F289447

General Info

Members Datasets Scaffolds Average Seq Length
188 137 376 363

Family's Representative Sequence

Representative Sequence 3300021361|Ga0213872_10038544|Ga0213872_100385442
Length 387
Sequence MLMAPNRHFQFSRSEMTIKEKLWHVSWSFVVLIAIVCSIGFMTLYSAANGSLEPWAARQMMHFTAGMTVMLAVALVDIRSWMRWSYALYAISLVLLIAVQIKGSVLKGGQRWIDLGFIQLQPSEIMKITLVLALARYFHGASYQEVGRPVFLLPPVLMVLLPVGLVLKQPDLGTAMMLAFSSGALLFLAGVRLWKFALVLAAAAGVAPIAWKFMRDYQKNRILTFLNPENDPLGTGYHILQSKIALGSGGVFGKGFMQGTQSHLNFLPEKQTDFIFTMLAEEWGLVGGVVLVGLYTLILVYGYALSMKSRNHFGRLTGLGLTTTFFLYVFINIAMVMGLVPVVGVPLPLISYGGTAMLTLLFGFGLIMSVYIHRDVHIGRRGASDDV

Samples

Sample ID Description Type Environment
1 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
13 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
14 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
15 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
20 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
23 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
24 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
27 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
28 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
29 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
30 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
31 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
38 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
41 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
42 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
61 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
64 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
65 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
66 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
67 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
68 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
69 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
70 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
71 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
72 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
73 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
74 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
75 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
76 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
77 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
78 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
79 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
80 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
81 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
82 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
83 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
84 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
85 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
86 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
87 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
88 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
89 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
90 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
95 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
96 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
97 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
98 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
99 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
102 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
103 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
104 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
105 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
106 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
107 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
108 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
109 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
110 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
111 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
112 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
113 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
114 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
115 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
116 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
117 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
118 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
119 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
120 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
121 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
122 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
123 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
124 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
