F288431

General Info

Members Datasets Scaffolds Average Seq Length
187 79 187 213

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_578673_c1|nmdc:mga08y16_578673_c1_307_1047
Length 246
Sequence VKHAIIIVTVDIRAYCPRCSIFLASWTGVELDKMRAMRNYLIPLYEVRHEQVVVNSRFIATLVPVFSTEEARAFIARIKKEFADASHNVPAYIIGGGNTVTEYFSDDGEPSGTAGRPALAVLRGSGLGDAAVVVTRYFGGTLLGTGGLVKAYTEATQLVVNAVGRGRRVRVHIALAVIPYNLLERVRLLVGRNKGEVLGEDFAADITMTLQFPVDSFEDFQNDLREISAGKLQAEIIESTEKVVAA

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
10 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
16 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
17 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
18 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
22 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
23 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
24 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
25 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
31 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
32 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
38 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
39 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
40 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
41 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
42 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
43 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
44 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
45 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
46 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
47 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
48 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
49 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
50 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
51 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
52 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
57 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
58 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
61 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
62 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
63 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
64 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
65 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
66 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
67 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
68 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
69 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
70 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
71 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
72 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
73 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
74 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
75 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
76 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
77 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
78 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
79 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.07
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 13.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_2885758 2162886006 Bacteria 4431
2 MRS1b_contig_6473045 2162886011 Bacteria 1696
3 rootH1_10173862 3300003323 Bacteria 1639
4 Ga0065704_10070392 3300005289 Bacteria 27224
5 Ga0065707_10000470 3300005295 Bacteria 51079
6 Ga0065707_10092377 3300005295 Bacteria 3781
7 Ga0065707_10158329 3300005295 Bacteria 1579
8 Ga0070690_100229489 3300005330 Bacteria 1304
9 Ga0070682_100586514 3300005337 Bacteria 878
10 Ga0070705_100775400 3300005440 Unclassified 760
11 Ga0070700_100090146 3300005441 Bacteria 1999
12 Ga0070708_100569433 3300005445 Bacteria 1068
13 Ga0070706_100485110 3300005467 Bacteria 1150
14 Ga0070707_100681148 3300005468 Bacteria 991
15 Ga0070698_100122318 3300005471 Bacteria 2561
16 Ga0070698_100559133 3300005471 Unclassified 1084
17 Ga0070699_100001388 3300005518 Bacteria 22270
18 Ga0070697_100463899 3300005536 Unclassified 1104
