F289614

General Info

Members Datasets Scaffolds Average Seq Length
188 79 376 143

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10282884|Ga0316578_102828842
Length 153
Sequence MPIRVEIVSEDRMVYEGQADIVVVPGVGGEMGILPNHAPLISTLGFGILKVRLAGEEEVFTISGGIVEVQPDIVTVLASAAENVREIDLSRAEEARRXXXXLLKEGPPPDTDTYLALEAALRRSNLRLDAARRFRRTTRQRMPGGSGGSSETS

Samples

Sample ID Description Type Environment
1 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
8 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
9 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
10 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
11 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
12 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
13 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
14 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
15 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
16 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
17 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
18 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
19 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
20 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
21 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
22 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
23 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
24 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
25 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
32 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
35 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
36 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
37 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
38 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
39 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
40 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
41 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
42 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
43 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
44 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
45 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
46 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
51 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
52 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
53 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
54 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
55 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
56 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
57 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
58 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
59 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
60 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
61 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
62 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
63 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
64 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
65 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
66 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
67 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
68 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
69 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
70 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
71 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
72 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
73 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
74 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
75 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
76 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
77 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
78 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
79 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 100
Stem 0
Stem Tuber 0
Unclassified 22.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316578_10282884 3300031728 Unclassified 993
2 SwRhRL2b_contig_719764 2162886007 Unclassified 1206
3 Ga0065707_10000501 3300005295 Bacteria 47733
4 Ga0065707_10088930 3300005295 Bacteria 4511
5 Ga0070680_100691856 3300005336 Bacteria 877
6 Ga0070689_100591609 3300005340 Bacteria 960
7 Ga0070667_101449691 3300005367 Bacteria 644
8 Ga0070701_10332035 3300005438 Unclassified 944
