F289202

General Info

Members Datasets Scaffolds Average Seq Length
188 123 188 177

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10038890|Ga0099794_100388902
Length 206
Sequence MPTYGWAYEQFQVGRRLRQRYNFRFKKRGIPMKRPEPTEYAEFYAGYVSKVPGSDALGVLESQRLQMLQLFAGRSERDGNFRYAPGKWTVKEVLGHITDTERIFTYRALRIARGDQTPLPGFEQEDFVRNGAFSKRTLADLTEEFGLVRNASMALFRSFQEEAWPRRGVASQKEVTVRALAFITAGHQIHHRLILEERYFPAIPRA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
18 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
19 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
20 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
21 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
24 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
25 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
26 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
27 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
34 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
37 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
38 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
39 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
58 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
59 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
61 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
62 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
64 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
65 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
66 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
67 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
68 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
69 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
70 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
71 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
72 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
73 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
79 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
80 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
81 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
82 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
83 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
84 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
85 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
86 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
92 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
93 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
94 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
95 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
96 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
97 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
98 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
99 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
100 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
101 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
104 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
108 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
109 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
110 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
111 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
112 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
113 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
114 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
115 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
116 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
117 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
118 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
119 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
120 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
121 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
122 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
123 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.4
Metatranscriptomes 1.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.53
Rhizosphere 98.94
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10075763 3300005290 Bacteria 3771
2 Ga0065707_10158473 3300005295 Bacteria 1586
3 Ga0065707_10166302 3300005295 Bacteria 1520
4 Ga0065707_10564883 3300005295 Unclassified 712
5 Ga0070676_10319468 3300005328 Unclassified 1058
6 Ga0070680_100433514 3300005336 Unclassified 1122
7 Ga0070689_100000009 3300005340 Bacteria 238551
8 Ga0070668_100015016 3300005347 Bacteria 5784
9 Ga0070669_100447655 3300005353 Bacteria 1064
10 Ga0070675_100746422 3300005354 Bacteria 893
11 Ga0070709_10864650 3300005434 Unclassified 713
12 Ga0070714_100258476 3300005435 Unclassified 1612
13 Ga0070705_100135730 3300005440 Unclassified 1611
14 Ga0070694_100109462 3300005444 Bacteria 1966
15 Ga0070708_100151808 3300005445 Unclassified 2155
16 Ga0070681_10801040 3300005458 Unclassified 859
17 Ga0070698_100033207 3300005471 Bacteria 5344
18 Ga0070699_100187411 3300005518 Unclassified 1837
19 Ga0070695_100435862 3300005545 Unclassified 1001
20 Ga0070696_100212339 3300005546 Bacteria 1449
21 Ga0070704_100001164 3300005549 Bacteria 13729
22 Ga0070704_100119125 3300005549 Bacteria 2024
23 Ga0070704_100187334 3300005549 Unclassified 1660
24 Ga0070664_100329836 3300005564 Bacteria 1384
25 Ga0068858_100638425 3300005842 Bacteria 1034
26 Ga0068862_100057485 3300005844 Bacteria 3336
27 Ga0081539_10200576 3300005985 Unclassified 922
28 Ga0070716_100000352 3300006173 Bacteria 18800
29 Ga0075428_100003099 3300006844 Bacteria 18142
30 Ga0075431_100062505 3300006847 Bacteria 3842
31 Ga0075431_100071518 3300006847 Unclassified 3579
32 Ga0075431_100212339 3300006847 Unclassified 1976
33 Ga0075431_101768463 3300006847 Bacteria 574
34 Ga0075434_101438165 3300006871 Unclassified 699
35 Ga0075436_100009875 3300006914 Bacteria 6529
36 Ga0075436_100077308 3300006914 Bacteria 2305
37 Ga0075436_100140351 3300006914 Unclassified 1698
38 Ga0075435_100142565 3300007076 Bacteria 2011
39 Ga0099794_10005689 3300007265 Bacteria 5022
40 Ga0099794_10009094 3300007265 Bacteria 4155
41 Ga0099794_10014295 3300007265 Bacteria 3474
42 Ga0099794_10020209 3300007265 Bacteria 3011
43 Ga0099794_10025979 3300007265 Unclassified 2703
44 Ga0099794_10033952 3300007265 Bacteria 2400
45 Ga0099794_10038890 3300007265 Unclassified 2255
46 Ga0099794_10054950 3300007265 Bacteria 1923
47 Ga0099794_10055125 3300007265 Unclassified 1920
48 Ga0099794_10086283 3300007265 Unclassified 1554
49 Ga0099794_10310139 3300007265 Unclassified 818