19 Ga0070704_100401413 3300005549 Bacteria 1170
20 Ga0068864_100021266 3300005618 Bacteria 5436
21 Ga0068866_10373168 3300005718 Bacteria 913
22 Ga0075428_100044945 3300006844 Bacteria 4853
23 Ga0075428_100228498 3300006844 Bacteria 2008
24 Ga0075428_101408858 3300006844 Unclassified 731
25 Ga0075430_100087529 3300006846 Unclassified 2607
26 Ga0075430_100288733 3300006846 Unclassified 1357
27 Ga0075431_100644569 3300006847 Bacteria 1040
28 Ga0075433_10301131 3300006852 Bacteria 1420
29 Ga0075434_100221704 3300006871 Unclassified 1911
30 Ga0075434_100566069 3300006871 Bacteria 1156
31 Ga0075429_100018563 3300006880 Bacteria 6023
32 Ga0075429_100101380 3300006880 Bacteria 2513
33 Ga0075429_100138189 3300006880 Bacteria 2133
34 Ga0111539_10405106 3300009094 Unclassified 1589
35 Ga0114129_10006640 3300009147 Bacteria 16426
36 Ga0114129_10011869 3300009147 Bacteria 12390
37 Ga0114129_10029497 3300009147 Bacteria 7771
38 Ga0114129_10071473 3300009147 Bacteria 4839
39 Ga0114129_10128113 3300009147 Bacteria 3488
40 Ga0114129_10137899 3300009147 Unclassified 3346
41 Ga0114129_10865869 3300009147 Bacteria 1147
42 Ga0114129_11239609 3300009147 Bacteria 927
43 Ga0114129_11414239 3300009147 Unclassified 858
44 Ga0105243_10429310 3300009148 Unclassified 1235
45 Ga0105249_10299643 3300009553 Bacteria 1612
46 Ga0105246_10061306 3300011119 Bacteria 2616
47 Ga0157378_10336994 3300013297 Unclassified 1470
48 Ga0213875_10040022 3300021388 Bacteria 2207
49 Ga0207684_10537682 3300025910 Bacteria 1000
50 Ga0207654_10300004 3300025911 Bacteria 1092
51 Ga0207646_10198178 3300025922 Bacteria 1813
52 Ga0207708_10270910 3300026075 Bacteria 1373
53 Ga0268265_10265260 3300028380 Bacteria 1529
54 Ga0268265_10619262 3300028380 Unclassified 1037
55 Ga0316575_10036933 3300031665 Unclassified 1923
56 Ga0316579_10011357 3300031691 Bacteria 3784
57 Ga0316579_10030301 3300031691 Bacteria 2472
58 Ga0316576_10065847 3300031727 Bacteria 2664
59 Ga0316576_10414978 3300031727 Bacteria 997
60 Ga0316578_10235891 3300031728 Bacteria 1098
61 Ga0316578_10289682 3300031728 Unclassified 980
62 Ga0316577_10071095 3300031733 Bacteria 1942
63 Ga0316577_10080507 3300031733 Bacteria 1821
64 Ga0316577_10125811 3300031733 Bacteria 1441
65 Ga0316577_10154163 3300031733 Bacteria 1295
66 Ga0316577_10160701 3300031733 Bacteria 1267
67 Ga0316577_10220209 3300031733 Bacteria 1073
68 Ga0316577_10492508 3300031733 Bacteria 697
69 Ga0307413_10884075 3300031824 Unclassified 758
70 Ga0307410_10146541 3300031852 Unclassified 1753
71 Ga0307406_10734417 3300031901 Unclassified 827
72 Ga0307412_10442983 3300031911 Bacteria 1068
73 Ga0307409_100175011 3300031995 Bacteria 1893
74 Ga0316574_0009079 3300035398 Bacteria 5556
75 Ga0316574_0136235 3300035398 Unclassified 1581
76 Ga0316574_0151485 3300035398 Unclassified 1494
77 Ga0316574_0176019 3300035398 Bacteria 1377
78 Ga0316574_0202786 3300035398 Unclassified 1274
79 Ga0316574_0453696 3300035398 Bacteria 803
80 Ga0316582_0000744 3300036647 Bacteria 13025
81 Ga0316582_0002334 3300036647 Bacteria 8882
82 Ga0316582_0036656 3300036647 Bacteria 3036
83 Ga0316582_0298477 3300036647 Unclassified 1107
84 Ga0316582_0359164 3300036647 Bacteria 1002
85 Ga0316584_0007672 3300036712 Bacteria 7403
86 Ga0316584_0007689 3300036712 Bacteria 7396
87 Ga0316584_0047160 3300036712 Bacteria 3218
88 Ga0316584_0048715 3300036712 Bacteria 3166
89 Ga0316584_0090204 3300036712 Bacteria 2294
90 Ga0316584_0205238 3300036712 Bacteria 1453
91 Ga0316584_0264769 3300036712 Unclassified 1253
92 Ga0436364_0001969 3300037853 Bacteria 8969
93 Ga0400490_27039 3300038726 Unclassified 3267
94 Ga0400490_52793 3300038726 Bacteria 1068
95 Ga0400489_15957 3300039093 Bacteria 103691
96 Ga0400489_54940 3300039093 Unclassified 1410
97 Ga0451853_1955715 3300041512 Bacteria 1467
98 Ga0451577_0001030 3300042876 Bacteria 40345
99 Ga0451577_0008318 3300042876 Bacteria 10096
100 Ga0451577_0032319 3300042876 Bacteria 4716
101 Ga0451577_0050653 3300042876 Unclassified 3707
102 Ga0451577_0255781 3300042876 Bacteria 1585
103 Ga0451577_0353257 3300042876 Bacteria 1333