9 Ga0070700_100473533 3300005441 Unclassified 958
10 Ga0070708_102187464 3300005445 Bacteria 511
11 Ga0070698_100315944 3300005471 Unclassified 1493
12 Ga0070698_101031667 3300005471 Bacteria 770
13 Ga0068859_100013783 3300005617 Bacteria 8106
14 Ga0068859_100256457 3300005617 Bacteria 1839
15 Ga0068864_100135063 3300005618 Bacteria 2220
16 Ga0068860_101972833 3300005843 Unclassified 605
17 Ga0068862_100018350 3300005844 Bacteria 5826
18 Ga0075428_100186400 3300006844 Bacteria 2245
19 Ga0075428_100552377 3300006844 Bacteria 1231
20 Ga0075428_100774005 3300006844 Bacteria 1021
21 Ga0075428_100915183 3300006844 Bacteria 930
22 Ga0075428_101273286 3300006844 Bacteria 774
23 Ga0075430_100034051 3300006846 Bacteria 4323
24 Ga0075431_100028799 3300006847 Bacteria 5710
25 Ga0075431_100268982 3300006847 Bacteria 1728
26 Ga0075431_100477394 3300006847 Unclassified 1240
27 Ga0075431_101128679 3300006847 Unclassified 748
28 Ga0075433_10374775 3300006852 Bacteria 1257
29 Ga0075434_100636932 3300006871 Bacteria 1085
30 Ga0075429_100001636 3300006880 Bacteria 18518
31 Ga0075429_100036010 3300006880 Bacteria 4304
32 Ga0075429_100086245 3300006880 Unclassified 2737
33 Ga0075429_101181993 3300006880 Bacteria 668
34 Ga0097620_100013783 3300006931 Bacteria 8106
35 Ga0097620_100256461 3300006931 Bacteria 1839
36 Ga0105245_10790730 3300009098 Bacteria 986
37 Ga0114129_10000832 3300009147 Bacteria 39897
38 Ga0114129_10129040 3300009147 Bacteria 3474
39 Ga0114129_10173572 3300009147 Bacteria 2937
40 Ga0114129_10652379 3300009147 Bacteria 1358
41 Ga0114129_10680083 3300009147 Bacteria 1325
42 Ga0114129_11389150 3300009147 Bacteria 867
43 Ga0114129_12259289 3300009147 Unclassified 654
44 Ga0105241_10527041 3300009174 Unclassified 1057
45 Ga0105246_10166201 3300011119 Bacteria 1685
46 Ga0157379_10535252 3300014968 Bacteria 1089
47 Ga0207643_10028075 3300025908 Bacteria 3123
48 Ga0207660_10887301 3300025917 Bacteria 728
49 Ga0207670_10339189 3300025936 Unclassified 1187
50 Ga0207708_10553868 3300026075 Unclassified 970
51 Ga0207676_10079793 3300026095 Bacteria 2655
52 Ga0207674_10767851 3300026116 Unclassified 930
53 Ga0268265_10104246 3300028380 Unclassified 2298
54 Ga0265334_10021822 3300028573 Bacteria 2613
55 Ga0316575_10009228 3300031665 Bacteria 3611
56 Ga0316575_10017075 3300031665 Bacteria 2753
57 Ga0316575_10281162 3300031665 Unclassified 702
58 Ga0316579_10011722 3300031691 Bacteria 3733
59 Ga0316579_10307491 3300031691 Bacteria 766
60 Ga0316576_10080800 3300031727 Unclassified 2412
61 Ga0316578_10015183 3300031728 Bacteria 4136
62 Ga0316578_10079962 3300031728 Bacteria 1944
63 Ga0316578_10357788 3300031728 Unclassified 868
64 Ga0307405_10637188 3300031731 Unclassified 875
65 Ga0316577_10002553 3300031733 Bacteria 9055
66 Ga0316577_10037376 3300031733 Bacteria 2715
67 Ga0316577_10109098 3300031733 Bacteria 1553
68 Ga0316577_10459857 3300031733 Unclassified 723
69 Ga0307406_10306227 3300031901 Bacteria 1223
70 Ga0307409_102261698 3300031995 Unclassified 573
71 Ga0307415_100790997 3300032126 Bacteria 865
72 Ga0316583_10198273 3300032133 Unclassified 697
73 Ga0316583_10202011 3300032133 Unclassified 690
74 Ga0316585_10036016 3300032137 Bacteria 1568
75 Ga0316593_10008203 3300032168 Bacteria 2902
76 Ga0316593_10055681 3300032168 Bacteria 1344
77 Ga0316596_1120081 3300033541 Bacteria 715
78 Ga0316574_0002794 3300035398 Bacteria 8869
79 Ga0316574_0322960 3300035398 Unclassified 979
80 Ga0316574_0540637 3300035398 Unclassified 724
81 Ga0316582_0011665 3300036647 Bacteria 4869
82 Ga0316582_0016118 3300036647 Bacteria 4291
83 Ga0316582_0054934 3300036647 Bacteria 2537
84 Ga0316582_0134246 3300036647 Bacteria 1665
85 Ga0316582_0234295 3300036647 Bacteria 1257
86 Ga0316582_0715801 3300036647 Unclassified 687
87 Ga0316582_1188515 3300036647 Unclassified 519
88 Ga0316584_0021194 3300036712 Bacteria 4720
89 Ga0316584_0033616 3300036712 Bacteria 3799
90 Ga0316584_0140863 3300036712 Bacteria 1798
91 Ga0316584_0193004 3300036712 Bacteria 1505
92 Ga0316584_0467939 3300036712 Bacteria 889
93 Ga0316584_0891610 3300036712 Bacteria 599
94 Ga0316581_0009916 3300037588 Bacteria 2629
95 Ga0451577_0106139 3300042876 Bacteria 2511
96 Ga0451577_0251255 3300042876 Bacteria 1601
97 Ga0451577_0278899 3300042876 Bacteria 1514
98 Ga0451577_0407266 3300042876 Bacteria 1234
99 Ga0451577_0568244 3300042876 Bacteria 1029
100 Ga0451577_1385139 3300042876 Unclassified 624