50 Ga0099794_10345456 3300007265 Unclassified 774
51 Ga0099795_10166113 3300007788 Unclassified 914
52 Ga0099795_10304865 3300007788 Unclassified 701
53 Ga0114129_10015973 3300009147 Bacteria 10676
54 Ga0114129_11634493 3300009147 Bacteria 788
55 Ga0114129_11968558 3300009147 Bacteria 707
56 Ga0105242_10051399 3300009176 Bacteria 3358
57 Ga0105249_10001283 3300009553 Bacteria 22053
58 Ga0105249_10147103 3300009553 Unclassified 2264
59 Ga0105249_10272883 3300009553 Unclassified 1685
60 Ga0163162_10000784 3300013306 Bacteria 29548
61 Ga0163162_10231357 3300013306 Archaea 1979
62 Ga0157380_10217008 3300014326 Bacteria 1709
63 Ga0157380_10540124 3300014326 Bacteria 1141
64 Ga0157380_10565323 3300014326 Unclassified 1118
65 Ga0157380_11231482 3300014326 Unclassified 793
66 Ga0157379_10063828 3300014968 Bacteria 3292
67 Ga0224572_1018020 3300024225 Unclassified 1356
68 Ga0207699_10204585 3300025906 Bacteria 1339
69 Ga0207660_10134820 3300025917 Bacteria 1883
70 Ga0207646_10006919 3300025922 Bacteria 11643
71 Ga0207646_10281457 3300025922 Bacteria 1503
72 Ga0207681_11179095 3300025923 Unclassified 643
73 Ga0207659_10563695 3300025926 Bacteria 969
74 Ga0207664_10047098 3300025929 Unclassified 3386
75 Ga0207686_10229172 3300025934 Unclassified 1346
76 Ga0207670_10000010 3300025936 Bacteria 283265
77 Ga0207669_10082439 3300025937 Unclassified 2065
78 Ga0207665_10000102 3300025939 Bacteria 55304
79 Ga0207665_10330427 3300025939 Unclassified 1146
80 Ga0207712_10000586 3300025961 Bacteria 29417
81 Ga0207712_10097608 3300025961 Unclassified 2177
82 Ga0207668_10009544 3300025972 Bacteria 5822
83 Ga0207703_10597791 3300026035 Bacteria 1043
84 Ga0209969_1019089 3300027360 Bacteria 1016
85 Ga0209179_1037878 3300027512 Unclassified 1008
86 Ga0209999_1012312 3300027543 Bacteria 1549
87 Ga0209588_1002568 3300027671 Bacteria 4932
88 Ga0209588_1002955 3300027671 Unclassified 4672
89 Ga0209588_1017942 3300027671 Unclassified 2200
90 Ga0209588_1018760 3300027671 Unclassified 2154
91 Ga0209588_1024627 3300027671 Bacteria 1901
92 Ga0209588_1027478 3300027671 Unclassified 1811
93 Ga0209588_1041302 3300027671 Bacteria 1489
94 Ga0209974_10119672 3300027876 Unclassified 932
95 Ga0207428_10000234 3300027907 Bacteria 76592
96 Ga0265354_1000025 3300028016 Bacteria 23991
97 Ga0265354_1003749 3300028016 Bacteria 1660
98 Ga0268265_10110239 3300028380 Bacteria 2245
99 Ga0265338_10170405 3300028800 Bacteria 1671
100 Ga0265770_1001212 3300030878 Bacteria 3581
101 Ga0265770_1015912 3300030878 Bacteria 1149
102 Ga0265760_10233606 3300031090 Unclassified 631
103 Ga0265330_10353848 3300031235 Unclassified 620
104 Ga0265320_10061333 3300031240 Unclassified 1793
105 Ga0265325_10073184 3300031241 Bacteria 1716
106 Ga0265331_10003298 3300031250 Bacteria 10494
107 Ga0265316_10005678 3300031344 Bacteria 12069
108 Ga0307408_100010702 3300031548 Bacteria 6051
109 Ga0307408_100094823 3300031548 Unclassified 2261
110 Ga0307408_100112951 3300031548 Bacteria 2090
111 Ga0265342_10110056 3300031712 Bacteria 1560
112 Ga0307405_10057170 3300031731 Bacteria 2450
113 Ga0307405_10066725 3300031731 Unclassified 2295
114 Ga0307405_10082692 3300031731 Bacteria 2102
115 Ga0307413_10004856 3300031824 Bacteria 5907
116 Ga0307413_10031499 3300031824 Bacteria 2993