104 Ga0466972_0000692 3300044658 Bacteria 16130
105 Ga0453683_0000540 3300044673 Bacteria 42176
106 Ga0453683_0082694 3300044673 Bacteria 2012
107 Ga0453683_0133468 3300044673 Bacteria 1565
108 Ga0453683_0498618 3300044673 Bacteria 790
109 Ga0453683_0512191 3300044673 Unclassified 779
110 Ga0466965_0021641 3300044683 Bacteria 3097
111 Ga0453684_0000591 3300044712 Bacteria 134711
112 Ga0453684_0000631 3300044712 Bacteria 127857
113 Ga0453684_0000670 3300044712 Bacteria 122645
114 Ga0453684_0000701 3300044712 Bacteria 119225
115 Ga0453684_0001158 3300044712 Bacteria 82247
116 Ga0453684_0001972 3300044712 Bacteria 52694
117 Ga0453684_0004295 3300044712 Bacteria 30378
118 Ga0453684_0013998 3300044712 Bacteria 12918
119 Ga0453684_0015548 3300044712 Bacteria 12017
120 Ga0453684_0018095 3300044712 Bacteria 10847
121 Ga0453684_0022190 3300044712 Bacteria 9435
122 Ga0453684_0044261 3300044712 Bacteria 5962
123 Ga0453684_0054498 3300044712 Bacteria 5208
124 Ga0453684_0069467 3300044712 Unclassified 4467
125 Ga0453684_0075690 3300044712 Unclassified 4229
126 Ga0453684_0078000 3300044712 Bacteria 4148
127 Ga0453684_0085407 3300044712 Unclassified 3921
128 Ga0453684_0094430 3300044712 Bacteria 3679
129 Ga0453684_0136602 3300044712 Bacteria 2934
130 Ga0453684_0136821 3300044712 Bacteria 2932
131 Ga0453684_0159378 3300044712 Bacteria 2671
132 Ga0453684_0218656 3300044712 Bacteria 2208
133 Ga0453684_0249184 3300044712 Bacteria 2040
134 Ga0453684_0262638 3300044712 Bacteria 1977
135 Ga0453684_0277540 3300044712 Bacteria 1912
136 Ga0453684_0419554 3300044712 Bacteria 1495
137 Ga0453684_0463003 3300044712 Bacteria 1409
138 Ga0453684_0629394 3300044712 Bacteria 1173
139 Ga0453684_0811508 3300044712 Bacteria 1008
140 Ga0453684_0875368 3300044712 Bacteria 964
141 Ga0453684_0927112 3300044712 Unclassified 931
142 Ga0453684_0954906 3300044712 Bacteria 915
143 Ga0466968_0002962 3300044735 Bacteria 6272
144 Ga0466960_0029278 3300044901 Bacteria 2526
145 Ga0451576_0023697 3300045051 Bacteria 6642
146 Ga0451576_0027236 3300045051 Bacteria 6141
147 Ga0451576_0071314 3300045051 Unclassified 3615
148 Ga0451576_0088228 3300045051 Bacteria 3226
149 Ga0451576_0102246 3300045051 Bacteria 2981
150 Ga0451576_0162052 3300045051 Bacteria 2334
151 Ga0451576_0223800 3300045051 Bacteria 1965
152 Ga0451576_0646901 3300045051 Unclassified 1111
153 Ga0451576_1280284 3300045051 Unclassified 764
154 Ga0496108_0000018 3300048911 Bacteria 234917
155 Ga0496110_0231129 3300048913 Bacteria 1682
156 Ga0496116_0155735 3300048919 Bacteria 1261
157 Ga0496117_0000275 3300048920 Bacteria 95947
158 Ga0496119_0001885 3300048922 Bacteria 24142
159 Ga0496119_0036470 3300048922 Bacteria 3209
160 Ga0496119_0336887 3300048922 Bacteria 734
161 Ga0496120_0000295 3300048923 Bacteria 83754
162 Ga0496120_0000360 3300048923 Bacteria 74606
163 Ga0496120_0014867 3300048923 Bacteria 5161
164 Ga0496120_0111023 3300048923 Bacteria 1432
165 Ga0496120_0179255 3300048923 Bacteria 1041
166 Ga0496122_0000008 3300048925 Bacteria 596403
167 Ga0496122_0000512 3300048925 Bacteria 80116
168 Ga0496123_0000053 3300048926 Bacteria 234794
169 Ga0496124_0035335 3300048927 Bacteria 4373
170 Ga0496125_0000045 3300048928 Bacteria 296312
171 Ga0496126_0000021 3300048929 Bacteria 472971
172 Ga0496126_0000492 3300048929 Bacteria 77802
173 Ga0501076_0819891 3300049592 Unclassified 768
174 nmdc:mga05p37_104983_c1 3300050507 Bacteria 3476
175 nmdc:mga05p37_138348_c1 3300050507 Unclassified 2984
176 nmdc:mga05p37_27733_c1 3300050507 Bacteria 6899
177 nmdc:mga05p37_37220_c1 3300050507 Bacteria 5967
178 nmdc:mga05p37_41552_c1 3300050507 Bacteria 5645
179 nmdc:mga09592_248789_c1 3300050508 Bacteria 1541
180 nmdc:mga09592_5197_c1 3300050508 Bacteria 10572
181 nmdc:mga09592_97258_c1 3300050508 Bacteria 2519
182 nmdc:mga06r32_603037_c1 3300050510 Bacteria 1069
183 nmdc:mga08y16_578673_c1 3300050511 Unclassified 1134
184 nmdc:mga0a205_294466_c1 3300050515 Bacteria 1497
185 nmdc:mga0a205_3102_c2 3300050515 Bacteria 10269
186 nmdc:mga0a205_612039_c1 3300050515 Unclassified 942
187 Ga0501084_0446747 3300054114 Bacteria 1093