101 Ga0453683_0013166 3300044673 Bacteria 5409
102 Ga0453683_0024128 3300044673 Bacteria 3873
103 Ga0453683_0096767 3300044673 Bacteria 1852
104 Ga0453683_0147991 3300044673 Bacteria 1483
105 Ga0453683_0160123 3300044673 Bacteria 1424
106 Ga0453683_0504627 3300044673 Bacteria 785
107 Ga0453684_0001019 3300044712 Bacteria 90275
108 Ga0453684_0001029 3300044712 Bacteria 89157
109 Ga0453684_0001056 3300044712 Bacteria 87692
110 Ga0453684_0001322 3300044712 Bacteria 73247
111 Ga0453684_0004391 3300044712 Bacteria 29844
112 Ga0453684_0006588 3300044712 Bacteria 21965
113 Ga0453684_0032307 3300044712 Bacteria 7330
114 Ga0453684_0053325 3300044712 Bacteria 5279
115 Ga0453684_0077780 3300044712 Bacteria 4155
116 Ga0453684_0090942 3300044712 Bacteria 3770
117 Ga0453684_0104050 3300044712 Bacteria 3467
118 Ga0453684_0123431 3300044712 Bacteria 3122
119 Ga0453684_0131910 3300044712 Bacteria 2997
120 Ga0453684_0175542 3300044712 Bacteria 2520
121 Ga0453684_0177570 3300044712 Bacteria 2503
122 Ga0453684_0188374 3300044712 Bacteria 2415
123 Ga0453684_0245221 3300044712 Bacteria 2060
124 Ga0453684_0277034 3300044712 Bacteria 1914
125 Ga0453684_0281809 3300044712 Bacteria 1895
126 Ga0453684_0293108 3300044712 Bacteria 1852
127 Ga0453684_0352768 3300044712 Bacteria 1658
128 Ga0453684_0389906 3300044712 Bacteria 1562
129 Ga0453684_0772316 3300044712 Bacteria 1038
130 Ga0453684_1210357 3300044712 Bacteria 792
131 Ga0453684_1280767 3300044712 Unclassified 766
132 Ga0453684_1525621 3300044712 Bacteria 688
133 Ga0453684_2043799 3300044712 Unclassified 576
134 Ga0453684_2437405 3300044712 Bacteria 517
135 Ga0451576_0086469 3300045051 Bacteria 3261
136 Ga0451576_0153163 3300045051 Bacteria 2404
137 Ga0451576_0198681 3300045051 Bacteria 2094
138 Ga0451576_0222860 3300045051 Bacteria 1969
139 Ga0451576_0385809 3300045051 Bacteria 1468
140 Ga0501292_005963 3300049515 Bacteria 1718
141 Ga0501298_017117 3300049521 Bacteria 1320
142 Ga0501040_0475020 3300049576 Unclassified 901
143 Ga0501040_0524405 3300049576 Unclassified 854
144 Ga0501041_0254894 3300049577 Bacteria 1103
145 Ga0501042_1092188 3300049578 Unclassified 582
146 Ga0501048_0135978 3300049582 Bacteria 1737
147 Ga0501048_0696200 3300049582 Bacteria 730
148 Ga0501069_0981742 3300049585 Unclassified 515
149 Ga0501071_0328052 3300049587 Bacteria 1163
150 Ga0501071_0642214 3300049587 Bacteria 817
151 Ga0501074_0217073 3300049590 Bacteria 1362
152 Ga0501074_0233054 3300049590 Bacteria 1311
153 Ga0501075_0024082 3300049591 Bacteria 4458
154 Ga0501075_0784164 3300049591 Unclassified 725
155 Ga0501076_0119634 3300049592 Bacteria 2132
156 Ga0501076_0213853 3300049592 Bacteria 1576
157 Ga0501076_0529028 3300049592 Bacteria 972
158 Ga0501227_016454 3300049665 Bacteria 1662
159 Ga0501079_0119713 3300049741 Bacteria 2047
160 Ga0501079_0271849 3300049741 Bacteria 1325
161 Ga0501079_0664509 3300049741 Bacteria 820
162 Ga0501079_1071539 3300049741 Bacteria 635
163 Ga0501080_0423552 3300049742 Bacteria 1196
164 Ga0501081_0095636 3300049743 Bacteria 2094
165 Ga0501081_0346904 3300049743 Bacteria 1094
166 Ga0501045_0119454 3300049824 Bacteria 1957
167 nmdc:mga05p37_234_c1 3300050507 Bacteria 56385
168 nmdc:mga05p37_272191_c1 3300050507 Unclassified 2023
169 nmdc:mga05p37_548566_c1 3300050507 Bacteria 1316
170 nmdc:mga05p37_571741_c1 3300050507 Bacteria 1282
171 nmdc:mga05p37_853783_c1 3300050507 Unclassified 988
172 nmdc:mga09592_105423_c1 3300050508 Bacteria 2417
173 nmdc:mga09592_130822_c1 3300050508 Bacteria 2159
174 nmdc:mga09592_137726_c1 3300050508 Bacteria 2103
175 nmdc:mga09592_33783_c1 3300050508 Bacteria 4272
176 nmdc:mga09592_631696_c1 3300050508 Bacteria 915
177 nmdc:mga09592_93010_c1 3300050508 Unclassified 2578
178 nmdc:mga0qj67_266904_c1 3300050509 Bacteria 1388
179 nmdc:mga0qj67_493546_c1 3300050509 Unclassified 984
180 nmdc:mga06r32_110242_c1 3300050510 Bacteria 2707
181 nmdc:mga06r32_429308_c1 3300050510 Unclassified 1302
182 nmdc:mga0n895_230797_c1 3300050512 Bacteria 1878
183 nmdc:mga0n895_965112_c1 3300050512 Unclassified 835
184 nmdc:mga0a205_478193_c1 3300050515 Bacteria 1104
185 nmdc:mga0a205_675809_c1 3300050515 Bacteria 883
186 Ga0501084_0388338 3300054114 Unclassified 1179
187 Ga0501082_0096047 3300060353 Bacteria 2562
188 Ga0530510_0192062 3300061734 Unclassified 1516
189 Ga0316578_10282884
190 SwRhRL2b_contig_719764