125 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
126 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
127 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
128 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
129 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
130 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
131 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
132 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
133 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
134 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
135 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
136 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
137 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.87
Metatranscriptomes 0
Isolates 2.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.09
Nodule 0.53
Rhizoplane 5.32
Rhizosphere 70.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213872_10038544 3300021361 Bacteria 2181
2 SwRhRL2b_contig_3939249 2162886007 Bacteria 12044
3 rootH2_10030787 3300003320 Bacteria 43928
4 Ga0065704_10070144 3300005289 Bacteria 333223
5 Ga0065707_10084496 3300005295 Bacteria 7140
6 Ga0070658_10001816 3300005327 Bacteria 17961
7 Ga0070658_10004180 3300005327 Bacteria 11812
8 Ga0070658_10005205 3300005327 Bacteria 10582
9 Ga0070680_100248227 3300005336 Bacteria 1505
10 Ga0070671_100000570 3300005355 Bacteria 26189
11 Ga0070671_100011898 3300005355 Bacteria 6998
12 Ga0070671_100119676 3300005355 Bacteria 2216
13 Ga0070671_100272542 3300005355 Bacteria 1439
14 Ga0070659_100019849 3300005366 Bacteria 5101
15 Ga0070667_100000416 3300005367 Bacteria 45555
16 Ga0070667_100179932 3300005367 Bacteria 1870
17 Ga0070714_100001246 3300005435 Bacteria 18371
18 Ga0070714_100151719 3300005435 Bacteria 2089
19 Ga0070679_100068189 3300005530 Bacteria 3549
20 Ga0070665_100001006 3300005548 Bacteria 35713
21 Ga0070665_100041134 3300005548 Bacteria 4645
22 Ga0068855_100026675 3300005563 Bacteria 6913
23 Ga0068855_100407700 3300005563 Bacteria 1489
24 Ga0068857_100222669 3300005577 Bacteria 1724
25 Ga0068856_100130275 3300005614 Bacteria 2520
26 Ga0068856_100351001 3300005614 Bacteria 1494
27 Ga0068852_100000219 3300005616 Bacteria 38833
28 Ga0068859_100025120 3300005617 Bacteria 5979
29 Ga0068859_100342722 3300005617 Bacteria 1589
30 Ga0068864_100009159 3300005618 Bacteria 8161
31 Ga0068864_100079665 3300005618 Bacteria 2868
32 Ga0068863_100011363 3300005841 Bacteria 8622
33 Ga0068863_100011972 3300005841 Bacteria 8383
34 Ga0068858_100002181 3300005842 Bacteria 19841
35 Ga0068860_100003443 3300005843 Bacteria 16282
36 Ga0075368_10008172 3300006042 Bacteria 3718
37 Ga0075363_100030842 3300006048 Bacteria 2777
38 Ga0075364_10198576 3300006051 Bacteria 1359
39 Ga0075432_10000544 3300006058 Bacteria 11327
40 Ga0075362_10000003 3300006177 Bacteria 171099
41 Ga0075362_10000493 3300006177 Bacteria 11500
42 Ga0075362_10048462 3300006177 Bacteria 1896
43 Ga0075367_10001327 3300006178 Bacteria 10487
44 Ga0075369_10000223 3300006186 Bacteria 16746
45 Ga0075369_10001565 3300006186 Bacteria 7848
46 Ga0075366_10000023 3300006195 Bacteria 53503
47 Ga0075370_10000097 3300006353 Bacteria 27295
48 Ga0075370_10011030 3300006353 Bacteria 4739
49 Ga0075436_100016664 3300006914 Bacteria 5030
50 Ga0097620_100025120 3300006931 Bacteria 5979
51 Ga0097620_100342725 3300006931 Bacteria 1589
52 Ga0105240_10010966 3300009093 Bacteria 12692
53 Ga0105245_10178308 3300009098 Bacteria 2028
54 Ga0105248_10033921 3300009177 Bacteria 5704
55 Ga0105238_10042624 3300009551 Bacteria 4595
56 Ga0105249_10426501 3300009553 Bacteria 1361
57 Ga0157373_10025084 3300013100 Bacteria 4316
58 Ga0163162_10023040 3300013306 Bacteria 6142
59 Ga0163162_10256623 3300013306 Bacteria 1880
60 Ga0182008_10025663 3300014497 Bacteria 2993
61 Ga0213872_10000374 3300021361 Bacteria 37611
62 Ga0213872_10003740 3300021361 Bacteria 8309
63 Ga0207680_10129929 3300025903 Bacteria 1659
64 Ga0207705_10000004 3300025909 Bacteria 705756
65 Ga0207695_10012897 3300025913 Bacteria 10002
66 Ga0207693_10151506 3300025915 Bacteria 1824
67 Ga0207660_10194314 3300025917 Bacteria 1582
68 Ga0207681_10000232 3300025923 Bacteria 43369
69 Ga0207694_10019108 3300025924 Bacteria 5180
70 Ga0207664_10002182 3300025929 Bacteria 12881
71 Ga0207644_10000003 3300025931 Bacteria 585905
72 Ga0207644_10002241 3300025931 Bacteria 12541
73 Ga0207644_10016621 3300025931 Bacteria 4953
74 Ga0207690_10233932 3300025932 Bacteria 1412
75 Ga0207706_10025481 3300025933 Bacteria 5298
76 Ga0207711_10085283 3300025941 Bacteria 2767
77 Ga0207667_10347461 3300025949 Bacteria 1513
78 Ga0207658_10002291 3300025986 Bacteria 14138
79 Ga0207703_10002391 3300026035 Bacteria 16315