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005441 Ga0070700_100090146 Ga0070700_1000901463 199
2 3300005718 Ga0068866_10373168 Ga0068866_103731681 199
3 3300009147 Ga0114129_11239609 Ga0114129_112396092 199
4 3300009148 Ga0105243_10429310 Ga0105243_104293102 199
5 3300009553 Ga0105249_10299643 Ga0105249_102996432 199
6 3300003323 rootH1_10173862 rootH1_101738622 200
7 3300044658 Ga0466972_0000692 Ga0466972_0000692_9980_10582 200
8 3300044683 Ga0466965_0021641 Ga0466965_0021641_189_791 200
9 3300044735 Ga0466968_0002962 Ga0466968_0002962_4378_4980 200
10 3300044901 Ga0466960_0029278 Ga0466960_0029278_1341_1943 200
11 3300005445 Ga0070708_100569433 Ga0070708_1005694331 201
12 3300021388 Ga0213875_10040022 Ga0213875_100400221 201
13 3300025911 Ga0207654_10300004 Ga0207654_103000042 201
14 3300037853 Ga0436364_0001969 Ga0436364_0001969_2587_3201 201
15 3300050515 nmdc:mga0a205_3102_c2 nmdc:mga0a205_3102_c2_5718_6323 201
16 3300006871 Ga0075434_100566069 Ga0075434_1005660692 202
17 3300048911 Ga0496108_0000018 Ga0496108_0000018_189560_190177 202
18 3300048913 Ga0496110_0231129 Ga0496110_0231129_124_741 202
19 3300031824 Ga0307413_10884075 Ga0307413_108840751 204
20 3300044712 Ga0453684_0085407 Ga0453684_0085407_721_1335 204
21 3300044712 Ga0453684_0000591 Ga0453684_0000591_50954_51571 205
22 3300044712 Ga0453684_0277540 Ga0453684_0277540_17_634 205
23 3300013297 Ga0157378_10336994 Ga0157378_103369942 206
24 3300009147 Ga0114129_10865869 Ga0114129_108658691 207
25 3300005330 Ga0070690_100229489 Ga0070690_1002294891 208
26 3300005337 Ga0070682_100586514 Ga0070682_1005865141 208
27 3300042876 Ga0451577_0008318 Ga0451577_0008318_4578_5207 209
28 3300044712 Ga0453684_0000670 Ga0453684_0000670_117421_118050 209
29 3300044712 Ga0453684_0463003 Ga0453684_0463003_546_1178 209
30 3300048919 Ga0496116_0155735 Ga0496116_0155735_287_955 209
31 3300048920 Ga0496117_0000275 Ga0496117_0000275_25480_26166 209
32 3300048922 Ga0496119_0001885 Ga0496119_0001885_2324_3013 209
33 3300048922 Ga0496119_0036470 Ga0496119_0036470_235_903 209
34 3300048922 Ga0496119_0336887 Ga0496119_0336887_55_711 209
35 3300048923 Ga0496120_0000295 Ga0496120_0000295_11282_11971 209
36 3300048923 Ga0496120_0000360 Ga0496120_0000360_22001_22663 209
37 3300048923 Ga0496120_0014867 Ga0496120_0014867_131_799 209
38 3300048923 Ga0496120_0111023 Ga0496120_0111023_405_1061 209
39 3300048925 Ga0496122_0000512 Ga0496122_0000512_38566_39234 209
40 3300048926 Ga0496123_0000053 Ga0496123_0000053_85728_86396 209
41 3300048927 Ga0496124_0035335 Ga0496124_0035335_110_778 209
42 3300048928 Ga0496125_0000045 Ga0496125_0000045_169468_170136 209
43 3300048929 Ga0496126_0000492 Ga0496126_0000492_72787_73473 209
44 3300005467 Ga0070706_100485110 Ga0070706_1004851101 210
45 3300005518 Ga0070699_100001388 Ga0070699_1000013886 210
46 3300006844 Ga0075428_100044945 Ga0075428_1000449453 210
47 3300006844 Ga0075428_100228498 Ga0075428_1002284982 210