117 Ga0307413_10418037 3300031824 Bacteria 1055
118 Ga0307410_10013100 3300031852 Bacteria 4826
119 Ga0307410_10020926 3300031852 Bacteria 4014
120 Ga0307410_10075698 3300031852 Bacteria 2347
121 Ga0307410_10273392 3300031852 Bacteria 1322
122 Ga0307406_10025070 3300031901 Unclassified 3567
123 Ga0307407_10001151 3300031903 Bacteria 9275
124 Ga0307407_10074313 3300031903 Bacteria 2033
125 Ga0307412_10014568 3300031911 Bacteria 4641
126 Ga0307409_100024410 3300031995 Bacteria 4216
127 Ga0307409_100267192 3300031995 Unclassified 1573
128 Ga0307416_100014900 3300032002 Bacteria 5348
129 Ga0307416_100049519 3300032002 Bacteria 3341
130 Ga0307414_10004364 3300032004 Bacteria 7676
131 Ga0307414_10348941 3300032004 Bacteria 1269
132 Ga0307411_10150175 3300032005 Bacteria 1730
133 Ga0307411_10493398 3300032005 Bacteria 1034
134 Ga0307415_100029437 3300032126 Bacteria 3510
135 Ga0307415_100289931 3300032126 Bacteria 1350
136 Ga0307415_100450589 3300032126 Bacteria 1112
137 Ga0316212_1014789 3300033547 Bacteria 1103
138 Ga0373926_0000579 3300035083 Bacteria 9857
139 Ga0373943_0105401 3300035170 Bacteria 1480
140 Ga0373927_0006079 3300035695 Bacteria 8263
141 Ga0373947_0015575 3300035725 Unclassified 4367
142 Ga0373925_0001406 3300037068 Bacteria 20901
143 Ga0395899_0416736 3300037312 Unclassified 886
144 Ga0439434_0023458 3300042435 Bacteria 1858
145 Ga0451577_0130454 3300042876 Bacteria 2254
146 Ga0451577_1445377 3300042876 Unclassified 609
147 Ga0495580_0646063 3300046472 Unclassified 696
148 Ga0495630_0009221 3300046517 Bacteria 7095
149 Ga0495630_0025795 3300046517 Unclassified 4347
150 Ga0495666_0060612 3300046526 Bacteria 1808
151 Ga0495623_0084123 3300046679 Unclassified 1964
152 Ga0495624_0129605 3300046690 Bacteria 1547
153 Ga0495604_0516443 3300047317 Unclassified 773
154 Ga0495674_0023547 3300047319 Bacteria 5674
155 Ga0495675_0065942 3300047444 Bacteria 2289
156 Ga0496101_0073431 3300048904 Archaea 2513
157 Ga0501290_038142 3300049513 Unclassified 711
158 Ga0501034_0529348 3300049571 Bacteria 1090
159 Ga0501034_0852873 3300049571 Bacteria 801
160 Ga0501036_0233794 3300049572 Bacteria 1542
161 Ga0501037_0226173 3300049573 Bacteria 1315
162 Ga0501040_0085223 3300049576 Bacteria 2193
163 Ga0501046_0130953 3300049580 Bacteria 1903
164 Ga0501047_0145520 3300049581 Bacteria 2247
165 Ga0501048_0202492 3300049582 Bacteria 1407
166 Ga0501067_0016628 3300049583 Bacteria 4065
167 Ga0501068_0236996 3300049584 Bacteria 1161
168 Ga0501069_0153754 3300049585 Bacteria 1323
169 Ga0501071_0394678 3300049587 Bacteria 1056
170 Ga0501076_0026513 3300049592 Bacteria 4490
171 Ga0501259_017172 3300049688 Unclassified 1252
172 Ga0501221_217219 3300049704 Unclassified 538
173 Ga0501080_0318365 3300049742 Unclassified 1409
174 Ga0501212_110375 3300049851 Unclassified 524
175 nmdc:mga05p37_1603921_c1 3300050507 Bacteria 641
176 nmdc:mga05p37_7790_c1 3300050507 Bacteria 12642
177 nmdc:mga06r32_106452_c1 3300050510 Bacteria 2755
178 nmdc:mga06r32_18404_c1 3300050510 Bacteria 6397
179 nmdc:mga06r32_436576_c1 3300050510 Bacteria 1290
180 nmdc:mga06r32_77118_c1 3300050510 Unclassified 3237
181 nmdc:mga08y16_10_c1 3300050511 Bacteria 470512
182 nmdc:mga0n895_1385365_c1 3300050512 Unclassified 672