80 Ga0207703_10238655 3300026035 Bacteria 1633
81 Ga0207702_10143832 3300026078 Bacteria 2161
82 Ga0207641_10012652 3300026088 Bacteria 6919
83 Ga0207698_10000196 3300026142 Bacteria 37797
84 Ga0207698_10005841 3300026142 Bacteria 7644
85 Ga0207698_10044510 3300026142 Bacteria 3336
86 Ga0207698_10208008 3300026142 Bacteria 1758
87 Ga0209813_10000846 3300027866 Bacteria 6912
88 Ga0268266_10003933 3300028379 Bacteria 14443
89 Ga0268264_10025270 3300028381 Bacteria 4852
90 Ga0265316_10027376 3300031344 Bacteria 4722
91 Ga0265313_10018412 3300031595 Bacteria 3922
92 Ga0316579_10030510 3300031691 Bacteria 2464
93 Ga0265314_10004885 3300031711 Bacteria 12258
94 Ga0265314_10006197 3300031711 Bacteria 10621
95 Ga0265314_10027562 3300031711 Bacteria 4253
96 Ga0265314_10083596 3300031711 Bacteria 2098
97 Ga0316576_10005928 3300031727 Bacteria 7542
98 Ga0316576_10012506 3300031727 Bacteria 5608
99 Ga0316577_10003325 3300031733 Bacteria 8102
100 Ga0307414_10217828 3300032004 Bacteria 1565
101 Ga0316583_10004210 3300032133 Bacteria 5120
102 Ga0316580_10014424 3300032139 Bacteria 2413
103 Ga0373923_0038138 3300035111 Bacteria 1968
104 Ga0373955_0015673 3300035172 Bacteria 3716
105 Ga0373937_0008964 3300036401 Bacteria 8685
106 Ga0373937_0016515 3300036401 Bacteria 6558
107 Ga0316584_0008768 3300036712 Bacteria 6983
108 Ga0395899_0059331 3300037312 Bacteria 2820
109 Ga0395900_0132634 3300037418 Bacteria 2552
110 Ga0395900_0303169 3300037418 Bacteria 1583
111 Ga0395898_0081067 3300037466 Bacteria 3129
112 Ga0395901_0079162 3300038443 Bacteria 3431
113 Ga0395901_0237936 3300038443 Bacteria 1900
114 Ga0395901_0398028 3300038443 Bacteria 1415
115 Ga0436365_0813439 3300039437 Bacteria 2942
116 Ga0436360_1016062 3300039438 Bacteria 1488
117 Ga0436361_0183770 3300039447 Bacteria 1487
118 Ga0436361_0194413 3300039447 Bacteria 1982
119 Ga0436361_0265235 3300039447 Bacteria 19992
120 Ga0436361_0726540 3300039447 Bacteria 1594
121 Ga0436361_0753918 3300039447 Bacteria 8409
122 Ga0436361_0891718 3300039447 Bacteria 28099
123 Ga0436361_0903663 3300039447 Bacteria 5116
124 Ga0436361_1188402 3300039447 Bacteria 6031
125 Ga0439432_006682 3300042006 Bacteria 4109
126 Ga0451577_0046923 3300042876 Bacteria 3863
127 Ga0453683_0024569 3300044673 Bacteria 3833
128 Ga0453684_0074714 3300044712 Bacteria 4265
129 Ga0453684_0476290 3300044712 Bacteria 1386
130 Ga0466959_0143800 3300045049 Bacteria 1684
131 Ga0451576_0000007 3300045051 Bacteria 782228
132 Ga0451576_0000786 3300045051 Bacteria 62393
133 Ga0466958_0000376 3300045836 Bacteria 18142
134 Ga0495596_0005337 3300046500 Bacteria 6086
135 Ga0495596_0027202 3300046500 Bacteria 2301
136 Ga0495610_0002991 3300046512 Bacteria 13614
137 Ga0495643_0028400 3300046522 Bacteria 3137
138 Ga0495609_0071165 3300046538 Bacteria 1528
139 Ga0495668_0147344 3300046616 Bacteria 1289
140 Ga0495625_0006176 3300046660 Bacteria 10730
141 Ga0495680_0135786 3300047322 Bacteria 1804
142 Ga0495615_0000271 3300048090 Bacteria 9793
143 Ga0495626_0001347 3300048091 Bacteria 19841
144 Ga0496101_0084735 3300048904 Bacteria 2347
145 Ga0496102_0260341 3300048905 Bacteria 1635
146 Ga0496103_0021049 3300048906 Bacteria 3923
147 Ga0496105_0099251 3300048908 Bacteria 2404
148 Ga0496107_0000772 3300048910 Bacteria 18497
149 Ga0496109_0029269 3300048912 Bacteria 4932
150 Ga0496109_0354493 3300048912 Bacteria 1386
151 Ga0496110_0200214 3300048913 Bacteria 1814
152 Ga0496111_0095122 3300048914 Bacteria 2185
153 Ga0496112_0170080 3300048915 Bacteria 2144
154 Ga0496116_0000089 3300048919 Bacteria 213129
155 Ga0496118_0189725 3300048921 Bacteria 1231
156 Ga0496122_0001080 3300048925 Bacteria 47324
157 Ga0496123_0000576 3300048926 Bacteria 62722
158 Ga0496124_0140876 3300048927 Bacteria 1903
159 Ga0496126_0004867 3300048929 Bacteria 15728
160 Ga0501047_0124261 3300049581 Bacteria 2461
161 Ga0501083_0011519 3300049744 Bacteria 6204
162 nmdc:mga03683_1800_c1 3300050489 Bacteria 6499
163 nmdc:mga03683_22_c1 3300050489 Bacteria 82016
164 nmdc:mga03683_8938_c1 3300050489 Bacteria 3543
165 nmdc:mga03n38_390_c1 3300050490 Bacteria 10841
166 nmdc:mga00v17_26889_c1 3300050491 Bacteria 3356
167 nmdc:mga0k408_25_c1 3300050493 Bacteria 96034
168 nmdc:mga06z11_219_c1 3300050494 Bacteria 22852
169 nmdc:mga04h51_1399_c1 3300050495 Bacteria 5573
170 nmdc:mga07m45_4_c1 3300050496 Bacteria 409607
171 nmdc:mga07m45_7559_c1 3300050496 Bacteria 5556
172 nmdc:mga07m45_8_c1 3300050496 Bacteria 214050
173 nmdc:mga08x19_56355_c1 3300050514 Bacteria 2536
174 nmdc:mga0sz30_38_c1 3300050516 Bacteria 47836
175 Ga0500647_0092393 3300053091 Bacteria 1448
176 Ga0500607_003390 3300053121 Bacteria 11710
177 Ga0500608_008558 3300053122 Bacteria 4310
178 Ga0500642_0001834 3300053130 Bacteria 6132