48 3300006844 Ga0075428_101408858 Ga0075428_1014088581 210
49 3300006846 Ga0075430_100087529 Ga0075430_1000875294 210
50 3300006846 Ga0075430_100288733 Ga0075430_1002887331 210
51 3300006880 Ga0075429_100101380 Ga0075429_1001013804 210
52 3300006880 Ga0075429_100138189 Ga0075429_1001381892 210
53 3300009094 Ga0111539_10405106 Ga0111539_104051062 210
54 3300009147 Ga0114129_10006640 Ga0114129_1000664016 210
55 3300009147 Ga0114129_10071473 Ga0114129_100714734 210
56 3300025910 Ga0207684_10537682 Ga0207684_105376821 210
57 3300026075 Ga0207708_10270910 Ga0207708_102709102 210
58 3300035398 Ga0316574_0136235 Ga0316574_0136235_933_1571 210
59 3300035398 Ga0316574_0202786 Ga0316574_0202786_229_864 210
60 3300036712 Ga0316584_0007689 Ga0316584_0007689_2001_2636 210
61 3300038726 Ga0400490_27039 Ga0400490_27039_266_904 210
62 3300041512 Ga0451853_1955715 Ga0451853_1955715_348_980 210
63 3300042876 Ga0451577_0001030 Ga0451577_0001030_36523_37158 210
64 3300042876 Ga0451577_0032319 Ga0451577_0032319_1829_2464 210
65 3300042876 Ga0451577_0353257 Ga0451577_0353257_431_1066 210
66 3300044673 Ga0453683_0000540 Ga0453683_0000540_17664_18296 210
67 3300044673 Ga0453683_0082694 Ga0453683_0082694_1127_1762 210
68 3300044673 Ga0453683_0133468 Ga0453683_0133468_841_1473 210
69 3300044673 Ga0453683_0498618 Ga0453683_0498618_117_752 210
70 3300044712 Ga0453684_0000631 Ga0453684_0000631_109192_109827 210
71 3300044712 Ga0453684_0001158 Ga0453684_0001158_70835_71470 210
72 3300044712 Ga0453684_0001972 Ga0453684_0001972_14859_15491 210
73 3300044712 Ga0453684_0013998 Ga0453684_0013998_2636_3271 210
74 3300044712 Ga0453684_0022190 Ga0453684_0022190_349_984 210
75 3300044712 Ga0453684_0044261 Ga0453684_0044261_4736_5371 210
76 3300044712 Ga0453684_0054498 Ga0453684_0054498_596_1231 210
77 3300044712 Ga0453684_0078000 Ga0453684_0078000_2834_3499 210
78 3300044712 Ga0453684_0136602 Ga0453684_0136602_726_1361 210
79 3300044712 Ga0453684_0136821 Ga0453684_0136821_2076_2711 210
80 3300044712 Ga0453684_0218656 Ga0453684_0218656_134_769 210
81 3300044712 Ga0453684_0262638 Ga0453684_0262638_121_756 210
82 3300044712 Ga0453684_0419554 Ga0453684_0419554_625_1260 210
83 3300044712 Ga0453684_0875368 Ga0453684_0875368_90_725 210
84 3300044712 Ga0453684_0927112 Ga0453684_0927112_27_683 210
85 3300044712 Ga0453684_0954906 Ga0453684_0954906_148_789 210
86 3300045051 Ga0451576_0023697 Ga0451576_0023697_500_1135 210
87 3300045051 Ga0451576_0071314 Ga0451576_0071314_578_1210 210
88 3300045051 Ga0451576_0088228 Ga0451576_0088228_559_1215 210
89 3300045051 Ga0451576_0162052 Ga0451576_0162052_1493_2128 210
90 3300045051 Ga0451576_0223800 Ga0451576_0223800_163_795 210
91 3300045051 Ga0451576_0646901 Ga0451576_0646901_387_1022 210
92 3300045051 Ga0451576_1280284 Ga0451576_1280284_86_721 210
93 3300050507 nmdc:mga05p37_104983_c1 nmdc:mga05p37_104983_c1_2516_3151 210
94 3300050508 nmdc:mga09592_248789_c1 nmdc:mga09592_248789_c1_748_1383 210