183 nmdc:mga0rr50_146828_c1 3300050513 Bacteria 1902
184 nmdc:mga08x19_119299_c1 3300050514 Unclassified 1767
185 nmdc:mga08x19_6178_c1 3300050514 Bacteria 7082
186 nmdc:mga08x19_6836_c1 3300050514 Bacteria 6774
187 Ga0501084_1058439 3300054114 Unclassified 681
188 Ga0501082_0079910 3300060353 Bacteria 2822

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049513 Ga0501290_038142 Ga0501290_038142_28_498 152
2 3300049704 Ga0501221_217219 Ga0501221_217219_41_511 152
3 3300049851 Ga0501212_110375 Ga0501212_110375_27_497 152
4 3300005295 Ga0065707_10166302 Ga0065707_101663022 169
5 3300005328 Ga0070676_10319468 Ga0070676_103194681 169
6 3300006871 Ga0075434_101438165 Ga0075434_1014381651 169
7 3300050512 nmdc:mga0n895_1385365_c1 nmdc:mga0n895_1385365_c1_99_608 169
8 3300005347 Ga0070668_100015016 Ga0070668_1000150163 170
9 3300006844 Ga0075428_100003099 Ga0075428_10000309917 170
10 3300006847 Ga0075431_100212339 Ga0075431_1002123392 170
11 3300009147 Ga0114129_11634493 Ga0114129_116344931 170
12 3300009147 Ga0114129_11968558 Ga0114129_119685581 170
13 3300009553 Ga0105249_10001283 Ga0105249_1000128310 170
14 3300013306 Ga0163162_10000784 Ga0163162_1000078419 170
15 3300014326 Ga0157380_10217008 Ga0157380_102170082 170
16 3300014326 Ga0157380_10540124 Ga0157380_105401242 170
17 3300025937 Ga0207669_10082439 Ga0207669_100824392 170
18 3300025961 Ga0207712_10000586 Ga0207712_100005868 170
19 3300025972 Ga0207668_10009544 Ga0207668_100095445 170
20 3300027876 Ga0209974_10119672 Ga0209974_101196722 170
21 3300027907 Ga0207428_10000234 Ga0207428_1000023469 170
22 3300050507 nmdc:mga05p37_1603921_c1 nmdc:mga05p37_1603921_c1_55_567 170
23 3300050510 nmdc:mga06r32_106452_c1 nmdc:mga06r32_106452_c1_1196_1711 170
24 3300050511 nmdc:mga08y16_10_c1 nmdc:mga08y16_10_c1_76488_77003 170
25 3300005295 Ga0065707_10158473 Ga0065707_101584732 171
26 3300005295 Ga0065707_10564883 Ga0065707_105648831 171
27 3300005353 Ga0070669_100447655 Ga0070669_1004476551 171
28 3300005354 Ga0070675_100746422 Ga0070675_1007464222 171
29 3300005564 Ga0070664_100329836 Ga0070664_1003298362 171
30 3300006173 Ga0070716_100000352 Ga0070716_1000003528 171
31 3300006914 Ga0075436_100009875 Ga0075436_1000098754 171
32 3300006914 Ga0075436_100077308 Ga0075436_1000773083 171
33 3300007076 Ga0075435_100142565 Ga0075435_1001425652 171
34 3300007265 Ga0099794_10005689 Ga0099794_100056893 171
35 3300007265 Ga0099794_10014295 Ga0099794_100142952 171
36 3300007265 Ga0099794_10033952 Ga0099794_100339522 171
37 3300007265 Ga0099794_10054950 Ga0099794_100549502 171
38 3300007265 Ga0099794_10055125 Ga0099794_100551252 171
39 3300007265 Ga0099794_10086283 Ga0099794_100862832 171
40 3300007265 Ga0099794_10310139 Ga0099794_103101391 171
41 3300007265 Ga0099794_10345456 Ga0099794_103454561 171
42 3300009553 Ga0105249_10272883 Ga0105249_102728832 171
43 3300014326 Ga0157380_10565323 Ga0157380_105653232 171
44 3300014326 Ga0157380_11231482 Ga0157380_112314822 171
45 3300025923 Ga0207681_11179095 Ga0207681_111790951 171
46 3300025926 Ga0207659_10563695 Ga0207659_105636951 171
47 3300025939 Ga0207665_10000102 Ga0207665_1000010218 171
48 3300027543 Ga0209999_1012312 Ga0209999_10123123 171
49 3300027671 Ga0209588_1002568 Ga0209588_10025684 171