179 Ga0500564_004457 3300053138 Bacteria 5608
180 Ga0500567_020858 3300053723 Bacteria 3146
181 Ga0500625_000018 3300053729 Bacteria 94860
182 Ga0500645_017415 3300053730 Bacteria 2253
183 Ga0500645_027132 3300053730 Bacteria 1738
184 Ga0501082_0178558 3300060353 Bacteria 1846
185 2511129963 2510917021 Bacteria 5705459
186 2739650172 2739367664 Bacteria 4114334
187 2740028645 2739367865 Bacteria 4114482
188 2842336196 2842333319 Bacteria 8899485
189 Ga0213872_10038544
190 SwRhRL2b_contig_3939249
191 rootH2_10030787
192 Ga0065704_10070144
193 Ga0065707_10084496
194 Ga0070658_10001816
195 Ga0070658_10004180
196 Ga0070658_10005205
197 Ga0070680_100248227
198 Ga0070671_100000570
199 Ga0070671_100011898
200 Ga0070671_100119676
201 Ga0070671_100272542
202 Ga0070659_100019849
203 Ga0070667_100000416
204 Ga0070667_100179932
205 Ga0070714_100001246
206 Ga0070714_100151719
207 Ga0070679_100068189
208 Ga0070665_100001006
209 Ga0070665_100041134
210 Ga0068855_100026675
211 Ga0068855_100407700
212 Ga0068857_100222669
213 Ga0068856_100130275
214 Ga0068856_100351001
215 Ga0068852_100000219
216 Ga0068859_100025120
217 Ga0068859_100342722
218 Ga0068864_100009159
219 Ga0068864_100079665
220 Ga0068863_100011363
221 Ga0068863_100011972
222 Ga0068858_100002181
223 Ga0068860_100003443
224 Ga0075368_10008172
225 Ga0075363_100030842
226 Ga0075364_10198576
227 Ga0075432_10000544
228 Ga0075362_10000003
229 Ga0075362_10000493
230 Ga0075362_10048462
231 Ga0075367_10001327
232 Ga0075369_10000223
233 Ga0075369_10001565
234 Ga0075366_10000023
235 Ga0075370_10000097
236 Ga0075370_10011030
237 Ga0075436_100016664
238 Ga0097620_100025120
239 Ga0097620_100342725
240 Ga0105240_10010966
241 Ga0105245_10178308
242 Ga0105248_10033921
243 Ga0105238_10042624
244 Ga0105249_10426501
245 Ga0157373_10025084
246 Ga0163162_10023040
247 Ga0163162_10256623
248 Ga0182008_10025663
249 Ga0213872_10000374
250 Ga0213872_10003740
251 Ga0207680_10129929
252 Ga0207705_10000004
253 Ga0207695_10012897
254 Ga0207693_10151506
255 Ga0207660_10194314
256 Ga0207681_10000232
257 Ga0207694_10019108
258 Ga0207664_10002182
259 Ga0207644_10000003
260 Ga0207644_10002241
261 Ga0207644_10016621
262 Ga0207690_10233932
263 Ga0207706_10025481
264 Ga0207711_10085283
265 Ga0207667_10347461
266 Ga0207658_10002291
267 Ga0207703_10002391
268 Ga0207703_10238655
269 Ga0207702_10143832
270 Ga0207641_10012652
271 Ga0207698_10000196
272 Ga0207698_10005841
273 Ga0207698_10044510
274 Ga0207698_10208008
275 Ga0209813_10000846
276 Ga0268266_10003933
277 Ga0268264_10025270
278 Ga0265316_10027376
279 Ga0265313_10018412
280 Ga0316579_10030510
281 Ga0265314_10004885
282 Ga0265314_10006197
283 Ga0265314_10027562
284 Ga0265314_10083596
285 Ga0316576_10005928
286 Ga0316576_10012506
287 Ga0316577_10003325
288 Ga0307414_10217828
289 Ga0316583_10004210
290 Ga0316580_10014424
291 Ga0373923_0038138
292 Ga0373955_0015673
293 Ga0373937_0008964
294 Ga0373937_0016515
295 Ga0316584_0008768
296 Ga0395899_0059331
297 Ga0395900_0132634
298 Ga0395900_0303169
299 Ga0395898_0081067
300 Ga0395901_0079162
301 Ga0395901_0237936
302 Ga0395901_0398028
303 Ga0436365_0813439
304 Ga0436360_1016062
305 Ga0436361_0183770
306 Ga0436361_0194413
307 Ga0436361_0265235
308 Ga0436361_0726540
309 Ga0436361_0753918
310 Ga0436361_0891718
311 Ga0436361_0903663
312 Ga0436361_1188402
313 Ga0439432_006682
314 Ga0451577_0046923
315 Ga0453683_0024569
316 Ga0453684_0074714
317 Ga0453684_0476290
318 Ga0466959_0143800
319 Ga0451576_0000007
320 Ga0451576_0000786
321 Ga0466958_0000376
322 Ga0495596_0005337
323 Ga0495596_0027202
324 Ga0495610_0002991
325 Ga0495643_0028400
326 Ga0495609_0071165
327 Ga0495668_0147344
328 Ga0495625_0006176
329 Ga0495680_0135786
330 Ga0495615_0000271
331 Ga0495626_0001347
332 Ga0496101_0084735
333 Ga0496102_0260341
334 Ga0496103_0021049
335 Ga0496105_0099251
336 Ga0496107_0000772
337 Ga0496109_0029269
338 Ga0496109_0354493
339 Ga0496110_0200214
340 Ga0496111_0095122
341 Ga0496112_0170080
342 Ga0496116_0000089
343 Ga0496118_0189725
344 Ga0496122_0001080
345 Ga0496123_0000576
346 Ga0496124_0140876
347 Ga0496126_0004867
348 Ga0501047_0124261
349 Ga0501083_0011519
350 nmdc:mga03683_1800_c1
351 nmdc:mga03683_22_c1
352 nmdc:mga03683_8938_c1
353 nmdc:mga03n38_390_c1
354 nmdc:mga00v17_26889_c1
355 nmdc:mga0k408_25_c1
356 nmdc:mga06z11_219_c1
357 nmdc:mga04h51_1399_c1
358 nmdc:mga07m45_4_c1
359 nmdc:mga07m45_7559_c1
360 nmdc:mga07m45_8_c1
361 nmdc:mga08x19_56355_c1
362 nmdc:mga0sz30_38_c1
363 Ga0500647_0092393
364 Ga0500607_003390
365 Ga0500608_008558
366 Ga0500642_0001834
367 Ga0500564_004457
368 Ga0500567_020858
369 Ga0500625_000018
370 Ga0500645_017415
371 Ga0500645_027132
372 Ga0501082_0178558
373 2511129963
374 2739650172
375 2740028645
376 2842336196