95 3300050508 nmdc:mga09592_97258_c1 nmdc:mga09592_97258_c1_1715_2350 210
96 3300050511 nmdc:mga08y16_578673_c1 nmdc:mga08y16_578673_c1_307_1047 210
97 3300005295 Ga0065707_10092377 Ga0065707_100923773 211
98 3300005295 Ga0065707_10158329 Ga0065707_101583292 211
99 3300005471 Ga0070698_100122318 Ga0070698_1001223181 211
100 3300005536 Ga0070697_100463899 Ga0070697_1004638992 211
101 3300006847 Ga0075431_100644569 Ga0075431_1006445692 211
102 3300006880 Ga0075429_100018563 Ga0075429_1000185635 211
103 3300009147 Ga0114129_10011869 Ga0114129_100118697 211
104 3300009147 Ga0114129_10137899 Ga0114129_101378994 211
105 3300009147 Ga0114129_11414239 Ga0114129_114142392 211
106 3300011119 Ga0105246_10061306 Ga0105246_100613062 211
107 3300025922 Ga0207646_10198178 Ga0207646_101981782 211
108 3300028380 Ga0268265_10265260 Ga0268265_102652601 211
109 3300028380 Ga0268265_10619262 Ga0268265_106192622 211
110 3300031728 Ga0316578_10289682 Ga0316578_102896822 211
111 3300031852 Ga0307410_10146541 Ga0307410_101465411 211
112 3300031901 Ga0307406_10734417 Ga0307406_107344172 211
113 3300036647 Ga0316582_0002334 Ga0316582_0002334_1291_1929 211
114 3300036712 Ga0316584_0007672 Ga0316584_0007672_3803_4459 211
115 3300036712 Ga0316584_0090204 Ga0316584_0090204_539_1177 211
116 3300036712 Ga0316584_0264769 Ga0316584_0264769_368_1042 211
117 3300039093 Ga0400489_54940 Ga0400489_54940_710_1360 211
118 3300044712 Ga0453684_0000701 Ga0453684_0000701_46764_47402 211
119 3300044712 Ga0453684_0015548 Ga0453684_0015548_628_1263 211
120 3300044712 Ga0453684_0069467 Ga0453684_0069467_1750_2391 211
121 3300044712 Ga0453684_0075690 Ga0453684_0075690_576_1214 211
122 3300044712 Ga0453684_0094430 Ga0453684_0094430_1542_2177 211
123 3300044712 Ga0453684_0159378 Ga0453684_0159378_1533_2171 211
124 3300044712 Ga0453684_0811508 Ga0453684_0811508_311_973 211
125 3300045051 Ga0451576_0102246 Ga0451576_0102246_150_788 211
126 3300048923 Ga0496120_0179255 Ga0496120_0179255_241_903 211
127 3300048925 Ga0496122_0000008 Ga0496122_0000008_281403_282065 211
128 3300048929 Ga0496126_0000021 Ga0496126_0000021_312092_312754 211
129 3300049592 Ga0501076_0819891 Ga0501076_0819891_56_700 211
130 3300050507 nmdc:mga05p37_138348_c1 nmdc:mga05p37_138348_c1_1458_2096 211
131 3300050507 nmdc:mga05p37_27733_c1 nmdc:mga05p37_27733_c1_4735_5370 211
132 3300050508 nmdc:mga09592_5197_c1 nmdc:mga09592_5197_c1_5222_5857 211
133 3300050510 nmdc:mga06r32_603037_c1 nmdc:mga06r32_603037_c1_38_673 211
134 3300054114 Ga0501084_0446747 Ga0501084_0446747_211_855 211
135 2162886006 SwRhRL3b_contig_2885758 SwRhRL3b_0689.00000550 212
136 2162886011 MRS1b_contig_6473045 MRS1b_0503.00001680 212
137 3300005289 Ga0065704_10070392 Ga0065704_100703924 212
138 3300005295 Ga0065707_10000470 Ga0065707_1000047041 212
139 3300005440 Ga0070705_100775400 Ga0070705_1007754001 212
140 3300005468 Ga0070707_100681148 Ga0070707_1006811481 212
141 3300005471 Ga0070698_100559133 Ga0070698_1005591332 212
