ga0105239_117174411 139
137 3300022467 Ga0224712_10184157 Ga0224712_101841572 139
138 3300025898 Ga0207692_10885713 Ga0207692_108857131 139
139 3300025928 Ga0207700_10705210 Ga0207700_107052102 139
140 3300025928 Ga0207700_10927671 Ga0207700_109276711 139
141 3300025929 Ga0207664_10076463 Ga0207664_100764633 139
142 3300025929 Ga0207664_10242488 Ga0207664_102424882 139
143 3300025929 Ga0207664_10318241 Ga0207664_103182412 139
144 3300031247 Ga0265340_10089729 Ga0265340_100897292 139
145 3300038443 Ga0395901_0310791 Ga0395901_0310791_413_832 139
146 3300044706 Ga0466964_0860041 Ga0466964_0860041_50_490 139
147 3300045049 Ga0466959_0047167 Ga0466959_0047167_1487_1990 139
148 3300045976 Ga0466967_0002085 Ga0466967_0002085_11205_11663 139
149 3300046459 Ga0495629_0151614 Ga0495629_0151614_199_639 139
150 3300046461 Ga0495641_0150857 Ga0495641_0150857_40_480 139
151 3300046492 Ga0495585_0355804 Ga0495585_0355804_19_444 139
152 3300046514 Ga0495618_0267224 Ga0495618_0267224_133_573 139
153 3300046517 Ga0495630_0511544 Ga0495630_0511544_315_755 139
154 3300046525 Ga0495663_0041704 Ga0495663_0041704_473_898 139
155 3300046542 Ga0495597_0300566 Ga0495597_0300566_103_528 139
156 3300046543 Ga0495645_0198451 Ga0495645_0198451_363_812 139
157 3300046559 Ga0495667_0331301 Ga0495667_0331301_151_591 139
158 3300046663 Ga0495635_0137453 Ga0495635_0137453_29_454 139
159 3300046692 Ga0495671_0190860 Ga0495671_0190860_117_542 139
160 3300047315 Ga0495581_0374544 Ga0495581_0374544_166_606 139
161 3300047317 Ga0495604_0277388 Ga0495604_0277388_420_860 139
162 3300049572 Ga0501036_0333258 Ga0501036_0333258_204_641 139
163 3300050511 nmdc:mga08y16_270450_c1 nmdc:mga08y16_270450_c1_783_1208 139
164 3300006175 Ga0070712_100079205 Ga0070712_1000792054 140
165 3300044656 Ga0466969_0090971 Ga0466969_0090971_681_1103 140
166 3300045049 Ga0466959_0028450 Ga0466959_0028450_2925_3347 140
167 3300044684 Ga0466966_0072677 Ga0466966_0072677_220_645 141
168 3300044684 Ga0466966_0186933 Ga0466966_0186933_141_566 141
169 3300002459 JGI24751J29686_10101918 JGI24751J29686_101019181 142
170 3300005329 Ga0070683_100001475 Ga0070683_10000147510 142
171 3300005331 Ga0070670_100942085 Ga0070670_1009420852 142
172 3300005337 Ga0070682_100670106 Ga0070682_1006701062 142
173 3300005354 Ga0070675_100088883 Ga0070675_1000888833 142
174 3300005455 Ga0070663_100773511 Ga0070663_1007735112 142
175 3300005466 Ga0070685_10356291 Ga0070685_103562911 142
176 3300005535 Ga0070684_100000300 Ga0070684_10000030025 142
177 3300005577 Ga0068857_100002311 Ga0068857_10000231112 142
178 3300009553 Ga0105249_10285659 Ga0105249_102856592 142
179 3300010375 Ga0105239_10497834 Ga0105239_104978342 142
180 3300011119 Ga0105246_10023361 Ga0105246_100233614 142
181 3300025908 Ga0207643_10261006 Ga0207643_102610062 142
182 3300025925 Ga0207650_10240618 Ga0207650_102406182 142
183 3300025927 Ga0207687_10444347 Ga0207687_104443472 142
184 3300025944 Ga0207661_10004084 Ga0207661_1000408410 142
185 3300026116 Ga0207674_10008051 Ga0207674_100080515 142
186 3300049571 Ga0501034_1159551 Ga0501034_1159551_62_496 142
187 3300049585 Ga0501069_0069806 Ga0501069_0069806_1023_1457 142
188 3300050512 nmdc:mga0n895_1884058_c1 nmdc:mga0n895_1884058_c1_31_465 142

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04828

GFA

Glutathione-dependent formaldehyde-activating enzyme

42

130

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7907 8 141
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7663 2 139
3fac-assembly8.cif.gz_H crystal structure of rhodobacter sphaeroides protein rsp_2168. northeast structural genomics target rhr83. 0.7493 10 111
1xa8-assembly1.cif.gz_A crystal structure analysis of glutathione-dependent formaldehyde-activating enzyme (gfa) 0.7422 2 139
8ajq-assembly3.cif.gz_E crystal structure of pa2722 from pseudomonas aeruginosa pao1 0.7332 8 141
ID Description Score Start End Superfamily
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.8426 7 135 3.90.1590.10
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.8127 10 106 2.170.150.70
af_O14034_2_133_3.90.1590.10 Alpha Beta;Alpha-Beta Complex;glutathione-dependent formaldehyde- activating enzyme (gfa);glutathione-dependent formaldehyde- activating enzyme (gfa) 0.797 7 135 3.90.1590.10
af_Q54VC9_11_133_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7883 11 105 2.170.150.70
af_A0A1D6EPM0_14_114_2.170.150.70 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A; 0.7698 10 106 2.170.150.70
ID Description Score Start End GO Terms
AF-A0A1F2WC68-F1-model_v4 CENP-V/GFA domain-containing protein 0.9367 11 141 GO:0016846
GO:0046872
AF-A0A3C1ADG1-F1-model_v4 deleted 0.935 4 87
AF-A0A2E8WLV7-F1-model_v4 CENP-V/GFA domain-containing protein 0.9296 10 85 GO:0016846
GO:0046872
AF-A0A3C1ADG1-F1-model_v4 deleted 0.9245 4 87
AF-A0A538EP70-F1-model_v4 GFA family protein 0.9233 4 142 GO:0016846
GO:0046872

Feature Viewer

pLDDT pTM Quality
89.21 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map