50 3300027671 Ga0209588_1002955 Ga0209588_10029553 171
51 3300027671 Ga0209588_1018760 Ga0209588_10187602 171
52 3300027671 Ga0209588_1024627 Ga0209588_10246274 171
53 3300027671 Ga0209588_1041302 Ga0209588_10413022 171
54 3300035083 Ga0373926_0000579 Ga0373926_0000579_4181_4708 171
55 3300035170 Ga0373943_0105401 Ga0373943_0105401_100_627 171
56 3300035695 Ga0373927_0006079 Ga0373927_0006079_680_1207 171
57 3300035725 Ga0373947_0015575 Ga0373947_0015575_2005_2532 171
58 3300037068 Ga0373925_0001406 Ga0373925_0001406_17944_18471 171
59 3300042876 Ga0451577_0130454 Ga0451577_0130454_1528_2052 171
60 3300046517 Ga0495630_0025795 Ga0495630_0025795_665_1192 171
61 3300046526 Ga0495666_0060612 Ga0495666_0060612_904_1431 171
62 3300046690 Ga0495624_0129605 Ga0495624_0129605_159_686 171
63 3300049571 Ga0501034_0852873 Ga0501034_0852873_258_782 171
64 3300049572 Ga0501036_0233794 Ga0501036_0233794_453_971 171
65 3300049582 Ga0501048_0202492 Ga0501048_0202492_110_628 171
66 3300049587 Ga0501071_0394678 Ga0501071_0394678_477_995 171
67 3300049592 Ga0501076_0026513 Ga0501076_0026513_3016_3534 171
68 3300050513 nmdc:mga0rr50_146828_c1 nmdc:mga0rr50_146828_c1_288_815 171
69 3300050514 nmdc:mga08x19_6178_c1 nmdc:mga08x19_6178_c1_4670_5197 171
70 3300050514 nmdc:mga08x19_6836_c1 nmdc:mga08x19_6836_c1_5888_6415 171
71 3300060353 Ga0501082_0079910 Ga0501082_0079910_2136_2654 171
72 3300037312 Ga0395899_0416736 Ga0395899_0416736_123_650 172
73 3300042876 Ga0451577_1445377 Ga0451577_1445377_27_554 172
74 3300005336 Ga0070680_100433514 Ga0070680_1004335142 173
75 3300005440 Ga0070705_100135730 Ga0070705_1001357301 173
76 3300005444 Ga0070694_100109462 Ga0070694_1001094624 173
77 3300005471 Ga0070698_100033207 Ga0070698_1000332073 173
78 3300005518 Ga0070699_100187411 Ga0070699_1001874112 173
79 3300005545 Ga0070695_100435862 Ga0070695_1004358622 173
80 3300005546 Ga0070696_100212339 Ga0070696_1002123392 173
81 3300005549 Ga0070704_100001164 Ga0070704_1000011644 173
82 3300005549 Ga0070704_100187334 Ga0070704_1001873342 173
83 3300005844 Ga0068862_100057485 Ga0068862_1000574852 173
84 3300006847 Ga0075431_100071518 Ga0075431_1000715185 173
85 3300006847 Ga0075431_101768463 Ga0075431_1017684631 173
86 3300006914 Ga0075436_100140351 Ga0075436_1001403511 173
87 3300009553 Ga0105249_10147103 Ga0105249_101471032 173
88 3300024225 Ga0224572_1018020 Ga0224572_10180201 173
89 3300025917 Ga0207660_10134820 Ga0207660_101348203 173
90 3300025922 Ga0207646_10006919 Ga0207646_100069192 173
91 3300025922 Ga0207646_10281457 Ga0207646_102814572 173
92 3300025961 Ga0207712_10097608 Ga0207712_100976082 173
93 3300027360 Ga0209969_1019089 Ga0209969_10190892 173
94 3300028016 Ga0265354_1000025 Ga0265354_10000257 173
95 3300028016 Ga0265354_1003749 Ga0265354_10037492 173
96 3300028380 Ga0268265_10110239 Ga0268265_101102392 173
97 3300030878 Ga0265770_1001212 Ga0265770_10012124 173
98 3300030878 Ga0265770_1015912 Ga0265770_10159122 173
99 3300031090 Ga0265760_10233606 Ga0265760_102336061 173
100 3300031235 Ga0265330_10353848 Ga0265330_103538481 173
101 3300031240 Ga0265320_10061333 Ga0265320_100613332 173
102 3300031548 Ga0307408_100010702 Ga0307408_1000107024 173
103 3300031548 Ga0307408_100094823 Ga0307408_1000948234 173