142 3300005549 Ga0070704_100401413 Ga0070704_1004014132 212
143 3300005618 Ga0068864_100021266 Ga0068864_1000212662 212
144 3300006852 Ga0075433_10301131 Ga0075433_103011312 212
145 3300006871 Ga0075434_100221704 Ga0075434_1002217043 212
146 3300009147 Ga0114129_10029497 Ga0114129_100294975 212
147 3300009147 Ga0114129_10128113 Ga0114129_101281132 212
148 3300031665 Ga0316575_10036933 Ga0316575_100369332 212
149 3300031691 Ga0316579_10011357 Ga0316579_100113572 212
150 3300031691 Ga0316579_10030301 Ga0316579_100303012 212
151 3300031727 Ga0316576_10065847 Ga0316576_100658473 212
152 3300031727 Ga0316576_10414978 Ga0316576_104149782 212
153 3300031728 Ga0316578_10235891 Ga0316578_102358911 212
154 3300031733 Ga0316577_10071095 Ga0316577_100710952 212
155 3300031733 Ga0316577_10080507 Ga0316577_100805072 212
156 3300031733 Ga0316577_10125811 Ga0316577_101258111 212
157 3300031733 Ga0316577_10154163 Ga0316577_101541632 212
158 3300031733 Ga0316577_10160701 Ga0316577_101607012 212
159 3300031733 Ga0316577_10220209 Ga0316577_102202092 212
160 3300031733 Ga0316577_10492508 Ga0316577_104925081 212
161 3300031911 Ga0307412_10442983 Ga0307412_104429831 212
162 3300031995 Ga0307409_100175011 Ga0307409_1001750113 212
163 3300035398 Ga0316574_0009079 Ga0316574_0009079_30_683 212
164 3300035398 Ga0316574_0151485 Ga0316574_0151485_515_1177 212
165 3300035398 Ga0316574_0176019 Ga0316574_0176019_627_1295 212
166 3300035398 Ga0316574_0453696 Ga0316574_0453696_98_748 212
167 3300036647 Ga0316582_0000744 Ga0316582_0000744_1968_2609 212
168 3300036647 Ga0316582_0036656 Ga0316582_0036656_1338_1979 212
169 3300036647 Ga0316582_0298477 Ga0316582_0298477_29_700 212
170 3300036647 Ga0316582_0359164 Ga0316582_0359164_324_977 212
171 3300036712 Ga0316584_0047160 Ga0316584_0047160_89_751 212
172 3300036712 Ga0316584_0048715 Ga0316584_0048715_1808_2467 212
173 3300036712 Ga0316584_0205238 Ga0316584_0205238_272_913 212
174 3300038726 Ga0400490_52793 Ga0400490_52793_55_717 212
175 3300039093 Ga0400489_15957 Ga0400489_15957_91543_92199 212
176 3300042876 Ga0451577_0050653 Ga0451577_0050653_723_1364 212
177 3300042876 Ga0451577_0255781 Ga0451577_0255781_66_707 212
178 3300044673 Ga0453683_0512191 Ga0453683_0512191_24_686 212
179 3300044712 Ga0453684_0004295 Ga0453684_0004295_898_1539 212
180 3300044712 Ga0453684_0018095 Ga0453684_0018095_5399_6049 212
181 3300044712 Ga0453684_0249184 Ga0453684_0249184_1338_1979 212
182 3300044712 Ga0453684_0629394 Ga0453684_0629394_385_1047 212
183 3300045051 Ga0451576_0027236 Ga0451576_0027236_2990_3631 212
184 3300050507 nmdc:mga05p37_37220_c1 nmdc:mga05p37_37220_c1_2512_3153 212
185 3300050507 nmdc:mga05p37_41552_c1 nmdc:mga05p37_41552_c1_3730_4371 212
186 3300050515 nmdc:mga0a205_294466_c1 nmdc:mga0a205_294466_c1_366_1007 212
187 3300050515 nmdc:mga0a205_612039_c1 nmdc:mga0a205_612039_c1_92_733 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09186