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

21

376

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.803 11 322
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7933 8 324
6pl6-assembly1.cif.gz_A structural coordination of polymerization and crosslinking by a peptidoglycan synthase complex 0.7664 8 324
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.7637 11 322
8tj3-assembly1.cif.gz_B structural basis of peptidoglycan synthesis by e. coli roda-pbp2 complex 0.746 9 324
ID Description Score Start End Superfamily
af_P26231_646_862_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.4075 156 328 1.20.120.230
6dv1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3835 155 321 1.20.120.230
6dv1A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3348 155 321 1.20.120.230
af_P26231_646_862_1.20.120.230 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3346 156 328 1.20.120.230
4iggA06 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Alpha-catenin/vinculin-like 0.3216 130 319 1.20.120.230
ID Description Score Start End GO Terms
AF-A0A4Q3CH28-F1-model_v4 Rod shape-determining protein RodA 0.9648 70 324 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A4Q3CH28-F1-model_v4 Rod shape-determining protein RodA 0.9575 70 324 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A090RL59-F1-model_v4 deleted 0.9494 73 322
AF-A0A3D0TMU4-F1-model_v4 Rod shape-determining protein RodA 0.9485 62 325 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-X1RF08-F1-model_v4 Rod shape-determining protein RodA 0.947 64 316 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301

Map