104 3300031548 Ga0307408_100112951 Ga0307408_1001129513 173
105 3300031731 Ga0307405_10057170 Ga0307405_100571701 173
106 3300031731 Ga0307405_10066725 Ga0307405_100667252 173
107 3300031731 Ga0307405_10082692 Ga0307405_100826923 173
108 3300031824 Ga0307413_10004856 Ga0307413_100048565 173
109 3300031824 Ga0307413_10031499 Ga0307413_100314992 173
110 3300031824 Ga0307413_10418037 Ga0307413_104180372 173
111 3300031852 Ga0307410_10013100 Ga0307410_100131001 173
112 3300031852 Ga0307410_10020926 Ga0307410_100209265 173
113 3300031852 Ga0307410_10075698 Ga0307410_100756982 173
114 3300031852 Ga0307410_10273392 Ga0307410_102733922 173
115 3300031901 Ga0307406_10025070 Ga0307406_100250704 173
116 3300031903 Ga0307407_10001151 Ga0307407_100011518 173
117 3300031903 Ga0307407_10074313 Ga0307407_100743131 173
118 3300031911 Ga0307412_10014568 Ga0307412_100145684 173
119 3300031995 Ga0307409_100024410 Ga0307409_1000244104 173
120 3300031995 Ga0307409_100267192 Ga0307409_1002671922 173
121 3300032002 Ga0307416_100014900 Ga0307416_1000149001 173
122 3300032002 Ga0307416_100049519 Ga0307416_1000495194 173
123 3300032004 Ga0307414_10004364 Ga0307414_100043642 173
124 3300032004 Ga0307414_10348941 Ga0307414_103489412 173
125 3300032005 Ga0307411_10150175 Ga0307411_101501752 173
126 3300032005 Ga0307411_10493398 Ga0307411_104933982 173
127 3300032126 Ga0307415_100029437 Ga0307415_1000294372 173
128 3300032126 Ga0307415_100289931 Ga0307415_1002899312 173
129 3300032126 Ga0307415_100450589 Ga0307415_1004505892 173
130 3300033547 Ga0316212_1014789 Ga0316212_10147892 173
131 3300046517 Ga0495630_0009221 Ga0495630_0009221_3532_4065 173
132 3300046679 Ga0495623_0084123 Ga0495623_0084123_181_714 173
133 3300047317 Ga0495604_0516443 Ga0495604_0516443_68_601 173
134 3300047319 Ga0495674_0023547 Ga0495674_0023547_2169_2702 173
135 3300047444 Ga0495675_0065942 Ga0495675_0065942_1605_2138 173
136 3300049583 Ga0501067_0016628 Ga0501067_0016628_1674_2240 173
137 3300049584 Ga0501068_0236996 Ga0501068_0236996_174_740 173
138 3300049585 Ga0501069_0153754 Ga0501069_0153754_482_1048 173
139 3300049688 Ga0501259_017172 Ga0501259_017172_243_776 173
140 3300049742 Ga0501080_0318365 Ga0501080_0318365_406_939 173
141 3300050510 nmdc:mga06r32_436576_c1 nmdc:mga06r32_436576_c1_346_867 173
142 3300050510 nmdc:mga06r32_77118_c1 nmdc:mga06r32_77118_c1_552_1073 173
143 3300050514 nmdc:mga08x19_119299_c1 nmdc:mga08x19_119299_c1_1201_1722 173
144 3300054114 Ga0501084_1058439 Ga0501084_1058439_19_549 173
145 3300007265 Ga0099794_10009094 Ga0099794_100090942 174
146 3300027671 Ga0209588_1017942 Ga0209588_10179424 174
147 3300046472 Ga0495580_0646063 Ga0495580_0646063_103_660 174
148 3300049571 Ga0501034_0529348 Ga0501034_0529348_165_689 174
149 3300049573 Ga0501037_0226173 Ga0501037_0226173_522_1046 174
150 3300049580 Ga0501046_0130953 Ga0501046_0130953_191_715 174
151 3300049581 Ga0501047_0145520 Ga0501047_0145520_87_611 174
152 3300005290 Ga0065712_10075763 Ga0065712_100757633 175
153 3300005340 Ga0070689_100000009 Ga0070689_10000000931 175
154 3300005434 Ga0070709_10864650 Ga0070709_108646501 175
155 3300005435 Ga0070714_100258476 Ga0070714_1002584761 175
156 3300005445 Ga0070708_100151808 Ga0070708_1001518082 175
157 3300005458 Ga0070681_10801040 Ga0070681_108010402 175