DUF1949

Domain of unknown function (DUF1949)

177

231

0.98

PF01205

UPF0029

Uncharacterized protein family UPF0029

54

160

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3grz-assembly1.cif.gz_B crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9451 137 174
3grz-assembly1.cif.gz_A crystal structure of ribosomal protein l11 methylase from lactobacillus delbrueckii subsp. bulgaricus 0.9423 137 174
7oya-assembly1.cif.gz_v2 cryo-em structure of the 1 hpf zebrafish embryo 80s ribosome 0.7978 135 202
2boa-assembly2.cif.gz_B human procarboxypeptidase a4. 0.7879 135 203
1jqg-assembly1.cif.gz_A crystal structure of the carboxypeptidase a from helicoverpa armigera 0.7515 135 200
ID Description Score Start End Superfamily
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9762 1 131 3.30.230.30
1vi7A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9731 135 202 3.30.70.240
af_Q6ZJC5_65_187_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9713 4 129 3.30.230.30
af_P27862_1_132_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9617 1 131 3.30.230.30
af_Q2G059_1_130_3.30.230.30 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Impact, N-terminal domain 0.9576 4 129 3.30.230.30
ID Description Score Start End GO Terms
AF-A0A3N5GJV4-F1-model_v4 YigZ family protein 1.001 4 108 GO:0005737
GO:0006446
AF-A0A3M1QYP6-F1-model_v4 YigZ family protein 0.989 2 96 GO:0005737
GO:0006446
AF-A0A7C2NIJ7-F1-model_v4 YigZ family protein 0.9848 3 129 GO:0005737
GO:0006446
AF-A0A3C1HQC0-F1-model_v4 deleted 0.9838 3 126
AF-A0A2R5L0V0-F1-model_v4 YigZ family protein 0.9838 19 123 GO:0005737
GO:0006446

Feature Viewer

pLDDT pTM Quality
94.38 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map