191 Ga0065707_10000501
192 Ga0065707_10088930
193 Ga0070680_100691856
194 Ga0070689_100591609
195 Ga0070667_101449691
196 Ga0070701_10332035
197 Ga0070700_100473533
198 Ga0070708_102187464
199 Ga0070698_100315944
200 Ga0070698_101031667
201 Ga0068859_100013783
202 Ga0068859_100256457
203 Ga0068864_100135063
204 Ga0068860_101972833
205 Ga0068862_100018350
206 Ga0075428_100186400
207 Ga0075428_100552377
208 Ga0075428_100774005
209 Ga0075428_100915183
210 Ga0075428_101273286
211 Ga0075430_100034051
212 Ga0075431_100028799
213 Ga0075431_100268982
214 Ga0075431_100477394
215 Ga0075431_101128679
216 Ga0075433_10374775
217 Ga0075434_100636932
218 Ga0075429_100001636
219 Ga0075429_100036010
220 Ga0075429_100086245
221 Ga0075429_101181993
222 Ga0097620_100013783
223 Ga0097620_100256461
224 Ga0105245_10790730
225 Ga0114129_10000832
226 Ga0114129_10129040
227 Ga0114129_10173572
228 Ga0114129_10652379
229 Ga0114129_10680083
230 Ga0114129_11389150
231 Ga0114129_12259289
232 Ga0105241_10527041
233 Ga0105246_10166201
234 Ga0157379_10535252
235 Ga0207643_10028075
236 Ga0207660_10887301
237 Ga0207670_10339189
238 Ga0207708_10553868
239 Ga0207676_10079793
240 Ga0207674_10767851
241 Ga0268265_10104246
242 Ga0265334_10021822
243 Ga0316575_10009228
244 Ga0316575_10017075
245 Ga0316575_10281162
246 Ga0316579_10011722
247 Ga0316579_10307491
248 Ga0316576_10080800
249 Ga0316578_10015183
250 Ga0316578_10079962
251 Ga0316578_10357788
252 Ga0307405_10637188
253 Ga0316577_10002553
254 Ga0316577_10037376
255 Ga0316577_10109098
256 Ga0316577_10459857
257 Ga0307406_10306227
258 Ga0307409_102261698
259 Ga0307415_100790997
260 Ga0316583_10198273
261 Ga0316583_10202011
262 Ga0316585_10036016
263 Ga0316593_10008203
264 Ga0316593_10055681
265 Ga0316596_1120081
266 Ga0316574_0002794
267 Ga0316574_0322960
268 Ga0316574_0540637
269 Ga0316582_0011665
270 Ga0316582_0016118
271 Ga0316582_0054934
272 Ga0316582_0134246
273 Ga0316582_0234295
274 Ga0316582_0715801
275 Ga0316582_1188515
276 Ga0316584_0021194
277 Ga0316584_0033616
278 Ga0316584_0140863
279 Ga0316584_0193004
280 Ga0316584_0467939
281 Ga0316584_0891610
282 Ga0316581_0009916
283 Ga0451577_0106139
284 Ga0451577_0251255
285 Ga0451577_0278899
286 Ga0451577_0407266
287 Ga0451577_0568244
288 Ga0451577_1385139
289 Ga0453683_0013166
290 Ga0453683_0024128
291 Ga0453683_0096767
292 Ga0453683_0147991
293 Ga0453683_0160123
294 Ga0453683_0504627
295 Ga0453684_0001019
296 Ga0453684_0001029
297 Ga0453684_0001056
298 Ga0453684_0001322
299 Ga0453684_0004391
300 Ga0453684_0006588
301 Ga0453684_0032307
302 Ga0453684_0053325
303 Ga0453684_0077780
304 Ga0453684_0090942
305 Ga0453684_0104050
306 Ga0453684_0123431
307 Ga0453684_0131910
308 Ga0453684_0175542
309 Ga0453684_0177570
310 Ga0453684_0188374
311 Ga0453684_0245221
312 Ga0453684_0277034
313 Ga0453684_0281809
314 Ga0453684_0293108
315 Ga0453684_0352768
316 Ga0453684_0389906
317 Ga0453684_0772316
318 Ga0453684_1210357
319 Ga0453684_1280767
320 Ga0453684_1525621
321 Ga0453684_2043799
322 Ga0453684_2437405
323 Ga0451576_0086469
324 Ga0451576_0153163
325 Ga0451576_0198681
326 Ga0451576_0222860
327 Ga0451576_0385809
328 Ga0501292_005963
329 Ga0501298_017117
330 Ga0501040_0475020
331 Ga0501040_0524405
332 Ga0501041_0254894
333 Ga0501042_1092188
334 Ga0501048_0135978
335 Ga0501048_0696200
336 Ga0501069_0981742
337 Ga0501071_0328052
338 Ga0501071_0642214
339 Ga0501074_0217073
340 Ga0501074_0233054
341 Ga0501075_0024082
342 Ga0501075_0784164
343 Ga0501076_0119634
344 Ga0501076_0213853
345 Ga0501076_0529028
346 Ga0501227_016454
347 Ga0501079_0119713
348 Ga0501079_0271849
349 Ga0501079_0664509
350 Ga0501079_1071539
351 Ga0501080_0423552
352 Ga0501081_0095636
353 Ga0501081_0346904
354 Ga0501045_0119454
355 nmdc:mga05p37_234_c1
356 nmdc:mga05p37_272191_c1
357 nmdc:mga05p37_548566_c1
358 nmdc:mga05p37_571741_c1
359 nmdc:mga05p37_853783_c1
360 nmdc:mga09592_105423_c1
361 nmdc:mga09592_130822_c1
362 nmdc:mga09592_137726_c1
363 nmdc:mga09592_33783_c1
364 nmdc:mga09592_631696_c1
365 nmdc:mga09592_93010_c1
366 nmdc:mga0qj67_266904_c1
367 nmdc:mga0qj67_493546_c1
368 nmdc:mga06r32_110242_c1
369 nmdc:mga06r32_429308_c1
370 nmdc:mga0n895_230797_c1
371 nmdc:mga0n895_965112_c1
372 nmdc:mga0a205_478193_c1
373 nmdc:mga0a205_675809_c1
374 Ga0501084_0388338
375 Ga0501082_0096047
376 Ga0530510_0192062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02823