158 3300005549 Ga0070704_100119125 Ga0070704_1001191252 175
159 3300005842 Ga0068858_100638425 Ga0068858_1006384252 175
160 3300005985 Ga0081539_10200576 Ga0081539_102005762 175
161 3300006847 Ga0075431_100062505 Ga0075431_1000625052 175
162 3300007265 Ga0099794_10020209 Ga0099794_100202092 175
163 3300007265 Ga0099794_10025979 Ga0099794_100259792 175
164 3300007265 Ga0099794_10038890 Ga0099794_100388902 175
165 3300007788 Ga0099795_10166113 Ga0099795_101661131 175
166 3300007788 Ga0099795_10304865 Ga0099795_103048651 175
167 3300009147 Ga0114129_10015973 Ga0114129_100159734 175
168 3300009176 Ga0105242_10051399 Ga0105242_100513994 175
169 3300013306 Ga0163162_10231357 Ga0163162_102313573 175
170 3300014968 Ga0157379_10063828 Ga0157379_100638283 175
171 3300025906 Ga0207699_10204585 Ga0207699_102045851 175
172 3300025929 Ga0207664_10047098 Ga0207664_100470981 175
173 3300025934 Ga0207686_10229172 Ga0207686_102291722 175
174 3300025936 Ga0207670_10000010 Ga0207670_1000001072 175
175 3300025939 Ga0207665_10330427 Ga0207665_103304271 175
176 3300026035 Ga0207703_10597791 Ga0207703_105977912 175
177 3300027512 Ga0209179_1037878 Ga0209179_10378781 175
178 3300027671 Ga0209588_1027478 Ga0209588_10274782 175
179 3300028800 Ga0265338_10170405 Ga0265338_101704052 175
180 3300031241 Ga0265325_10073184 Ga0265325_100731842 175
181 3300031250 Ga0265331_10003298 Ga0265331_100032988 175
182 3300031344 Ga0265316_10005678 Ga0265316_100056788 175
183 3300031712 Ga0265342_10110056 Ga0265342_101100562 175
184 3300042435 Ga0439434_0023458 Ga0439434_0023458_540_1082 175
185 3300048904 Ga0496101_0073431 Ga0496101_0073431_704_1252 175
186 3300049576 Ga0501040_0085223 Ga0501040_0085223_1149_1694 175
187 3300050507 nmdc:mga05p37_7790_c1 nmdc:mga05p37_7790_c1_6488_7033 175
188 3300050510 nmdc:mga06r32_18404_c1 nmdc:mga06r32_18404_c1_3055_3582 175

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

60

195

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2yqy-assembly2.cif.gz_B crystal structure of tt2238, a four-helix bundle protein 0.8458 29 170
2yqy-assembly1.cif.gz_A crystal structure of tt2238, a four-helix bundle protein 0.8384 29 170
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.8329 28 167
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.824 29 173
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8175 29 173
ID Description Score Start End Superfamily
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8458 29 170 1.20.120.450
2nsgA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8133 29 166 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.811 29 166 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.803 29 170 1.20.120.450
5cqvB01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7894 28 133 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A7W1GYM8-F1-model_v4 DinB family protein 0.9987 60 174
AF-A0A2W1LBV7-F1-model_v4 DinB family protein 0.9975 29 175
AF-A0A2N9LGH4-F1-model_v4 DinB-like domain-containing protein 0.9952 6 172
AF-A0A2V7EFM0-F1-model_v4 DinB family protein 0.9944 40 172
AF-A0A2V8H0Y2-F1-model_v4 DinB family protein 0.9935 1 163

Feature Viewer

pLDDT pTM Quality
93.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map