ATP-synt_DE_N

ATP synthase, Delta/Epsilon chain, beta-sandwich domain

3

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6so5-assembly1.cif.gz_D homo sapiens wrb/caml heterotetramer in complex with a trc40 dimer 0.8928 72 116
8cqz-assembly1.cif.gz_B homo sapiens get3 in complex with the get1 cytoplasmic domain 0.866 72 114
7nk9-assembly1.cif.gz_H mycobacterium smegmatis atp synthase fo domain state 1 0.8271 19 68
5dn6-assembly1.cif.gz_I atp synthase from paracoccus denitrificans 0.7881 8 68
8dbs-assembly1.cif.gz_H "e. coli atp synthase imaged in 10mm mgatp state2 ""half-up"" fo classified" 0.7877 6 71
ID Description Score Start End Superfamily
af_A0A1D8PFW4_140_906_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9078 72 102 1.25.10.10
af_A0A0R0KXY9_13_77_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.8589 24 71 2.60.15.10
af_P00835_1_88_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.8477 1 68 2.60.15.10
af_A0A0R0H8M3_1_64_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.8254 1 61 2.60.15.10
af_A4I651_36_136_2.60.15.10 Mainly Beta;Sandwich;ATP Synthase; domain 1;F0F1 ATP synthase delta/epsilon subunit, N-terminal 0.8218 2 68 2.60.15.10
ID Description Score Start End GO Terms
AF-A0A3T1E2A9-F1-model_v4 deleted 0.9283 2 69
AF-D6PCV5-F1-model_v4 ATP synthase F1 complex delta/epsilon subunit N-terminal domain-containing protein 0.9008 2 69 GO:0012505
GO:0045261
GO:0046933
AF-A0A838P4S8-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.8885 14 68 GO:0012505
GO:0045261
GO:0046933
AF-A0A533J4A4-F1-model_v4 deleted 0.8657 1 65
AF-A0A838P4S8-F1-model_v4 F0F1 ATP synthase subunit epsilon 0.8605 14 68 GO:0012505
GO:0045261
GO:0046933

Map